SHELL = /bin/sh
SUBDIRS = utils driver hacks hacks/glx
-TARFILES = README README.VMS README.debugging INSTALL \
+TARFILES = README README.VMS README.debugging INSTALL xscreensaver.lsm \
configure configure.in Makefile.in config.h.in \
config.h-vms install-sh setup.com config.guess \
- config.sub makevms.com screenblank.txt
+ config.sub makevms.com screenblank.txt \
+ xscreensaver.lsm.sh
TAR = gtar
COMPRESS = gzip --verbose --best
COMPRESS_EXT = gz
clean:
@$(MAKE_SUBDIR)
distclean: clean
- -rm -f Makefile config.status config.cache config.log *~ "#"*
+ -rm -f config.h Makefile config.status config.cache config.log *~ "#"*
@$(MAKE_SUBDIR)
dist: tar
tar:
@$(MAKE) distdepend ; \
sh config.status ; \
+ sh xscreensaver.lsm.sh > xscreensaver.lsm.$$$$ ; \
+ mv xscreensaver.lsm.$$$$ xscreensaver.lsm ; \
NAME=`sed -n \
's/[^0-9]*\([0-9]\.[0-9][0-9]*\).*/xscreensaver-\1/p' utils/version.h` ; \
rm -f $$NAME ; ln -s . $$NAME ; \
bubbles - condensation forms on your monitor, then pops.
deco - Generates Brady-Bunch-era wall paneling.
moire - Circular interference patterns.
+ moire2 - More moire.
kaleidescope - Groovy, man.
swirl - Swirly color-cycling patterns.
bouboule - Spinning bubbles on a transparent ball.
ant - A cellular automaton.
xjack - Simulates a schizophrenic typist.
xlyap - Calculates and displays Lyapunov exponents.
- escher - Draws some escher-like scenes (GLX only.)
gears - Draws interlocking rotating gears (GLX only.)
morph3d - Draws shiny shape-changing 3d forms (GLX only.)
superquadrics - More shiny shape-changing 3d forms (GLX only.)
pipes - Generates a field of intertwined plumbing (GLX only.)
rubik - Solves a Rubik's Cube (GLX only.)
sproingies - Marble Madness meets Q-Bert (GLX only.)
+ stairs - Draws Escher's infinite staircase (GLX only.)
+ cage - Draws Escher's impossible cage (GLX only.)
+ moebius - Draws Escher's Moebius Strip II (GLX only.)
All of these will pop up their own window unless given that -root option.
See their man pages for more details.
-- Jamie Zawinski <jwz@netscape.com>
\f
+Changes since 2.15: Made `flag' able to do XPM images.
+ New look for the xscreensaver logo (`xroger').
+ Fixed compilation error on Suns with adjunct passwords.
+ Got multi-architecture builds working again.
+ Some configure tweaks for building on HPUX and Solaris.
+ Fixed bug in decayscreen.
+ Fixed typo i passwd.c.
+ Made `cynosure' not die when colormap is full.
+Changes since 2.14: Added `cynosure' hack.
+ Added `moire2' hack.
+ Tweaked `erase.c' some more.
+ Made unfading a bit smoother.
+ Added `vidwhacker' hack (not installed by default.)
+ Added `stairs' hack.
+ Split `escher' into `cage' and `moebius', as per
+ xlockmore.
+ Changed subprocess handling to use sigaction() instead
+ of signal() if it's available (this is necessary for
+ SCO but should work fine on other systems too.)
+ Various other tweaks.
Changes since 2.13: Better fix for the Motif drag-and-die lossage.
Put in some kludges to work around a LessTif bug.
XScreenSaver is known to work with LessTif 0.82 now.
/* Define if you have the fcntl function. */
#undef HAVE_FCNTL
+/* Define if you have the sigaction function. */
+#undef HAVE_SIGACTION
+
/* Define if you have the <unistd.h> header file. */
#undef HAVE_UNISTD_H
ac_help="$ac_help
--with-sgivc-ext Include support for the SGI-VIDEO-CONTROL server
extension, if possible (this is the default).
- --without-sgivc-ext Do not compile in support for this extension."
+ --without-sgivc-ext Do not compile in support for this extension."
ac_help="$ac_help
Toolkit options:
fi
+echo $ac_n "checking for size_t""... $ac_c" 1>&6
+echo "configure:1533: checking for size_t" >&5
+if eval "test \"`echo '$''{'ac_cv_type_size_t'+set}'`\" = set"; then
+ echo $ac_n "(cached) $ac_c" 1>&6
+else
+ cat > conftest.$ac_ext <<EOF
+#line 1538 "configure"
+#include "confdefs.h"
+#include <sys/types.h>
+#if STDC_HEADERS
+#include <stdlib.h>
+#include <stddef.h>
+#endif
+EOF
+if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
+ egrep "size_t[^a-zA-Z_0-9]" >/dev/null 2>&1; then
+ rm -rf conftest*
+ ac_cv_type_size_t=yes
+else
+ rm -rf conftest*
+ ac_cv_type_size_t=no
+fi
+rm -f conftest*
+
+fi
+echo "$ac_t""$ac_cv_type_size_t" 1>&6
+if test $ac_cv_type_size_t = no; then
+ cat >> confdefs.h <<\EOF
+#define size_t unsigned
+EOF
+
+fi
+
echo $ac_n "checking return type of signal handlers""... $ac_c" 1>&6
-echo "configure:1533: checking return type of signal handlers" >&5
+echo "configure:1566: checking return type of signal handlers" >&5
if eval "test \"`echo '$''{'ac_cv_type_signal'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 1538 "configure"
+#line 1571 "configure"
#include "confdefs.h"
#include <sys/types.h>
#include <signal.h>
int i;
; return 0; }
EOF
-if { (eval echo configure:1555: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:1588: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_type_signal=void
else
EOF
-echo $ac_n "checking for size_t""... $ac_c" 1>&6
-echo "configure:1574: checking for size_t" >&5
-if eval "test \"`echo '$''{'ac_cv_type_size_t'+set}'`\" = set"; then
- echo $ac_n "(cached) $ac_c" 1>&6
-else
- cat > conftest.$ac_ext <<EOF
-#line 1579 "configure"
-#include "confdefs.h"
-#include <sys/types.h>
-#if STDC_HEADERS
-#include <stdlib.h>
-#include <stddef.h>
-#endif
-EOF
-if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
- egrep "size_t[^a-zA-Z_0-9]" >/dev/null 2>&1; then
- rm -rf conftest*
- ac_cv_type_size_t=yes
-else
- rm -rf conftest*
- ac_cv_type_size_t=no
-fi
-rm -f conftest*
-
-fi
-echo "$ac_t""$ac_cv_type_size_t" 1>&6
-if test $ac_cv_type_size_t = no; then
- cat >> confdefs.h <<\EOF
-#define size_t unsigned
-EOF
-
-fi
-
-
echo $ac_n "checking how to call gettimeofday""... $ac_c" 1>&6
-echo "configure:1609: checking how to call gettimeofday" >&5
+echo "configure:1608: checking how to call gettimeofday" >&5
if eval "test \"`echo '$''{'ac_cv_gettimeofday_args'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 1614 "configure"
+#line 1613 "configure"
#include "confdefs.h"
#include <stdlib.h>
#include <sys/time.h>
struct timeval tv; gettimeofday(&tv);
; return 0; }
EOF
-if { (eval echo configure:1622: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:1621: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_gettimeofday_args=1
else
cat conftest.$ac_ext >&5
rm -rf conftest*
cat > conftest.$ac_ext <<EOF
-#line 1630 "configure"
+#line 1629 "configure"
#include "confdefs.h"
#include <stdlib.h>
#include <sys/time.h>
gettimeofday(&tv, &tzp);
; return 0; }
EOF
-if { (eval echo configure:1639: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:1638: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_gettimeofday_args=2
else
for ac_func in select fcntl uname nice setpriority getcwd getwd putenv
do
echo $ac_n "checking for $ac_func""... $ac_c" 1>&6
-echo "configure:1679: checking for $ac_func" >&5
+echo "configure:1678: checking for $ac_func" >&5
if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 1684 "configure"
+#line 1683 "configure"
#include "confdefs.h"
/* System header to define __stub macros and hopefully few prototypes,
which can conflict with char $ac_func(); below. */
; return 0; }
EOF
-if { (eval echo configure:1707: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:1706: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_func_$ac_func=yes"
else
fi
done
+for ac_func in sigaction
+do
+echo $ac_n "checking for $ac_func""... $ac_c" 1>&6
+echo "configure:1733: checking for $ac_func" >&5
+if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then
+ echo $ac_n "(cached) $ac_c" 1>&6
+else
+ cat > conftest.$ac_ext <<EOF
+#line 1738 "configure"
+#include "confdefs.h"
+/* System header to define __stub macros and hopefully few prototypes,
+ which can conflict with char $ac_func(); below. */
+#include <assert.h>
+/* Override any gcc2 internal prototype to avoid an error. */
+/* We use char because int might match the return type of a gcc2
+ builtin and then its argument prototype would still apply. */
+char $ac_func();
+
+int main() {
+
+/* The GNU C library defines this for functions which it implements
+ to always fail with ENOSYS. Some functions are actually named
+ something starting with __ and the normal name is an alias. */
+#if defined (__stub_$ac_func) || defined (__stub___$ac_func)
+choke me
+#else
+$ac_func();
+#endif
+
+; return 0; }
+EOF
+if { (eval echo configure:1761: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+ rm -rf conftest*
+ eval "ac_cv_func_$ac_func=yes"
+else
+ echo "configure: failed program was:" >&5
+ cat conftest.$ac_ext >&5
+ rm -rf conftest*
+ eval "ac_cv_func_$ac_func=no"
+fi
+rm -f conftest*
+fi
+
+if eval "test \"`echo '$ac_cv_func_'$ac_func`\" = yes"; then
+ echo "$ac_t""yes" 1>&6
+ ac_tr_func=HAVE_`echo $ac_func | tr 'abcdefghijklmnopqrstuvwxyz' 'ABCDEFGHIJKLMNOPQRSTUVWXYZ'`
+ cat >> confdefs.h <<EOF
+#define $ac_tr_func 1
+EOF
+
+else
+ echo "$ac_t""no" 1>&6
+fi
+done
+
+
for ac_hdr in unistd.h
do
ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6
-echo "configure:1735: checking for $ac_hdr" >&5
+echo "configure:1790: checking for $ac_hdr" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 1740 "configure"
+#line 1795 "configure"
#include "confdefs.h"
#include <$ac_hdr>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:1745: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:1800: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
# Uses ac_ vars as temps to allow command line to override cache and checks.
# --without-x overrides everything else, but does not touch the cache.
echo $ac_n "checking for X""... $ac_c" 1>&6
-echo "configure:1797: checking for X" >&5
+echo "configure:1852: checking for X" >&5
# Check whether --with-x or --without-x was given.
if test "${with_x+set}" = set; then
# First, try using that file with no special directory specified.
cat > conftest.$ac_ext <<EOF
-#line 1859 "configure"
+#line 1914 "configure"
#include "confdefs.h"
#include <$x_direct_test_include>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:1864: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:1919: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
ac_save_LIBS="$LIBS"
LIBS="-l$x_direct_test_library $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 1933 "configure"
+#line 1988 "configure"
#include "confdefs.h"
int main() {
${x_direct_test_function}()
; return 0; }
EOF
-if { (eval echo configure:1940: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:1995: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
LIBS="$ac_save_LIBS"
# We can link X programs with no special library path.
case "`(uname -sr) 2>/dev/null`" in
"SunOS 5"*)
echo $ac_n "checking whether -R must be followed by a space""... $ac_c" 1>&6
-echo "configure:2046: checking whether -R must be followed by a space" >&5
+echo "configure:2101: checking whether -R must be followed by a space" >&5
ac_xsave_LIBS="$LIBS"; LIBS="$LIBS -R$x_libraries"
cat > conftest.$ac_ext <<EOF
-#line 2049 "configure"
+#line 2104 "configure"
#include "confdefs.h"
int main() {
; return 0; }
EOF
-if { (eval echo configure:2056: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2111: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
ac_R_nospace=yes
else
else
LIBS="$ac_xsave_LIBS -R $x_libraries"
cat > conftest.$ac_ext <<EOF
-#line 2072 "configure"
+#line 2127 "configure"
#include "confdefs.h"
int main() {
; return 0; }
EOF
-if { (eval echo configure:2079: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2134: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
ac_R_space=yes
else
# libraries were built with DECnet support. And karl@cs.umb.edu says
# the Alpha needs dnet_stub (dnet does not exist).
echo $ac_n "checking for dnet_ntoa in -ldnet""... $ac_c" 1>&6
-echo "configure:2111: checking for dnet_ntoa in -ldnet" >&5
+echo "configure:2166: checking for dnet_ntoa in -ldnet" >&5
ac_lib_var=`echo dnet'_'dnet_ntoa | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-ldnet $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2119 "configure"
+#line 2174 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
dnet_ntoa()
; return 0; }
EOF
-if { (eval echo configure:2130: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2185: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
if test $ac_cv_lib_dnet_dnet_ntoa = no; then
echo $ac_n "checking for dnet_ntoa in -ldnet_stub""... $ac_c" 1>&6
-echo "configure:2152: checking for dnet_ntoa in -ldnet_stub" >&5
+echo "configure:2207: checking for dnet_ntoa in -ldnet_stub" >&5
ac_lib_var=`echo dnet_stub'_'dnet_ntoa | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-ldnet_stub $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2160 "configure"
+#line 2215 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
dnet_ntoa()
; return 0; }
EOF
-if { (eval echo configure:2171: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2226: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
# The nsl library prevents programs from opening the X display
# on Irix 5.2, according to dickey@clark.net.
echo $ac_n "checking for gethostbyname""... $ac_c" 1>&6
-echo "configure:2200: checking for gethostbyname" >&5
+echo "configure:2255: checking for gethostbyname" >&5
if eval "test \"`echo '$''{'ac_cv_func_gethostbyname'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 2205 "configure"
+#line 2260 "configure"
#include "confdefs.h"
/* System header to define __stub macros and hopefully few prototypes,
which can conflict with char gethostbyname(); below. */
; return 0; }
EOF
-if { (eval echo configure:2228: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2283: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_func_gethostbyname=yes"
else
if test $ac_cv_func_gethostbyname = no; then
echo $ac_n "checking for gethostbyname in -lnsl""... $ac_c" 1>&6
-echo "configure:2249: checking for gethostbyname in -lnsl" >&5
+echo "configure:2304: checking for gethostbyname in -lnsl" >&5
ac_lib_var=`echo nsl'_'gethostbyname | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lnsl $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2257 "configure"
+#line 2312 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
gethostbyname()
; return 0; }
EOF
-if { (eval echo configure:2268: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2323: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
# -lsocket must be given before -lnsl if both are needed.
# We assume that if connect needs -lnsl, so does gethostbyname.
echo $ac_n "checking for connect""... $ac_c" 1>&6
-echo "configure:2298: checking for connect" >&5
+echo "configure:2353: checking for connect" >&5
if eval "test \"`echo '$''{'ac_cv_func_connect'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 2303 "configure"
+#line 2358 "configure"
#include "confdefs.h"
/* System header to define __stub macros and hopefully few prototypes,
which can conflict with char connect(); below. */
; return 0; }
EOF
-if { (eval echo configure:2326: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2381: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_func_connect=yes"
else
if test $ac_cv_func_connect = no; then
echo $ac_n "checking for connect in -lsocket""... $ac_c" 1>&6
-echo "configure:2347: checking for connect in -lsocket" >&5
+echo "configure:2402: checking for connect in -lsocket" >&5
ac_lib_var=`echo socket'_'connect | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lsocket $X_EXTRA_LIBS $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2355 "configure"
+#line 2410 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
connect()
; return 0; }
EOF
-if { (eval echo configure:2366: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2421: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
# gomez@mi.uni-erlangen.de says -lposix is necessary on A/UX.
echo $ac_n "checking for remove""... $ac_c" 1>&6
-echo "configure:2390: checking for remove" >&5
+echo "configure:2445: checking for remove" >&5
if eval "test \"`echo '$''{'ac_cv_func_remove'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 2395 "configure"
+#line 2450 "configure"
#include "confdefs.h"
/* System header to define __stub macros and hopefully few prototypes,
which can conflict with char remove(); below. */
; return 0; }
EOF
-if { (eval echo configure:2418: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2473: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_func_remove=yes"
else
if test $ac_cv_func_remove = no; then
echo $ac_n "checking for remove in -lposix""... $ac_c" 1>&6
-echo "configure:2439: checking for remove in -lposix" >&5
+echo "configure:2494: checking for remove in -lposix" >&5
ac_lib_var=`echo posix'_'remove | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lposix $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2447 "configure"
+#line 2502 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
remove()
; return 0; }
EOF
-if { (eval echo configure:2458: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2513: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
# BSDI BSD/OS 2.1 needs -lipc for XOpenDisplay.
echo $ac_n "checking for shmat""... $ac_c" 1>&6
-echo "configure:2482: checking for shmat" >&5
+echo "configure:2537: checking for shmat" >&5
if eval "test \"`echo '$''{'ac_cv_func_shmat'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 2487 "configure"
+#line 2542 "configure"
#include "confdefs.h"
/* System header to define __stub macros and hopefully few prototypes,
which can conflict with char shmat(); below. */
; return 0; }
EOF
-if { (eval echo configure:2510: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2565: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_func_shmat=yes"
else
if test $ac_cv_func_shmat = no; then
echo $ac_n "checking for shmat in -lipc""... $ac_c" 1>&6
-echo "configure:2531: checking for shmat in -lipc" >&5
+echo "configure:2586: checking for shmat in -lipc" >&5
ac_lib_var=`echo ipc'_'shmat | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lipc $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2539 "configure"
+#line 2594 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
shmat()
; return 0; }
EOF
-if { (eval echo configure:2550: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2605: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
# libraries we check for below, so use a different variable.
# --interran@uluru.Stanford.EDU, kb@cs.umb.edu.
echo $ac_n "checking for IceConnectionNumber in -lICE""... $ac_c" 1>&6
-echo "configure:2583: checking for IceConnectionNumber in -lICE" >&5
+echo "configure:2638: checking for IceConnectionNumber in -lICE" >&5
ac_lib_var=`echo ICE'_'IceConnectionNumber | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lICE $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2591 "configure"
+#line 2646 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
IceConnectionNumber()
; return 0; }
EOF
-if { (eval echo configure:2602: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2657: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
echo $ac_n "checking for X app-defaults directory""... $ac_c" 1>&6
-echo "configure:2639: checking for X app-defaults directory" >&5
+echo "configure:2694: checking for X app-defaults directory" >&5
if eval "test \"`echo '$''{'ac_cv_x_app_defaults'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 2766 "configure"
+#line 2821 "configure"
#include "confdefs.h"
#include <X11/XHPlib.h>
EOF
# Check for the availability of the XPointer typedef, and define it otherwise.
#
echo $ac_n "checking for XPointer""... $ac_c" 1>&6
-echo "configure:2787: checking for XPointer" >&5
+echo "configure:2842: checking for XPointer" >&5
if eval "test \"`echo '$''{'ac_cv_xpointer'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 2798 "configure"
+#line 2853 "configure"
#include "confdefs.h"
#include <X11/Xlib.h>
int main() {
XPointer foo = (XPointer) 0;
; return 0; }
EOF
-if { (eval echo configure:2805: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:2860: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_xpointer=yes
else
# Some versions of Slowlaris Motif require -lgen. But not all. Why?
echo $ac_n "checking for regcmp in -lgen""... $ac_c" 1>&6
-echo "configure:2857: checking for regcmp in -lgen" >&5
+echo "configure:2912: checking for regcmp in -lgen" >&5
ac_lib_var=`echo gen'_'regcmp | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lgen $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 2865 "configure"
+#line 2920 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
regcmp()
; return 0; }
EOF
-if { (eval echo configure:2876: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:2931: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/Xmu/Error.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/Xmu/Error.h""... $ac_c" 1>&6
-echo "configure:2913: checking for X11/Xmu/Error.h" >&5
+echo "configure:2968: checking for X11/Xmu/Error.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 2918 "configure"
+#line 2973 "configure"
#include "confdefs.h"
#include <X11/Xmu/Error.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:2923: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:2978: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
case "$host" in
*-sunos4*)
echo $ac_n "checking for the SunOS 4.1.x _get_wmShellWidgetClass bug""... $ac_c" 1>&6
-echo "configure:2967: checking for the SunOS 4.1.x _get_wmShellWidgetClass bug" >&5
+echo "configure:3022: checking for the SunOS 4.1.x _get_wmShellWidgetClass bug" >&5
if eval "test \"`echo '$''{'ac_cv_sunos_xmu_bug'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
# with X libraries because we know it's SunOS.
LDFLAGS="$LDFLAGS -lXmu -lXt -lX11 -lXext -lm"
cat > conftest.$ac_ext <<EOF
-#line 2980 "configure"
+#line 3035 "configure"
#include "confdefs.h"
int main() {
; return 0; }
EOF
-if { (eval echo configure:2987: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:3042: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
ac_cv_sunos_xmu_bug=no
else
echo "$ac_t""$ac_cv_sunos_xmu_bug" 1>&6
if test $ac_cv_sunos_xmu_bug = yes ; then
echo $ac_n "checking whether the compiler understands -static""... $ac_c" 1>&6
-echo "configure:3003: checking whether the compiler understands -static" >&5
+echo "configure:3058: checking whether the compiler understands -static" >&5
if eval "test \"`echo '$''{'ac_cv_ld_static'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
ac_save_LDFLAGS="$LDFLAGS"
LDFLAGS="$LDFLAGS -static"
cat > conftest.$ac_ext <<EOF
-#line 3010 "configure"
+#line 3065 "configure"
#include "confdefs.h"
int main() {
; return 0; }
EOF
-if { (eval echo configure:3017: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:3072: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
ac_cv_ld_static=yes
else
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/extensions/XScreenSaver.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/extensions/XScreenSaver.h""... $ac_c" 1>&6
-echo "configure:3063: checking for X11/extensions/XScreenSaver.h" >&5
+echo "configure:3118: checking for X11/extensions/XScreenSaver.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3068 "configure"
+#line 3123 "configure"
#include "confdefs.h"
#include <X11/extensions/XScreenSaver.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3073: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3128: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/extensions/scrnsaver.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/extensions/scrnsaver.h""... $ac_c" 1>&6
-echo "configure:3128: checking for X11/extensions/scrnsaver.h" >&5
+echo "configure:3183: checking for X11/extensions/scrnsaver.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3133 "configure"
+#line 3188 "configure"
#include "confdefs.h"
#include <X11/extensions/scrnsaver.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3138: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3193: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
LDFLAGS="$LDFLAGS -L$x_libraries"
fi
echo $ac_n "checking for XScreenSaverRegister in -lXext""... $ac_c" 1>&6
-echo "configure:3182: checking for XScreenSaverRegister in -lXext" >&5
+echo "configure:3237: checking for XScreenSaverRegister in -lXext" >&5
ac_lib_var=`echo Xext'_'XScreenSaverRegister | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lXext -lm $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 3190 "configure"
+#line 3245 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
XScreenSaverRegister()
; return 0; }
EOF
-if { (eval echo configure:3201: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:3256: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
LDFLAGS="$LDFLAGS -L$x_libraries"
fi
echo $ac_n "checking for XScreenSaverRegister in -lXExExt""... $ac_c" 1>&6
-echo "configure:3252: checking for XScreenSaverRegister in -lXExExt" >&5
+echo "configure:3307: checking for XScreenSaverRegister in -lXExExt" >&5
ac_lib_var=`echo XExExt'_'XScreenSaverRegister | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lXExExt -lX11 -lXext -lm $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 3260 "configure"
+#line 3315 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
XScreenSaverRegister()
; return 0; }
EOF
-if { (eval echo configure:3271: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:3326: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
LDFLAGS="$LDFLAGS -L$x_libraries"
fi
echo $ac_n "checking for XScreenSaverRegister in -lXss""... $ac_c" 1>&6
-echo "configure:3317: checking for XScreenSaverRegister in -lXss" >&5
+echo "configure:3372: checking for XScreenSaverRegister in -lXss" >&5
ac_lib_var=`echo Xss'_'XScreenSaverRegister | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lXss -lX11 -lXext -lm $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 3325 "configure"
+#line 3380 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
XScreenSaverRegister()
; return 0; }
EOF
-if { (eval echo configure:3336: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:3391: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/extensions/xidle.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/extensions/xidle.h""... $ac_c" 1>&6
-echo "configure:3397: checking for X11/extensions/xidle.h" >&5
+echo "configure:3452: checking for X11/extensions/xidle.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3402 "configure"
+#line 3457 "configure"
#include "confdefs.h"
#include <X11/extensions/xidle.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3407: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3462: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/extensions/XShm.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/extensions/XShm.h""... $ac_c" 1>&6
-echo "configure:3462: checking for X11/extensions/XShm.h" >&5
+echo "configure:3517: checking for X11/extensions/XShm.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3467 "configure"
+#line 3522 "configure"
#include "confdefs.h"
#include <X11/extensions/XShm.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3472: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3527: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "sys/ipc.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for sys/ipc.h""... $ac_c" 1>&6
-echo "configure:3506: checking for sys/ipc.h" >&5
+echo "configure:3561: checking for sys/ipc.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3511 "configure"
+#line 3566 "configure"
#include "confdefs.h"
#include <sys/ipc.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3516: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3571: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "sys/shm.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for sys/shm.h""... $ac_c" 1>&6
-echo "configure:3551: checking for sys/shm.h" >&5
+echo "configure:3606: checking for sys/shm.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3556 "configure"
+#line 3611 "configure"
#include "confdefs.h"
#include <sys/shm.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3561: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3616: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/extensions/XSGIvc.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/extensions/XSGIvc.h""... $ac_c" 1>&6
-echo "configure:3622: checking for X11/extensions/XSGIvc.h" >&5
+echo "configure:3677: checking for X11/extensions/XSGIvc.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3627 "configure"
+#line 3682 "configure"
#include "confdefs.h"
#include <X11/extensions/XSGIvc.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3632: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3687: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
LDFLAGS="$LDFLAGS -L$x_libraries"
fi
echo $ac_n "checking for XSGIvcQueryGammaMap in -lXsgivc""... $ac_c" 1>&6
-echo "configure:3675: checking for XSGIvcQueryGammaMap in -lXsgivc" >&5
+echo "configure:3730: checking for XSGIvcQueryGammaMap in -lXsgivc" >&5
ac_lib_var=`echo Xsgivc'_'XSGIvcQueryGammaMap | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lXsgivc -lXext -lX11 $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 3683 "configure"
+#line 3738 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
XSGIvcQueryGammaMap()
; return 0; }
EOF
-if { (eval echo configure:3694: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:3749: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "Xm/Xm.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for Xm/Xm.h""... $ac_c" 1>&6
-echo "configure:3797: checking for Xm/Xm.h" >&5
+echo "configure:3852: checking for Xm/Xm.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3802 "configure"
+#line 3857 "configure"
#include "confdefs.h"
#include <Xm/Xm.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3807: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3862: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/Xaw/Dialog.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/Xaw/Dialog.h""... $ac_c" 1>&6
-echo "configure:3845: checking for X11/Xaw/Dialog.h" >&5
+echo "configure:3900: checking for X11/Xaw/Dialog.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 3850 "configure"
+#line 3905 "configure"
#include "confdefs.h"
#include <X11/Xaw/Dialog.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:3855: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:3910: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
# XawViewportSetCoordinates in Viewport.h (R3 (or R4?) don't.)
if test $have_athena = yes ; then
echo $ac_n "checking for XawViewportSetCoordinates in Viewport.h""... $ac_c" 1>&6
-echo "configure:3930: checking for XawViewportSetCoordinates in Viewport.h" >&5
+echo "configure:3985: checking for XawViewportSetCoordinates in Viewport.h" >&5
if eval "test \"`echo '$''{'ac_cv_have_XawViewportSetCoordinates'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 3942 "configure"
+#line 3997 "configure"
#include "confdefs.h"
#include <X11/Xaw/Viewport.h>
EOF
have_lesstif=no
if test $have_motif = yes ; then
echo $ac_n "checking whether Motif is really LessTif""... $ac_c" 1>&6
-echo "configure:3971: checking whether Motif is really LessTif" >&5
+echo "configure:4026: checking whether Motif is really LessTif" >&5
if eval "test \"`echo '$''{'ac_cv_have_lesstif'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 3982 "configure"
+#line 4037 "configure"
#include "confdefs.h"
#include <Xm/Xm.h>
int main() {
long vers = LesstifVersion;
; return 0; }
EOF
-if { (eval echo configure:3989: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:4044: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_have_lesstif=yes
else
# It must be at least "GNU Lesstif 0.82".
# #### If you change this, also sync the warning message lower down.
echo $ac_n "checking whether LessTif is of a recent enough vintage""... $ac_c" 1>&6
-echo "configure:4014: checking whether LessTif is of a recent enough vintage" >&5
+echo "configure:4069: checking whether LessTif is of a recent enough vintage" >&5
if eval "test \"`echo '$''{'ac_cv_good_lesstif'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
ac_cv_good_lesstif=yes
else
cat > conftest.$ac_ext <<EOF
-#line 4029 "configure"
+#line 4084 "configure"
#include "confdefs.h"
#include <Xm/Xm.h>
int main() { exit(LesstifVersion < 82); }
EOF
-if { (eval echo configure:4034: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest && (./conftest; exit) 2>/dev/null
+if { (eval echo configure:4089: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest && (./conftest; exit) 2>/dev/null
then
ac_cv_good_lesstif=yes
else
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/xpm.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/xpm.h""... $ac_c" 1>&6
-echo "configure:4075: checking for X11/xpm.h" >&5
+echo "configure:4130: checking for X11/xpm.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 4080 "configure"
+#line 4135 "configure"
#include "confdefs.h"
#include <X11/xpm.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:4085: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:4140: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "GL/gl.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for GL/gl.h""... $ac_c" 1>&6
-echo "configure:4140: checking for GL/gl.h" >&5
+echo "configure:4195: checking for GL/gl.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 4145 "configure"
+#line 4200 "configure"
#include "confdefs.h"
#include <GL/gl.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:4150: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:4205: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "GL/glx.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for GL/glx.h""... $ac_c" 1>&6
-echo "configure:4181: checking for GL/glx.h" >&5
+echo "configure:4236: checking for GL/glx.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 4186 "configure"
+#line 4241 "configure"
#include "confdefs.h"
#include <GL/glx.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:4191: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:4246: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 4231 "configure"
+#line 4286 "configure"
#include "confdefs.h"
#include <GL/glx.h>
EOF
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "X11/extensions/readdisplay.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for X11/extensions/readdisplay.h""... $ac_c" 1>&6
-echo "configure:4281: checking for X11/extensions/readdisplay.h" >&5
+echo "configure:4336: checking for X11/extensions/readdisplay.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 4286 "configure"
+#line 4341 "configure"
#include "confdefs.h"
#include <X11/extensions/readdisplay.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:4291: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:4346: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
ac_safe=`echo "dmedia/vl.h" | sed 'y%./+-%__p_%'`
echo $ac_n "checking for dmedia/vl.h""... $ac_c" 1>&6
-echo "configure:4343: checking for dmedia/vl.h" >&5
+echo "configure:4398: checking for dmedia/vl.h" >&5
if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
cat > conftest.$ac_ext <<EOF
-#line 4348 "configure"
+#line 4403 "configure"
#include "confdefs.h"
#include <dmedia/vl.h>
EOF
ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out"
-{ (eval echo configure:4353: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
+{ (eval echo configure:4408: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; }
ac_err=`grep -v '^ *+' conftest.out`
if test -z "$ac_err"; then
rm -rf conftest*
if test $have_sgivideo = yes; then
have_sgivideo=no
echo $ac_n "checking for vlOpenVideo in -lvl""... $ac_c" 1>&6
-echo "configure:4378: checking for vlOpenVideo in -lvl" >&5
+echo "configure:4433: checking for vlOpenVideo in -lvl" >&5
ac_lib_var=`echo vl'_'vlOpenVideo | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lvl $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 4386 "configure"
+#line 4441 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
vlOpenVideo()
; return 0; }
EOF
-if { (eval echo configure:4397: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:4452: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
fi
if test $have_sgivideo = yes; then
- SGI_VIDEO_OBJS="$(UTILS_SRC)/sgivideo.o"
+ SGI_VIDEO_OBJS="$(UTILS_BIN)/sgivideo.o"
SGI_VIDEO_LIBS="-lvl"
cat >> confdefs.h <<\EOF
#define HAVE_SGI_VIDEO 1
case "$with_zippy_req" in
/*)
echo $ac_n "checking for $with_zippy_req""... $ac_c" 1>&6
-echo "configure:4465: checking for $with_zippy_req" >&5
+echo "configure:4520: checking for $with_zippy_req" >&5
if test -x "$with_zippy_req" ; then
echo "$ac_t""yes" 1>&6
else
# Extract the first word of "$with_zippy_req", so it can be a program name with args.
set dummy $with_zippy_req; ac_word=$2
echo $ac_n "checking for $ac_word""... $ac_c" 1>&6
-echo "configure:4479: checking for $ac_word" >&5
+echo "configure:4534: checking for $ac_word" >&5
if eval "test \"`echo '$''{'ac_cv_path_zip2'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
# Extract the first word of "$ac_prog", so it can be a program name with args.
set dummy $ac_prog; ac_word=$2
echo $ac_n "checking for $ac_word""... $ac_c" 1>&6
-echo "configure:4525: checking for $ac_word" >&5
+echo "configure:4580: checking for $ac_word" >&5
if eval "test \"`echo '$''{'ac_cv_prog_emacs_exe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
# Extract the first word of "$ac_prog", so it can be a program name with args.
set dummy $ac_prog; ac_word=$2
echo $ac_n "checking for $ac_word""... $ac_c" 1>&6
-echo "configure:4558: checking for $ac_word" >&5
+echo "configure:4613: checking for $ac_word" >&5
if eval "test \"`echo '$''{'ac_cv_prog_xemacs_exe'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
if test -n "$emacs_exe" ; then
echo $ac_n "checking for emacs yow""... $ac_c" 1>&6
-echo "configure:4592: checking for emacs yow" >&5
+echo "configure:4647: checking for emacs yow" >&5
#
# get emacs to tell us where the libexec directory is.
#
if test -z "$ac_cv_zippy_program" ; then
echo $ac_n "checking for xemacs yow""... $ac_c" 1>&6
-echo "configure:4614: checking for xemacs yow" >&5
+echo "configure:4669: checking for xemacs yow" >&5
if test -n "$xemacs_exe" ; then
#
# get xemacs to tell us where the libexec directory is.
# Extract the first word of "$ac_prog", so it can be a program name with args.
set dummy $ac_prog; ac_word=$2
echo $ac_n "checking for $ac_word""... $ac_c" 1>&6
-echo "configure:4660: checking for $ac_word" >&5
+echo "configure:4715: checking for $ac_word" >&5
if eval "test \"`echo '$''{'ac_cv_prog_fortune'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
# Extract the first word of "$ac_prog", so it can be a program name with args.
set dummy $ac_prog; ac_word=$2
echo $ac_n "checking for $ac_word""... $ac_c" 1>&6
-echo "configure:4695: checking for $ac_word" >&5
+echo "configure:4750: checking for $ac_word" >&5
if eval "test \"`echo '$''{'ac_cv_path_fortune'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
if test $with_kerberos = yes; then
echo $ac_n "checking for Kerberos""... $ac_c" 1>&6
-echo "configure:4774: checking for Kerberos" >&5
+echo "configure:4829: checking for Kerberos" >&5
if eval "test \"`echo '$''{'ac_cv_kerberos'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 4785 "configure"
+#line 4840 "configure"
#include "confdefs.h"
#include <krb.h>
int main() {
; return 0; }
EOF
-if { (eval echo configure:4792: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:4847: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_kerberos=yes
else
#
if test $passwd_cruft_done = no ; then
echo $ac_n "checking for Sun-style shadow passwords""... $ac_c" 1>&6
-echo "configure:4842: checking for Sun-style shadow passwords" >&5
+echo "configure:4897: checking for Sun-style shadow passwords" >&5
if eval "test \"`echo '$''{'ac_cv_sun_adjunct'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 4853 "configure"
+#line 4908 "configure"
#include "confdefs.h"
#include <stdlib.h>
#include <unistd.h>
const char *pw = p->pwa_passwd;
; return 0; }
EOF
-if { (eval echo configure:4866: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:4921: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_sun_adjunct=yes
else
#
if test $passwd_cruft_done = no ; then
echo $ac_n "checking for DEC-style shadow passwords""... $ac_c" 1>&6
-echo "configure:4895: checking for DEC-style shadow passwords" >&5
+echo "configure:4950: checking for DEC-style shadow passwords" >&5
if eval "test \"`echo '$''{'ac_cv_enhanced_passwd'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 4906 "configure"
+#line 4961 "configure"
#include "confdefs.h"
#include <stdlib.h>
#include <unistd.h>
pw = p->ufld.fd_encrypt;
; return 0; }
EOF
-if { (eval echo configure:4923: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:4978: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_enhanced_passwd=yes
else
# On SCO, getprpwnam() is in -lprot (which uses nap() from -lx)
# (I'm told it needs -lcurses too, but I don't understand why.)
echo $ac_n "checking for getprpwnam in -lprot""... $ac_c" 1>&6
-echo "configure:4949: checking for getprpwnam in -lprot" >&5
+echo "configure:5004: checking for getprpwnam in -lprot" >&5
ac_lib_var=`echo prot'_'getprpwnam | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lprot -lx $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 4957 "configure"
+#line 5012 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
getprpwnam()
; return 0; }
EOF
-if { (eval echo configure:4968: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5023: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
echo "$ac_t""no" 1>&6
# On DEC, getprpwnam() is in -lsecurity
echo $ac_n "checking for getprpwnam in -lsecurity""... $ac_c" 1>&6
-echo "configure:4988: checking for getprpwnam in -lsecurity" >&5
+echo "configure:5043: checking for getprpwnam in -lsecurity" >&5
ac_lib_var=`echo security'_'getprpwnam | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lsecurity $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 4996 "configure"
+#line 5051 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
getprpwnam()
; return 0; }
EOF
-if { (eval echo configure:5007: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5062: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
#
if test $passwd_cruft_done = no ; then
echo $ac_n "checking for HP-style shadow passwords""... $ac_c" 1>&6
-echo "configure:5036: checking for HP-style shadow passwords" >&5
+echo "configure:5091: checking for HP-style shadow passwords" >&5
if eval "test \"`echo '$''{'ac_cv_hpux_passwd'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 5047 "configure"
+#line 5102 "configure"
#include "confdefs.h"
#include <stdlib.h>
#include <unistd.h>
const char *pw = p->pw_passwd;
; return 0; }
EOF
-if { (eval echo configure:5060: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:5115: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_hpux_passwd=yes
else
# on HPUX, bigcrypt is in -lsec
echo $ac_n "checking for bigcrypt in -lsec""... $ac_c" 1>&6
-echo "configure:5085: checking for bigcrypt in -lsec" >&5
+echo "configure:5140: checking for bigcrypt in -lsec" >&5
ac_lib_var=`echo sec'_'bigcrypt | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lsec $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 5093 "configure"
+#line 5148 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
bigcrypt()
; return 0; }
EOF
-if { (eval echo configure:5104: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5159: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
#
if test $passwd_cruft_done = no ; then
echo $ac_n "checking for generic shadow passwords""... $ac_c" 1>&6
-echo "configure:5131: checking for generic shadow passwords" >&5
+echo "configure:5186: checking for generic shadow passwords" >&5
if eval "test \"`echo '$''{'ac_cv_shadow'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
else
fi
CPPFLAGS="$CPPFLAGS $X_CFLAGS"
cat > conftest.$ac_ext <<EOF
-#line 5142 "configure"
+#line 5197 "configure"
#include "confdefs.h"
#include <stdlib.h>
#include <unistd.h>
const char *pw = p->sp_pwdp;
; return 0; }
EOF
-if { (eval echo configure:5154: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
+if { (eval echo configure:5209: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then
rm -rf conftest*
ac_cv_shadow=yes
else
# On some systems (UnixWare 2.1), getspnam() is in -lgen instead of -lc.
have_getspnam=no
echo $ac_n "checking for getspnam in -lc""... $ac_c" 1>&6
-echo "configure:5180: checking for getspnam in -lc" >&5
+echo "configure:5235: checking for getspnam in -lc" >&5
ac_lib_var=`echo c'_'getspnam | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lc $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 5188 "configure"
+#line 5243 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
getspnam()
; return 0; }
EOF
-if { (eval echo configure:5199: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5254: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
if test $have_getspnam = no ; then
echo $ac_n "checking for getspnam in -lgen""... $ac_c" 1>&6
-echo "configure:5221: checking for getspnam in -lgen" >&5
+echo "configure:5276: checking for getspnam in -lgen" >&5
ac_lib_var=`echo gen'_'getspnam | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lgen $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 5229 "configure"
+#line 5284 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
getspnam()
; return 0; }
EOF
-if { (eval echo configure:5240: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5295: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
# On some systems (UnixWare 2.1), crypt() is in -lcrypt instead of -lc.
have_crypt=no
echo $ac_n "checking for crypt in -lc""... $ac_c" 1>&6
-echo "configure:5267: checking for crypt in -lc" >&5
+echo "configure:5322: checking for crypt in -lc" >&5
ac_lib_var=`echo c'_'crypt | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lc $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 5275 "configure"
+#line 5330 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
crypt()
; return 0; }
EOF
-if { (eval echo configure:5286: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5341: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
if test $have_crypt = no ; then
echo $ac_n "checking for crypt in -lcrypt""... $ac_c" 1>&6
-echo "configure:5308: checking for crypt in -lcrypt" >&5
+echo "configure:5363: checking for crypt in -lcrypt" >&5
ac_lib_var=`echo crypt'_'crypt | sed 'y%./+-%__p_%'`
if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then
echo $ac_n "(cached) $ac_c" 1>&6
ac_save_LIBS="$LIBS"
LIBS="-lcrypt $LIBS"
cat > conftest.$ac_ext <<EOF
-#line 5316 "configure"
+#line 5371 "configure"
#include "confdefs.h"
/* Override any gcc2 internal prototype to avoid an error. */
/* We use char because int might match the return type of a gcc2
crypt()
; return 0; }
EOF
-if { (eval echo configure:5327: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
+if { (eval echo configure:5382: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then
rm -rf conftest*
eval "ac_cv_lib_$ac_lib_var=yes"
else
AC_TYPE_MODE_T
AC_TYPE_PID_T
-AC_TYPE_SIGNAL
AC_TYPE_SIZE_T
-
+AC_TYPE_SIGNAL
AC_MSG_CHECKING(how to call gettimeofday)
AC_CACHE_VAL(ac_cv_gettimeofday_args,
AC_CHECK_FUNCS(select fcntl uname nice setpriority getcwd getwd putenv)
+AC_CHECK_FUNCS(sigaction)
+
AC_CHECK_HEADERS(unistd.h)
dnl /usr/local/src/ssh-1.2.17/putenv.c -- AC_REPLACE_FUNCS(putenv)
if test -d /usr/contrib/X11R6/include ; then
X_CFLAGS="-I/usr/contrib/X11R6/include $X_CFLAGS"
X_LIBS="-L/usr/contrib/X11R6/lib $X_LIBS"
+ elif test -d /usr/X11R6/include ; then
+ X_CFLAGS="-I/usr/X11R6/include $X_CFLAGS"
+ X_LIBS="-L/usr/X11R6/lib $X_LIBS"
elif test -d /usr/contrib/X11R5/include ; then
X_CFLAGS="-I/usr/contrib/X11R5/include $X_CFLAGS"
X_LIBS="-L/usr/contrib/X11R5/lib $X_LIBS"
+ elif test -d /usr/X11R5/include ; then
+ X_CFLAGS="-I/usr/X11R5/include $X_CFLAGS"
+ X_LIBS="-L/usr/X11R5/lib $X_LIBS"
fi
;;
*-solaris*)
# Same to you, pinheads. (Is this really the standard location now?
# What happened to the joke that this kind of thing went in /opt?)
+ # cthomp says "answer: CDE (Common Disorganized Environment)"
if test -f /usr/dt/include/Xm/Xm.h ; then
X_CFLAGS="$X_CFLAGS -I/usr/dt/include"
X_LIBS="$X_LIBS -L/usr/dt/lib -R:/usr/dt/lib"
have_sgivideo=no
AC_CHECK_LIB(vl, vlOpenVideo, have_sgivideo=yes)
if test $have_sgivideo = yes; then
- SGI_VIDEO_OBJS="$(UTILS_SRC)/sgivideo.o"
+ SGI_VIDEO_OBJS="$(UTILS_BIN)/sgivideo.o"
SGI_VIDEO_LIBS="-lvl"
AC_DEFINE(HAVE_SGI_VIDEO)
fi
X_PRE_LIBS = @X_PRE_LIBS@
X_EXTRA_LIBS = @X_EXTRA_LIBS@
-XLIBS = $(X_LIBS) $(X_PRE_LIBS) -lX11 -lXext $(X_EXTRA_LIBS)
+XLIBS = $(X_PRE_LIBS) -lX11 -lXext $(X_EXTRA_LIBS)
AD_DIR = @APPDEFAULTS@
UTILS_SRC = $(srcdir)/../utils
UTILS_BIN = ../utils
-INCLUDES = -I. -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) @INCLUDES@
+INCLUDES = -I. -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) -I.. @INCLUDES@
PASSWD_LIBS = @PASSWD_LIBS@
MOTIF_SRCS = dialogs-Xm.c
UTIL_SRCS = $(UTILS_SRC)/fade.c $(UTILS_SRC)/overlay.c \
$(UTILS_SRC)/resources.c $(UTILS_SRC)/usleep.c \
$(UTILS_SRC)/visual.c $(UTILS_SRC)/xroger.c \
+ $(UTILS_SRC)/spline.c \
$(UTILS_SRC)/yarandom.c @XMU_SRCS@
UTIL_OBJS = $(UTILS_BIN)/fade.o $(UTILS_BIN)/overlay.o \
$(UTILS_BIN)/resources.o $(UTILS_BIN)/usleep.o \
$(UTILS_BIN)/visual.o $(UTILS_BIN)/xroger.o \
+ $(UTILS_BIN)/spline.o \
$(UTILS_BIN)/yarandom.o @XMU_OBJS@
SAVER_SRCS_1 = demo.c stderr.c subprocs.c timers.c windows.c \
SAVER_SRCS = $(SAVER_SRCS_1) $(DIALOG_SRCS) $(LOCK_SRCS) $(UTIL_SRCS)
SAVER_OBJS = $(SAVER_OBJS_1) $(DIALOG_OBJS) $(LOCK_OBJS) $(UTIL_OBJS)
-SAVER_LIBS = @SAVER_LIBS@ -lXt $(XLIBS) $(PASSWD_LIBS) $(LIBS)
+SAVER_LIBS = $(X_LIBS) @SAVER_LIBS@ -lXt $(XLIBS) $(PASSWD_LIBS) $(LIBS)
CMD_SRCS = xscreensaver-command.c
CMD_OBJS = xscreensaver-command.o
-CMD_LIBS = $(XLIBS) $(LIBS)
+CMD_LIBS = $(X_LIBS) $(XLIBS) $(LIBS)
EXES = xscreensaver xscreensaver-command
$$e " must run 'make install' as 'root', not as '$$me'." ;\
$$e "" ;\
$$e " For now, xscreensaver will be installed non-setuid, which" ;\
- $$e " means that locking may not work." ;\
+ $$e " means that locking might not work." ;\
$$e "" ;\
fi ; \
fi ; \
sed -e 's@ \./@ @g;s@ /[^ ]*@@g;/^.*:$$/d' \
-e 's@\.\./utils@$$(UTILS_SRC)@g' \
-e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \
- -e 's@$$.*\(XScreenSaver_ad\)@\1@g' ; \
+ -e 's@$$.*\(XScreenSaver_ad\)@\1@g' \
+ -e 's@ $$(srcdir)/\(.*config\.h\)@ \1@g' ; \
echo '' \
) > /tmp/distdepend.$$$$ && \
mv Makefile.in Makefile.in.bak && \
$(UTILS_BIN)/visual.o: $(UTILS_SRC)/visual.c
$(UTILS_BIN)/xmu.o: $(UTILS_SRC)/xmu.c
$(UTILS_BIN)/xroger.o: $(UTILS_SRC)/xroger.c
+$(UTILS_BIN)/spline.o: $(UTILS_SRC)/spline.c
$(UTILS_BIN)/yarandom.o: $(UTILS_SRC)/yarandom.c
$(UTIL_OBJS):
#
# DO NOT DELETE: updated by make distdepend
-demo.o: $(srcdir)/../config.h
+demo.o: ../config.h
demo.o: $(srcdir)/xscreensaver.h
demo.o: $(UTILS_SRC)/resources.h
-stderr.o: $(srcdir)/../config.h
+stderr.o: ../config.h
stderr.o: $(srcdir)/xscreensaver.h
stderr.o: $(UTILS_SRC)/resources.h
stderr.o: $(UTILS_SRC)/visual.h
-subprocs.o: $(srcdir)/../config.h
+subprocs.o: ../config.h
subprocs.o: $(srcdir)/xscreensaver.h
subprocs.o: $(UTILS_SRC)/yarandom.h
-timers.o: $(srcdir)/../config.h
+timers.o: ../config.h
timers.o: $(srcdir)/xscreensaver.h
-windows.o: $(srcdir)/../config.h
+windows.o: ../config.h
windows.o: $(srcdir)/xscreensaver.h
windows.o: $(UTILS_SRC)/visual.h
windows.o: $(UTILS_SRC)/fade.h
-xscreensaver.o: $(srcdir)/../config.h
+xscreensaver.o: ../config.h
xscreensaver.o: $(srcdir)/xscreensaver.h
xscreensaver.o: $(UTILS_SRC)/version.h
xscreensaver.o: $(UTILS_SRC)/yarandom.h
xscreensaver.o: $(UTILS_SRC)/resources.h
xscreensaver.o: $(UTILS_SRC)/visual.h
xscreensaver.o: XScreenSaver_ad.h
-xset.o: $(srcdir)/../config.h
+xset.o: ../config.h
xset.o: $(srcdir)/xscreensaver.h
-xscreensaver-command.o: $(srcdir)/../config.h
+xscreensaver-command.o: ../config.h
xscreensaver-command.o: $(UTILS_SRC)/version.h
! a screen saver and locker for the X window system
! by Jamie Zawinski
!
-! version 2.14
+! version 2.16
!
! See "man xscreensaver" for more info. The latest version is always
! available at http://people.netscape.com/jwz/xscreensaver/
lmorph -root \n\
deco -root \n\
moire -root \n\
+ moire2 -root \n\
lightning -root \n\
strange -root \n\
spiral -root \n\
kaleidescope -root \n\
xjack -root \n\
xlyap -root -random \n\
+ cynosure -root \n\
\
mono: rocks -root \n\
color: rocks -root -fg darksalmon \n\
@GL_KLUDGE_2@ gears -root \n\
@GL_KLUDGE_2@ superquadrics -root \n\
@GL_KLUDGE_2@ morph3d -root \n\
-@GL_KLUDGE_2@ escher -root \n\
+@GL_KLUDGE_2@ cage -root \n\
+@GL_KLUDGE_2@ moebius -root \n\
+@GL_KLUDGE_2@ stairs -root \n\
@GL_KLUDGE_2@ pipes -root \n\
@GL_KLUDGE_2@ sproingies -root \n\
@GL_KLUDGE_2@ rubik -root \n
! If your vendor doesn't provide real OpenGL, you might want to consider
! building MesaGL, which is a free implementation -- GL is way cool.
!
-! Note that those hacks (gears, superquadratics, morph3d, escher, pipes,
-! sproingies, and rubik) tend to work best on a visual *half* as deep as the
-! depth of the screen, since that way, they can do double-buffering -- try it
-! and see, but you will probably find that you should specify the deepest
-! visual that is half as deep as the screen.
+! Note that those hacks (gears, superquadratics, morph3d, cage, moebius,
+! stairs, pipes, sproingies, and rubik) tend to work best on a visual *half*
+! as deep as the depth of the screen, since that way, they can do
+! double-buffering -- try it and see, but you will probably find that you
+! should specify the deepest visual that is half as deep as the screen.
!
! For example, on a screen that supports both 24-bit TrueColor and 12-bit
! PseudoColor, the 12-bit visual will probably work best (this is true of
*label1.labelString: XScreenSaver %s
*label1.label: XScreenSaver %s
-*label2.labelString: Copyright © 1991-1997 by Jamie Zawinski <jwz@netscape.com>
-*label2.label: Copyright © 1991-1997 by Jamie Zawinski <jwz@netscape.com>
+*label2.labelString: Copyright © 1991-1998 by Jamie Zawinski <jwz@netscape.com>
+*label2.label: Copyright © 1991-1998 by Jamie Zawinski <jwz@netscape.com>
*demoList.visibleItemCount: 10
*demoList.automaticSelection: True
*next.labelString: Run Next
lmorph -root \\n\
deco -root \\n\
moire -root \\n\
+ moire2 -root \\n\
lightning -root \\n\
strange -root \\n\
spiral -root \\n\
kaleidescope -root \\n\
xjack -root \\n\
xlyap -root -random \\n\
+ cynosure -root \\n\
\
mono: rocks -root \\n\
color: rocks -root -fg darksalmon \\n\
gears -root \\n\
superquadrics -root \\n\
morph3d -root \\n\
- escher -root \\n\
+ cage -root \\n\
+ moebius -root \\n\
+ stairs -root \\n\
pipes -root \\n\
sproingies -root \\n\
rubik -root \\n",
"*demoDialog.maxWidth: 600",
"*label1.labelString: XScreenSaver %s",
"*label1.label: XScreenSaver %s",
-"*label2.labelString: Copyright © 1991-1997 by Jamie Zawinski <jwz@netscape.com>",
-"*label2.label: Copyright © 1991-1997 by Jamie Zawinski <jwz@netscape.com>",
+"*label2.labelString: Copyright © 1991-1998 by Jamie Zawinski <jwz@netscape.com>",
+"*label2.label: Copyright © 1991-1998 by Jamie Zawinski <jwz@netscape.com>",
"*demoList.visibleItemCount: 10",
"*demoList.automaticSelection: True",
"*next.labelString: Run Next",
/* passwd.c --- verifying typed passwords with the OS.
- * xscreensaver, Copyright (c) 1993-1997 Jamie Zawinski <jwz@netscape.com>
+ * xscreensaver, Copyright (c) 1993-1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
# include <sys/audit.h>
# include <pwdadj.h>
-# define PRTYPE passwd_adjunct *
+# define PWTYPE struct passwd_adjunct *
# define PWPSLOT pwa_passwd
# define GETPW getpwanam
# include <hpsecurity.h>
# include <prot.h>
-# define PRTYPE struct s_passwd *
+# define PWTYPE struct s_passwd *
# define PWPSLOT pw_passwd
# define GETPW getspwnam
# define crypt bigcrypt
/* subprocs.c --- choosing, spawning, and killing screenhacks.
- * xscreensaver, Copyright (c) 1991, 1992, 1993, 1995, 1997
+ * xscreensaver, Copyright (c) 1991, 1992, 1993, 1995, 1997, 1998
* Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
static void
block_sigchld (void)
{
-#ifdef USE_SIGACTION
+#ifdef HAVE_SIGACTION
sigset_t child_set;
sigemptyset (&child_set);
sigaddset (&child_set, SIGCHLD);
sigprocmask (SIG_BLOCK, &child_set, 0);
-#endif /* USE_SIGACTION */
+#endif /* HAVE_SIGACTION */
block_sigchld_handler++;
}
static void
unblock_sigchld (void)
{
-#ifdef USE_SIGACTION
+#ifdef HAVE_SIGACTION
sigset_t child_set;
sigemptyset(&child_set);
sigaddset(&child_set, SIGCHLD);
sigprocmask(SIG_UNBLOCK, &child_set, 0);
-#endif /* USE_SIGACTION */
+#endif /* HAVE_SIGACTION */
+
block_sigchld_handler--;
}
if (si->prefs.debug_p)
fprintf(stderr, "%s: got SIGCHLD%s\n", progname,
(block_sigchld_handler ? " (blocked)" : ""));
-#endif
+#endif /* DEBUG */
if (block_sigchld_handler < 0)
abort();
init_sigchld();
}
-#endif
+#endif /* SIGCHLD */
#ifndef VMS
(long) kid, errno);
else
fprintf (stderr, "%s: waitpid(-1) ==> %ld\n", progname, (long) kid);
-#endif
+#endif /* DEBUG */
/* 0 means no more children to reap.
-1 means error -- except "interrupted system call" isn't a "real"
{
#ifdef SIGCHLD
-# ifdef USE_SIGACTION /* Thanks to Tom Kelly <tom@ancilla.toronto.on.ca> */
+# ifdef HAVE_SIGACTION /* Thanks to Tom Kelly <tom@ancilla.toronto.on.ca> */
static Bool sigchld_initialized_p = 0;
if (!sigchld_initialized_p)
sigchld_initialized_p = True;
}
-# else /* !USE_SIGACTION */
+# else /* !HAVE_SIGACTION */
if (((long) signal (SIGCHLD, sigchld_handler)) == -1L)
{
sprintf (buf, "%s: couldn't catch SIGCHLD", progname);
perror (buf);
}
-# endif /* !USE_SIGACTION */
-#endif
+# endif /* !HAVE_SIGACTION */
+#endif /* SIGCHLD */
}
int i;
#ifdef SIGCHLD
signal (SIGCHLD, SIG_IGN);
-#endif
+#endif /* SIGCHLD */
for (i = 0; i < si->nscreens; i++)
{
si->locking_disabled_p = True;
si->nolock_reason = "running as root";
p = getpwnam ("nobody");
+ if (! p) p = getpwnam ("noaccess");
if (! p) p = getpwnam ("daemon");
if (! p) p = getpwnam ("bin");
if (! p) p = getpwnam ("sys");
}
}
}
-#ifndef NO_LOCKING
+# ifndef NO_LOCKING
else /* disable locking if already being run as "someone else" */
{
struct passwd *p = getpwuid (getuid ());
if (!p ||
!strcmp (p->pw_name, "root") ||
!strcmp (p->pw_name, "nobody") ||
+ !strcmp (p->pw_name, "noaccess") ||
!strcmp (p->pw_name, "daemon") ||
!strcmp (p->pw_name, "bin") ||
!strcmp (p->pw_name, "sys"))
sprintf (si->nolock_reason, "running as %s", p->pw_name);
}
}
-#endif /* NO_LOCKING */
+# endif /* !NO_LOCKING */
}
void
/* windows.c --- turning the screen black; dealing with visuals, virtual roots.
- * xscreensaver, Copyright (c) 1991-1997 Jamie Zawinski <jwz@netscape.com>
+ * xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
current_maps[i] = (between_hacks_p
? ssi->cmap
: DefaultColormapOfScreen (ssi->screen));
+ /* Ensure that the default background of the window is really black,
+ not a pixmap or something. (This does not clear the window.) */
+ XSetWindowBackground (si->dpy, ssi->screensaver_window,
+ ssi->black_pixel);
}
if (p->verbose_p) fprintf (stderr, "%s: fading... ", progname);
{
saver_screen_info *ssi = &si->screens[i];
current_windows[i] = ssi->screensaver_window;
+ /* Ensure that the default background of the window is really black,
+ not a pixmap or something. (This does not clear the window.) */
+ XSetWindowBackground (si->dpy, ssi->screensaver_window,
+ ssi->black_pixel);
}
if (p->verbose_p) fprintf (stderr, "%s: unfading... ", progname);
+ XSync (si->dpy, False);
XGrabServer (si->dpy);
+ XSync (si->dpy, False);
for (i = 0; i < si->nscreens; i++)
{
saver_screen_info *ssi = &si->screens[i];
clear_stderr (ssi);
}
XUngrabServer (si->dpy);
+ XSync (si->dpy, False);
fade_screens (si->dpy, 0, current_windows,
p->fade_seconds, p->fade_ticks,
}
#endif
+ /* Unmap the windows a second time, dammit -- just to avoid a race
+ with the screen-grabbing hacks. (I'm not sure if this is really
+ necessary; I'm stabbing in the dark now.)
+ */
+ for (i = 0; i < si->nscreens; i++)
+ XUnmapWindow (si->dpy, si->screens[i].screensaver_window);
+
si->screen_blanked_p = False;
}
-/* xscreensaver, Copyright (c) 1991-1997 Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
do_help (saver_info *si)
{
printf ("\
-xscreensaver %s, copyright (c) 1991-1997 by Jamie Zawinski <jwz@netscape.com>\n\
+xscreensaver %s, copyright (c) 1991-1998 by Jamie Zawinski <jwz@netscape.com>\n\
The standard Xt command-line options are accepted; other options include:\n\
\n\
-timeout <minutes> When the screensaver should activate.\n\
if (p->verbose_p)
printf ("\
-%s %s, copyright (c) 1991-1997 by Jamie Zawinski <jwz@netscape.com>\n\
+%s %s, copyright (c) 1991-1998 by Jamie Zawinski <jwz@netscape.com>\n\
pid = %d.\n", progname, si->version, (int) getpid ());
if (si->demo_mode_p)
demo_mode (si);
else
-#endif
+#endif /* !NO_DEMO_MODE */
{
if (p->verbose_p)
printf ("%s: user is idle; waking up at %s.\n", progname,
si->lock_id = XtAppAddTimeOut (si->app, p->lock_timeout,
activate_lock_timer,
(XtPointer) si);
-#endif
+#endif /* !NO_LOCKING */
PASSWD_INVALID:
goto PASSWD_INVALID;
si->locked_p = False;
}
-#endif
- unblank_screen (si);
+#endif /* !NO_LOCKING */
+
+ /* Let's kill it before unblanking, to get it to stop drawing as
+ soon as possible... */
kill_screenhack (si);
+ unblank_screen (si);
+
if (si->cycle_id)
{
XtRemoveTimeOut (si->cycle_id);
si->cycle_id = 0;
}
+
#ifndef NO_LOCKING
if (si->lock_id)
{
XtRemoveTimeOut (si->lock_id);
si->lock_id = 0;
}
-#endif
+#endif /* !NO_LOCKING */
+
if (p->verbose_p)
printf ("%s: user is active; going to sleep at %s.\n", progname,
timestring ());
.if n .sp 1
.if t .sp .5
..
-.TH XScreenSaver 1 "31-May-97" "X Version 11"
+.TH XScreenSaver 1 "16-Jan-98" "X Version 11"
.SH NAME
xscreensaver - graphics hack and screen locker, launched when the user is idle
.SH SYNOPSIS
This will cause \fIxscreensaver\fP to be launched when you log in.
(As always, make sure that xscreensaver and the graphics demos are on
-your \fB$PATH\fP; this needs to be set in \fI.cshrc\fP and/or \fI.dtprofile\fP,
-not \fI.login\fP.)
+your \fB$PATH\fP; the path needs to be set in \fI.cshrc\fP
+and/or \fI.dtprofile\fP, not \fI.login\fP.)
.TP 3
\fB3: Create XScreenSaver.dt\fP
-Create a file called \fI~/.dt/sessions/XScreenSaver.dt\fP with the following
+Create a file called \fI~/.dt/types/XScreenSaver.dt\fP with the following
contents:
ACTION XScreenSaver
to talk to \fIxscreensaver\fP.
.TP 3
\fB4: Create Lock.fp\fP
-Create a file called \fI~/.dt/sessions/Lock.fp\fP with the following
+Create a file called \fI~/.dt/types/Lock.fp\fP with the following
contents:
CONTROL Lock
.TP 3
\fB5: Restart\fP
Select ``\fIRestart Workspace Manager\fP'' from the popup menu to make
-your changes take effect. If things seem not to be working, the
+your changes take effect. If things seem not to be working, check the
file \fI~/.dt/errorlog\fP for error messages.
.RE
.PP
is restarted. This turns out to be kind of hard to fix. (But remember,
kids! Unix security doesn't do much more than keep honest people honest...)
.TP 8
-TWM and Colormaps
+Colormap lossage: TWM
The \fBinstallColormap\fP option doesn't work very well with the
.BR twm (1)
window manager and its descendants.
not do it if the screensaver comes on of its own volition, or is activated
from another console. Any thoughts on this problem are welcome...
.TP 8
+Colormap lossage: XV, XAnim, XEarth
+Some programs don't operate properly on visuals other than the default one,
+or with colormaps other than the default one. See the discussion of the
+magic "default-n" visual name in the section about the \fBprograms\fP
+resource. When programs only work with the default colormap, you need to
+use a syntax like this:
+
+ default-n: xv -root image-1.gif -quit \\n\\
+ default-n: xearth -nostars -wait 0 \\n\\
+
+It would also work to turn off the \fBinstallColormap\fP option altogether,
+but that would deny extra colors to those programs that \fIcan\fP take
+advantage of them.
+.TP 8
XView Clients
Apparently there are some problems with XView programs getting confused
and thinking that the screensaver window is the real root window even when
pretty ugly, especially the password dialog. Use Motif! If you don't
have OSF Motif, use GNU LessTif, it's free: http://www.lesstif.org/
.TP 8
+SGI Power Saver
+If you're running Irix 6.3, you might find that your monitor is powering down
+after an hour or two even if you've told it not to. This is fixed by SGI
+patches 2447 and 2537.
+.TP 8
Red Hot Lava
There need to be a lot more graphics hacks. In particular, there should be
a simulation of a Lavalite (tm).
.BR bouboule (1),
.BR braid (1),
.BR bubbles (1),
+.BR cage (1),
.BR coral (1),
+.BR cynosure (1),
.BR decayscreen (1),
.BR deco (1),
.BR drift (1),
-.BR escher (1),
.BR fadeplot (1),
.BR flag (1),
.BR flame (1),
.BR lissie (1),
.BR lmorph (1),
.BR maze (1),
+.BR moebius (1),
.BR moire (1),
+.BR moire2 (1),
.BR morph3d (1),
.BR mountain (1),
.BR munch (1),
.BR sphere (1),
.BR spiral (1),
.BR sproingies (1),
+.BR stairs (1),
.BR starfish (1),
.BR strange (1),
.BR superquadrics (1),
.BR xv (1),
.BR xwave (1).
.SH COPYRIGHT
-Copyright \(co 1991, 1992, 1993, 1994, 1995, 1996, 1997 by Jamie Zawinski.
-Permission to use, copy, modify, distribute, and sell this software and its
-documentation for any purpose is hereby granted without fee, provided that
-the above copyright notice appear in all copies and that both that copyright
-notice and this permission notice appear in supporting documentation. No
-representations are made about the suitability of this software for any
-purpose. It is provided "as is" without express or implied warranty.
+Copyright \(co 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998
+by Jamie Zawinski. Permission to use, copy, modify, distribute, and sell
+this software and its documentation for any purpose is hereby granted without
+fee, provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in supporting
+documentation. No representations are made about the suitability of this
+software for any purpose. It is provided "as is" without express or implied
+warranty.
.SH AUTHOR
Jamie Zawinski <jwz@netscape.com>. Written in late 1991; first posted
to comp.sources.x on 13-Aug-1992.
Please let me know if you find any bugs or make any improvements.
-
+.SH ACKNOWLEDGEMENTS
Thanks to David Wojtowicz for implementing \fIlockTimeout\fP.
Thanks to Martin Kraemer for adding support for shadow passwords and
/* xset.c --- interacting with server extensions and the builtin screensaver.
- * xscreensaver, Copyright (c) 1991-1997 Jamie Zawinski <jwz@netscape.com>
+ * xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
/* On SGIs, if interval is non-zero, it is the number of seconds after
screen saving starts at which the monitor should be powered down.
- Obviously I don't want that, so make sure it's a large positive number.
+ Obviously I don't want that, so set it to 0 (meaning "never".)
Power saving is disabled if DontPreferBlanking, but in that case,
we don't get extension events either. So we can't turn it off that way.
- The man page for `XSetScreenSaver' says that setting interval to 0 will
- disable powering down of the monitor, but this turns out not to be the
- case on Irix 6.3 (O2); the monitor powers down anyway. It didn't do
- this on 6.2, so someone screwed up.
-
- Extra Sucky Factoid #2: the number can't be more than 15 bits, which
- is only a bit over nine hours. So there's just *no fucking way* to make
- an SGI O2 leave its monitor powered on and idle for more than nine hours.
- You fucking losers!
-
- [...Later...] Ok, it's worse than that. The above doesn't work either.
- Setting it to a small number will cause it to power down early; but even
- if you set it to a large number, it still seems to power down in about
- an hour. You fucking fucking fucking losers!
+ Note: if you're running Irix 6.3 (O2), you may find that your monitor is
+ powering down anyway, regardless of the xset settings. This is fixed by
+ installing SGI patches 2447 and 2537.
*/
-#ifdef HAVE_SGI_SAVER_EXTENSION
- if (p->use_sgi_saver_extension)
- desired_server_interval = 32767;
- else
-#endif
- desired_server_interval = 0;
+ desired_server_interval = 0;
/* I suspect (but am not sure) that DontAllowExposures might have
something to do with powering off the monitor as well. */
UTILS_SRC = $(srcdir)/../utils
UTILS_BIN = ../utils
-INCLUDES = -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) @INCLUDES@
+INCLUDES = -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) -I.. @INCLUDES@
UTIL_SRCS = $(UTILS_SRC)/alpha.c $(UTILS_SRC)/colors.c \
$(UTILS_SRC)/grabscreen.c $(UTILS_SRC)/hsv.c \
$(UTILS_SRC)/usleep.c $(UTILS_SRC)/visual.c \
$(UTILS_SRC)/xroger.c $(UTILS_SRC)/yarandom.c \
$(UTILS_SRC)/erase.c $(UTILS_SRC)/sgivideo.c
-UTIL_OBJS = $(UTILS_SRC)/alpha.o $(UTILS_SRC)/colors.o \
- $(UTILS_SRC)/grabscreen.o $(UTILS_SRC)/hsv.o \
- $(UTILS_SRC)/resources.o $(UTILS_SRC)/spline.o \
- $(UTILS_SRC)/usleep.o $(UTILS_SRC)/visual.o \
- $(UTILS_SRC)/xroger.o $(UTILS_SRC)/yarandom.o \
- $(UTILS_SRC)/erase.o $(UTILS_SRC)/sgivideo.o
+UTIL_OBJS = $(UTILS_BIN)/alpha.o $(UTILS_BIN)/colors.o \
+ $(UTILS_BIN)/grabscreen.o $(UTILS_BIN)/hsv.o \
+ $(UTILS_BIN)/resources.o $(UTILS_BIN)/spline.o \
+ $(UTILS_BIN)/usleep.o $(UTILS_BIN)/visual.o \
+ $(UTILS_BIN)/xroger.o $(UTILS_BIN)/yarandom.o \
+ $(UTILS_BIN)/erase.o $(UTILS_BIN)/sgivideo.o
SRCS = attraction.c blitspin.c bouboule.c braid.c bubbles.c \
- bubbles_default.c decayscreen.c deco.c drift.c flag.c \
+ bubbles-default.c decayscreen.c deco.c drift.c flag.c \
flame.c forest.c vines.c galaxy.c grav.c greynetic.c \
halo.c helix.c hopalong.c hypercube.c ifs.c imsmap.c \
julia.c kaleidescope.c laser.c lightning.c lisa.c lmorph.c \
slip.c sphere.c spiral.c strange.c swirl.c xlockmore.c \
xroger-hack.c goop.c starfish.c munch.c fadeplot.c \
rd-bomb.c coral.c mountain.c triangle.c lissie.c worm.c \
- rotor.c ant.c xjack.c xlyap.c puzzle.c xscreensaver-sgigl.c
+ rotor.c ant.c xjack.c xlyap.c puzzle.c xscreensaver-sgigl.c \
+ cynosure.c moire2.c
OBJS = attraction.o blitspin.o bouboule.o braid.o bubbles.o \
- bubbles_default.o decayscreen.o deco.o drift.o flag.o \
+ bubbles-default.o decayscreen.o deco.o drift.o flag.o \
flame.o forest.o vines.o galaxy.o grav.o greynetic.o \
halo.o helix.o hopalong.o hypercube.o ifs.o imsmap.o \
julia.o kaleidescope.o laser.o lightning.o lisa.o lmorph.o \
slip.o sphere.o spiral.o strange.o swirl.o xlockmore.o \
xroger-hack.o goop.o starfish.o munch.o fadeplot.o \
rd-bomb.o coral.o mountain.o triangle.o lissie.o worm.o \
- rotor.o ant.o xjack.o xlyap.o puzzle.o xscreensaver-sgigl.o
+ rotor.o ant.o xjack.o xlyap.o puzzle.o xscreensaver-sgigl.o \
+ cynosure.o moire2.o
EXES = attraction blitspin bouboule braid bubbles decayscreen deco \
drift flag flame forest vines galaxy grav greynetic halo \
penrose pyro qix rocks rorschach sierpinski slidescreen \
slip sphere spiral strange swirl xroger goop starfish munch \
fadeplot rd-bomb coral mountain triangle lissie worm rotor \
- ant xjack xlyap puzzle
+ ant xjack xlyap puzzle cynosure moire2
HACK_OBJS_1 = $(UTILS_BIN)/resources.o $(UTILS_BIN)/visual.o \
$(UTILS_BIN)/usleep.o $(UTILS_BIN)/yarandom.o @XMU_OBJS@
xroger.man goop.man starfish.man munch.man rd-bomb.man \
xjack.man xlyap.man puzzle.man
STAR = *
-EXTRAS = README Makefile.in xlock.h default.xbm bob.xbm .gdbinit \
- noses/nose-$(STAR).xbm noses/nose-$(STAR).xpm \
- pieces/$(STAR).xbm \
- bubbles-tools/bubbles$(STAR) \
- bubbles-tools/xpm$(STAR) \
- bubbles-sources/$(STAR).pov \
- bubbles-samples/$(STAR).bub.gz
+EXTRAS = README Makefile.in xlock.h .gdbinit \
+ vidwhacker \
+ images/$(STAR).xbm \
+ images/bubbles/$(STAR).pov \
+ images/bubbles/$(STAR).xpm \
+ images/noseguy/$(STAR).xbm \
+ images/noseguy/$(STAR).xpm \
+ images/puzzle/$(STAR).xbm \
VMSFILES = compile_axp.com compile_decc.com link_axp.com link_decc.com \
vms_axp.opt vms_axp_12.opt vms_decc.opt vms_decc_12.opt
$(MAKE) INSTALL_PROGRAM='$(INSTALL_PROGRAM) -s' install
install-program:
- @for program in $(EXES); do \
+ @if [ ! -d $(HACKDIR) ]; then mkdir $(HACKDIR) ; fi ; \
+ for program in $(EXES); do \
echo $(INSTALL_PROGRAM) $$program $(HACKDIR)/$$program ; \
$(INSTALL_PROGRAM) $$program $(HACKDIR)/$$program ; \
done
install-man:
- @men="$(MEN)" ; \
+ @if [ ! -d $(mandir) ]; then mkdir $(mandir) ; fi ; \
+ if [ ! -d $(man1dir) ]; then mkdir $(man1dir) ; fi ; \
+ men="$(MEN)" ; \
for man in $$men; do \
instname=`echo $$man | sed 's/\.man$$/\.$(mansuffix)/'` ; \
echo $(INSTALL_DATA) $(srcdir)/$$man $(man1dir)/$$instname ; \
awk '/^# .*Makefile.in ---/,/^# DO .*distdepend/' < Makefile.in ; \
sed -e 's@ \./@ @g;s@ /[^ ]*@@g;/^.*:$$/d' \
-e 's@\.\./utils@$$(UTILS_SRC)@g' \
- -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' ; \
+ -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \
+ -e 's@ $$(srcdir)/\(.*config.h\)@ \1@g' ; \
echo '' \
) > /tmp/distdepend.$$$$ && \
mv Makefile.in Makefile.in.bak && \
ALP = $(HSV) $(UTILS_BIN)/alpha.o
HSV = $(UTILS_BIN)/hsv.o
SPL = $(UTILS_BIN)/spline.o
-XROG = $(UTILS_BIN)/xroger.o
+XROG = $(UTILS_BIN)/xroger.o $(SPL)
GRAB = $(GRAB_OBJS)
ERASE = $(UTILS_BIN)/erase.o
COL = $(COLOR_OBJS)
blitspin: $(HACK_OBJS) blitspin.o $(GRAB)
$(CC_HACK) -o $@ $(HACK_OBJS) blitspin.o $(GRAB) $(XPM_LIBS) $(GRAB_LIBS)
-bubbles: $(HACK_OBJS) bubbles.o bubbles_default.o
- $(CC_HACK) -o $@ $(HACK_OBJS) bubbles.o bubbles_default.o $(XPM_LIBS)
+bubbles: $(HACK_OBJS) bubbles.o bubbles-default.o
+ $(CC_HACK) -o $@ $(HACK_OBJS) bubbles.o bubbles-default.o $(XPM_LIBS)
decayscreen: $(HACK_OBJS) decayscreen.o $(GRAB)
$(CC_HACK) -o $@ $(HACK_OBJS) decayscreen.o $(GRAB) $(HACK_LIBS) $(GRAB_LIBS)
lmorph: $(HACK_OBJS) lmorph.o
$(CC_HACK) -o $@ $(HACK_OBJS) lmorph.o $(HACK_LIBS)
-maze: $(HACK_OBJS) maze.o $(ERASE) $(UTILS_BIN)/xroger.o
- $(CC_HACK) -o $@ $(HACK_OBJS) maze.o $(ERASE) $(UTILS_BIN)/xroger.o $(HACK_LIBS)
+maze: $(HACK_OBJS) maze.o $(ERASE) $(XROG)
+ $(CC_HACK) -o $@ $(HACK_OBJS) maze.o $(ERASE) $(XROG) $(HACK_LIBS)
moire: $(HACK_OBJS) moire.o $(COL)
$(CC_HACK) -o $@ $(HACK_OBJS) moire.o $(COL) $(HACK_LIBS)
+moire2: $(HACK_OBJS) moire2.o $(COL)
+ $(CC_HACK) -o $@ $(HACK_OBJS) moire2.o $(COL) $(HACK_LIBS)
+
noseguy: $(HACK_OBJS) noseguy.o
$(CC_HACK) -o $@ $(HACK_OBJS) noseguy.o $(XPM_LIBS)
puzzle: $(HACK_OBJS) puzzle.o $(GRAB)
$(CC_HACK) -o $@ $(HACK_OBJS) puzzle.o $(GRAB) $(HACK_LIBS) $(GRAB_LIBS)
+cynosure: $(HACK_OBJS) cynosure.o $(COL)
+ $(CC_HACK) -o $@ $(HACK_OBJS) cynosure.o $(COL) $(HACK_LIBS)
+
# The rules for those hacks which follow the `xlockmore' API.
#
$(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(ERASE) $(HACK_LIBS)
flag: flag.o $(XLOCK_OBJS)
- $(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(HACK_LIBS)
+ $(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(XPM_LIBS)
forest: forest.o $(XLOCK_OBJS) $(ERASE)
$(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(ERASE) $(HACK_LIBS)
# DO NOT DELETE: updated by make distdepend
attraction.o: $(srcdir)/screenhack.h
-attraction.o: $(srcdir)/../config.h
+attraction.o: ../config.h
attraction.o: $(UTILS_SRC)/yarandom.h
attraction.o: $(UTILS_SRC)/usleep.h
attraction.o: $(UTILS_SRC)/resources.h
attraction.o: $(UTILS_SRC)/visual.h
attraction.o: $(UTILS_SRC)/spline.h
blitspin.o: $(srcdir)/screenhack.h
-blitspin.o: $(srcdir)/../config.h
+blitspin.o: ../config.h
blitspin.o: $(UTILS_SRC)/yarandom.h
blitspin.o: $(UTILS_SRC)/usleep.h
blitspin.o: $(UTILS_SRC)/resources.h
blitspin.o: $(UTILS_SRC)/colors.h
blitspin.o: $(UTILS_SRC)/grabscreen.h
blitspin.o: $(UTILS_SRC)/visual.h
-blitspin.o: $(srcdir)/default.xbm
+blitspin.o: $(srcdir)/images/som.xbm
bouboule.o: $(srcdir)/xlockmore.h
-bouboule.o: $(srcdir)/../config.h
+bouboule.o: ../config.h
bouboule.o: $(srcdir)/xlockmoreI.h
bouboule.o: $(srcdir)/screenhack.h
bouboule.o: $(UTILS_SRC)/yarandom.h
bouboule.o: $(UTILS_SRC)/grabscreen.h
bouboule.o: $(UTILS_SRC)/visual.h
braid.o: $(srcdir)/xlockmore.h
-braid.o: $(srcdir)/../config.h
+braid.o: ../config.h
braid.o: $(srcdir)/xlockmoreI.h
braid.o: $(srcdir)/screenhack.h
braid.o: $(UTILS_SRC)/yarandom.h
braid.o: $(UTILS_SRC)/visual.h
braid.o: $(UTILS_SRC)/erase.h
bubbles.o: $(srcdir)/screenhack.h
-bubbles.o: $(srcdir)/../config.h
+bubbles.o: ../config.h
bubbles.o: $(UTILS_SRC)/yarandom.h
bubbles.o: $(UTILS_SRC)/usleep.h
bubbles.o: $(UTILS_SRC)/resources.h
bubbles.o: $(UTILS_SRC)/grabscreen.h
bubbles.o: $(UTILS_SRC)/visual.h
bubbles.o: $(srcdir)/bubbles.h
-bubbles_default.o: $(srcdir)/../config.h
-bubbles_default.o: $(srcdir)/bubbles.h
+bubbles-default.o: ../config.h
+bubbles-default.o: $(srcdir)/bubbles.h
+bubbles-default.o: $(UTILS_SRC)/yarandom.h
+bubbles-default.o: $(srcdir)/images/bubbles/blood1.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood2.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood3.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood4.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood5.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood6.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood7.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood8.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood9.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood10.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blood11.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue1.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue2.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue3.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue4.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue5.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue6.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue7.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue8.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue9.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue10.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/blue11.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass1.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass2.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass3.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass4.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass5.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass6.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass7.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass8.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass9.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass10.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/glass11.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade1.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade2.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade3.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade4.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade5.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade6.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade7.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade8.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade9.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade10.xpm
+bubbles-default.o: $(srcdir)/images/bubbles/jade11.xpm
decayscreen.o: $(srcdir)/screenhack.h
-decayscreen.o: $(srcdir)/../config.h
+decayscreen.o: ../config.h
decayscreen.o: $(UTILS_SRC)/yarandom.h
decayscreen.o: $(UTILS_SRC)/usleep.h
decayscreen.o: $(UTILS_SRC)/resources.h
decayscreen.o: $(UTILS_SRC)/grabscreen.h
decayscreen.o: $(UTILS_SRC)/visual.h
deco.o: $(srcdir)/screenhack.h
-deco.o: $(srcdir)/../config.h
+deco.o: ../config.h
deco.o: $(UTILS_SRC)/yarandom.h
deco.o: $(UTILS_SRC)/usleep.h
deco.o: $(UTILS_SRC)/resources.h
deco.o: $(UTILS_SRC)/grabscreen.h
deco.o: $(UTILS_SRC)/visual.h
drift.o: $(srcdir)/xlockmore.h
-drift.o: $(srcdir)/../config.h
+drift.o: ../config.h
drift.o: $(srcdir)/xlockmoreI.h
drift.o: $(srcdir)/screenhack.h
drift.o: $(UTILS_SRC)/yarandom.h
drift.o: $(UTILS_SRC)/visual.h
drift.o: $(UTILS_SRC)/erase.h
flag.o: $(srcdir)/xlockmore.h
-flag.o: $(srcdir)/../config.h
+flag.o: ../config.h
flag.o: $(srcdir)/xlockmoreI.h
flag.o: $(srcdir)/screenhack.h
flag.o: $(UTILS_SRC)/yarandom.h
flag.o: $(UTILS_SRC)/colors.h
flag.o: $(UTILS_SRC)/grabscreen.h
flag.o: $(UTILS_SRC)/visual.h
-flag.o: $(srcdir)/bob.xbm
+flag.o: $(srcdir)/images/bob.xbm
flame.o: $(srcdir)/screenhack.h
-flame.o: $(srcdir)/../config.h
+flame.o: ../config.h
flame.o: $(UTILS_SRC)/yarandom.h
flame.o: $(UTILS_SRC)/usleep.h
flame.o: $(UTILS_SRC)/resources.h
flame.o: $(UTILS_SRC)/grabscreen.h
flame.o: $(UTILS_SRC)/visual.h
forest.o: $(srcdir)/xlockmore.h
-forest.o: $(srcdir)/../config.h
+forest.o: ../config.h
forest.o: $(srcdir)/xlockmoreI.h
forest.o: $(srcdir)/screenhack.h
forest.o: $(UTILS_SRC)/yarandom.h
forest.o: $(UTILS_SRC)/visual.h
forest.o: $(UTILS_SRC)/erase.h
vines.o: $(srcdir)/xlockmore.h
-vines.o: $(srcdir)/../config.h
+vines.o: ../config.h
vines.o: $(srcdir)/xlockmoreI.h
vines.o: $(srcdir)/screenhack.h
vines.o: $(UTILS_SRC)/yarandom.h
vines.o: $(UTILS_SRC)/visual.h
vines.o: $(UTILS_SRC)/erase.h
galaxy.o: $(srcdir)/xlockmore.h
-galaxy.o: $(srcdir)/../config.h
+galaxy.o: ../config.h
galaxy.o: $(srcdir)/xlockmoreI.h
galaxy.o: $(srcdir)/screenhack.h
galaxy.o: $(UTILS_SRC)/yarandom.h
galaxy.o: $(UTILS_SRC)/grabscreen.h
galaxy.o: $(UTILS_SRC)/visual.h
grav.o: $(srcdir)/xlockmore.h
-grav.o: $(srcdir)/../config.h
+grav.o: ../config.h
grav.o: $(srcdir)/xlockmoreI.h
grav.o: $(srcdir)/screenhack.h
grav.o: $(UTILS_SRC)/yarandom.h
grav.o: $(UTILS_SRC)/grabscreen.h
grav.o: $(UTILS_SRC)/visual.h
greynetic.o: $(srcdir)/screenhack.h
-greynetic.o: $(srcdir)/../config.h
+greynetic.o: ../config.h
greynetic.o: $(UTILS_SRC)/yarandom.h
greynetic.o: $(UTILS_SRC)/usleep.h
greynetic.o: $(UTILS_SRC)/resources.h
greynetic.o: $(UTILS_SRC)/grabscreen.h
greynetic.o: $(UTILS_SRC)/visual.h
halo.o: $(srcdir)/screenhack.h
-halo.o: $(srcdir)/../config.h
+halo.o: ../config.h
halo.o: $(UTILS_SRC)/yarandom.h
halo.o: $(UTILS_SRC)/usleep.h
halo.o: $(UTILS_SRC)/resources.h
halo.o: $(UTILS_SRC)/grabscreen.h
halo.o: $(UTILS_SRC)/visual.h
helix.o: $(srcdir)/screenhack.h
-helix.o: $(srcdir)/../config.h
+helix.o: ../config.h
helix.o: $(UTILS_SRC)/yarandom.h
helix.o: $(UTILS_SRC)/usleep.h
helix.o: $(UTILS_SRC)/resources.h
helix.o: $(UTILS_SRC)/visual.h
helix.o: $(UTILS_SRC)/erase.h
hopalong.o: $(srcdir)/xlockmore.h
-hopalong.o: $(srcdir)/../config.h
+hopalong.o: ../config.h
hopalong.o: $(srcdir)/xlockmoreI.h
hopalong.o: $(srcdir)/screenhack.h
hopalong.o: $(UTILS_SRC)/yarandom.h
hopalong.o: $(UTILS_SRC)/visual.h
hopalong.o: $(UTILS_SRC)/erase.h
hypercube.o: $(srcdir)/screenhack.h
-hypercube.o: $(srcdir)/../config.h
+hypercube.o: ../config.h
hypercube.o: $(UTILS_SRC)/yarandom.h
hypercube.o: $(UTILS_SRC)/usleep.h
hypercube.o: $(UTILS_SRC)/resources.h
hypercube.o: $(UTILS_SRC)/grabscreen.h
hypercube.o: $(UTILS_SRC)/visual.h
ifs.o: $(srcdir)/xlockmore.h
-ifs.o: $(srcdir)/../config.h
+ifs.o: ../config.h
ifs.o: $(srcdir)/xlockmoreI.h
ifs.o: $(srcdir)/screenhack.h
ifs.o: $(UTILS_SRC)/yarandom.h
ifs.o: $(UTILS_SRC)/grabscreen.h
ifs.o: $(UTILS_SRC)/visual.h
imsmap.o: $(srcdir)/screenhack.h
-imsmap.o: $(srcdir)/../config.h
+imsmap.o: ../config.h
imsmap.o: $(UTILS_SRC)/yarandom.h
imsmap.o: $(UTILS_SRC)/usleep.h
imsmap.o: $(UTILS_SRC)/resources.h
imsmap.o: $(UTILS_SRC)/grabscreen.h
imsmap.o: $(UTILS_SRC)/visual.h
julia.o: $(srcdir)/xlockmore.h
-julia.o: $(srcdir)/../config.h
+julia.o: ../config.h
julia.o: $(srcdir)/xlockmoreI.h
julia.o: $(srcdir)/screenhack.h
julia.o: $(UTILS_SRC)/yarandom.h
julia.o: $(UTILS_SRC)/visual.h
kaleidescope.o: $(UTILS_SRC)/spline.h
kaleidescope.o: $(srcdir)/screenhack.h
-kaleidescope.o: $(srcdir)/../config.h
+kaleidescope.o: ../config.h
kaleidescope.o: $(UTILS_SRC)/yarandom.h
kaleidescope.o: $(UTILS_SRC)/usleep.h
kaleidescope.o: $(UTILS_SRC)/resources.h
kaleidescope.o: $(UTILS_SRC)/grabscreen.h
kaleidescope.o: $(UTILS_SRC)/visual.h
laser.o: $(srcdir)/xlockmore.h
-laser.o: $(srcdir)/../config.h
+laser.o: ../config.h
laser.o: $(srcdir)/xlockmoreI.h
laser.o: $(srcdir)/screenhack.h
laser.o: $(UTILS_SRC)/yarandom.h
laser.o: $(UTILS_SRC)/grabscreen.h
laser.o: $(UTILS_SRC)/visual.h
lightning.o: $(srcdir)/xlockmore.h
-lightning.o: $(srcdir)/../config.h
+lightning.o: ../config.h
lightning.o: $(srcdir)/xlockmoreI.h
lightning.o: $(srcdir)/screenhack.h
lightning.o: $(UTILS_SRC)/yarandom.h
lightning.o: $(UTILS_SRC)/grabscreen.h
lightning.o: $(UTILS_SRC)/visual.h
lisa.o: $(srcdir)/xlockmore.h
-lisa.o: $(srcdir)/../config.h
+lisa.o: ../config.h
lisa.o: $(srcdir)/xlockmoreI.h
lisa.o: $(srcdir)/screenhack.h
lisa.o: $(UTILS_SRC)/yarandom.h
lisa.o: $(UTILS_SRC)/grabscreen.h
lisa.o: $(UTILS_SRC)/visual.h
lmorph.o: $(srcdir)/screenhack.h
-lmorph.o: $(srcdir)/../config.h
+lmorph.o: ../config.h
lmorph.o: $(UTILS_SRC)/yarandom.h
lmorph.o: $(UTILS_SRC)/usleep.h
lmorph.o: $(UTILS_SRC)/resources.h
lmorph.o: $(UTILS_SRC)/grabscreen.h
lmorph.o: $(UTILS_SRC)/visual.h
maze.o: $(srcdir)/screenhack.h
-maze.o: $(srcdir)/../config.h
+maze.o: ../config.h
maze.o: $(UTILS_SRC)/yarandom.h
maze.o: $(UTILS_SRC)/usleep.h
maze.o: $(UTILS_SRC)/resources.h
maze.o: $(UTILS_SRC)/visual.h
maze.o: $(UTILS_SRC)/erase.h
moire.o: $(srcdir)/screenhack.h
-moire.o: $(srcdir)/../config.h
+moire.o: ../config.h
moire.o: $(UTILS_SRC)/yarandom.h
moire.o: $(UTILS_SRC)/usleep.h
moire.o: $(UTILS_SRC)/resources.h
moire.o: $(UTILS_SRC)/grabscreen.h
moire.o: $(UTILS_SRC)/visual.h
noseguy.o: $(srcdir)/screenhack.h
-noseguy.o: $(srcdir)/../config.h
+noseguy.o: ../config.h
noseguy.o: $(UTILS_SRC)/yarandom.h
noseguy.o: $(UTILS_SRC)/usleep.h
noseguy.o: $(UTILS_SRC)/resources.h
noseguy.o: $(UTILS_SRC)/colors.h
noseguy.o: $(UTILS_SRC)/grabscreen.h
noseguy.o: $(UTILS_SRC)/visual.h
-noseguy.o: $(srcdir)/noses/nose-f1.xpm
-noseguy.o: $(srcdir)/noses/nose-f2.xpm
-noseguy.o: $(srcdir)/noses/nose-f3.xpm
-noseguy.o: $(srcdir)/noses/nose-f4.xpm
-noseguy.o: $(srcdir)/noses/nose-l1.xpm
-noseguy.o: $(srcdir)/noses/nose-l2.xpm
-noseguy.o: $(srcdir)/noses/nose-r1.xpm
-noseguy.o: $(srcdir)/noses/nose-r2.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-f1.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-f2.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-f3.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-f4.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-l1.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-l2.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-r1.xpm
+noseguy.o: $(srcdir)/images/noseguy/nose-r2.xpm
pedal.o: $(srcdir)/screenhack.h
-pedal.o: $(srcdir)/../config.h
+pedal.o: ../config.h
pedal.o: $(UTILS_SRC)/yarandom.h
pedal.o: $(UTILS_SRC)/usleep.h
pedal.o: $(UTILS_SRC)/resources.h
pedal.o: $(UTILS_SRC)/grabscreen.h
pedal.o: $(UTILS_SRC)/visual.h
penrose.o: $(srcdir)/xlockmore.h
-penrose.o: $(srcdir)/../config.h
+penrose.o: ../config.h
penrose.o: $(srcdir)/xlockmoreI.h
penrose.o: $(srcdir)/screenhack.h
penrose.o: $(UTILS_SRC)/yarandom.h
penrose.o: $(UTILS_SRC)/grabscreen.h
penrose.o: $(UTILS_SRC)/visual.h
pyro.o: $(srcdir)/screenhack.h
-pyro.o: $(srcdir)/../config.h
+pyro.o: ../config.h
pyro.o: $(UTILS_SRC)/yarandom.h
pyro.o: $(UTILS_SRC)/usleep.h
pyro.o: $(UTILS_SRC)/resources.h
pyro.o: $(UTILS_SRC)/grabscreen.h
pyro.o: $(UTILS_SRC)/visual.h
qix.o: $(srcdir)/screenhack.h
-qix.o: $(srcdir)/../config.h
+qix.o: ../config.h
qix.o: $(UTILS_SRC)/yarandom.h
qix.o: $(UTILS_SRC)/usleep.h
qix.o: $(UTILS_SRC)/resources.h
qix.o: $(UTILS_SRC)/visual.h
qix.o: $(UTILS_SRC)/alpha.h
rocks.o: $(srcdir)/screenhack.h
-rocks.o: $(srcdir)/../config.h
+rocks.o: ../config.h
rocks.o: $(UTILS_SRC)/yarandom.h
rocks.o: $(UTILS_SRC)/usleep.h
rocks.o: $(UTILS_SRC)/resources.h
rocks.o: $(UTILS_SRC)/grabscreen.h
rocks.o: $(UTILS_SRC)/visual.h
rorschach.o: $(srcdir)/screenhack.h
-rorschach.o: $(srcdir)/../config.h
+rorschach.o: ../config.h
rorschach.o: $(UTILS_SRC)/yarandom.h
rorschach.o: $(UTILS_SRC)/usleep.h
rorschach.o: $(UTILS_SRC)/resources.h
rorschach.o: $(UTILS_SRC)/erase.h
screenhack.o: $(UTILS_SRC)/xmu.h
screenhack.o: $(srcdir)/screenhack.h
-screenhack.o: $(srcdir)/../config.h
+screenhack.o: ../config.h
screenhack.o: $(UTILS_SRC)/yarandom.h
screenhack.o: $(UTILS_SRC)/usleep.h
screenhack.o: $(UTILS_SRC)/resources.h
screenhack.o: $(UTILS_SRC)/version.h
screenhack.o: $(UTILS_SRC)/vroot.h
sierpinski.o: $(srcdir)/xlockmore.h
-sierpinski.o: $(srcdir)/../config.h
+sierpinski.o: ../config.h
sierpinski.o: $(srcdir)/xlockmoreI.h
sierpinski.o: $(srcdir)/screenhack.h
sierpinski.o: $(UTILS_SRC)/yarandom.h
sierpinski.o: $(UTILS_SRC)/grabscreen.h
sierpinski.o: $(UTILS_SRC)/visual.h
slidescreen.o: $(srcdir)/screenhack.h
-slidescreen.o: $(srcdir)/../config.h
+slidescreen.o: ../config.h
slidescreen.o: $(UTILS_SRC)/yarandom.h
slidescreen.o: $(UTILS_SRC)/usleep.h
slidescreen.o: $(UTILS_SRC)/resources.h
slidescreen.o: $(UTILS_SRC)/grabscreen.h
slidescreen.o: $(UTILS_SRC)/visual.h
slip.o: $(srcdir)/xlockmore.h
-slip.o: $(srcdir)/../config.h
+slip.o: ../config.h
slip.o: $(srcdir)/xlockmoreI.h
slip.o: $(srcdir)/screenhack.h
slip.o: $(UTILS_SRC)/yarandom.h
slip.o: $(UTILS_SRC)/grabscreen.h
slip.o: $(UTILS_SRC)/visual.h
sphere.o: $(srcdir)/xlockmore.h
-sphere.o: $(srcdir)/../config.h
+sphere.o: ../config.h
sphere.o: $(srcdir)/xlockmoreI.h
sphere.o: $(srcdir)/screenhack.h
sphere.o: $(UTILS_SRC)/yarandom.h
sphere.o: $(UTILS_SRC)/grabscreen.h
sphere.o: $(UTILS_SRC)/visual.h
spiral.o: $(srcdir)/xlockmore.h
-spiral.o: $(srcdir)/../config.h
+spiral.o: ../config.h
spiral.o: $(srcdir)/xlockmoreI.h
spiral.o: $(srcdir)/screenhack.h
spiral.o: $(UTILS_SRC)/yarandom.h
spiral.o: $(UTILS_SRC)/grabscreen.h
spiral.o: $(UTILS_SRC)/visual.h
strange.o: $(srcdir)/xlockmore.h
-strange.o: $(srcdir)/../config.h
+strange.o: ../config.h
strange.o: $(srcdir)/xlockmoreI.h
strange.o: $(srcdir)/screenhack.h
strange.o: $(UTILS_SRC)/yarandom.h
strange.o: $(UTILS_SRC)/grabscreen.h
strange.o: $(UTILS_SRC)/visual.h
swirl.o: $(srcdir)/xlockmore.h
-swirl.o: $(srcdir)/../config.h
+swirl.o: ../config.h
swirl.o: $(srcdir)/xlockmoreI.h
swirl.o: $(srcdir)/screenhack.h
swirl.o: $(UTILS_SRC)/yarandom.h
swirl.o: $(UTILS_SRC)/grabscreen.h
swirl.o: $(UTILS_SRC)/visual.h
xlockmore.o: $(srcdir)/screenhack.h
-xlockmore.o: $(srcdir)/../config.h
+xlockmore.o: ../config.h
xlockmore.o: $(UTILS_SRC)/yarandom.h
xlockmore.o: $(UTILS_SRC)/usleep.h
xlockmore.o: $(UTILS_SRC)/resources.h
xlockmore.o: $(UTILS_SRC)/visual.h
xlockmore.o: $(srcdir)/xlockmoreI.h
xroger-hack.o: $(srcdir)/screenhack.h
-xroger-hack.o: $(srcdir)/../config.h
+xroger-hack.o: ../config.h
xroger-hack.o: $(UTILS_SRC)/yarandom.h
xroger-hack.o: $(UTILS_SRC)/usleep.h
xroger-hack.o: $(UTILS_SRC)/resources.h
xroger-hack.o: $(UTILS_SRC)/grabscreen.h
xroger-hack.o: $(UTILS_SRC)/visual.h
goop.o: $(srcdir)/screenhack.h
-goop.o: $(srcdir)/../config.h
+goop.o: ../config.h
goop.o: $(UTILS_SRC)/yarandom.h
goop.o: $(UTILS_SRC)/usleep.h
goop.o: $(UTILS_SRC)/resources.h
goop.o: $(UTILS_SRC)/spline.h
goop.o: $(UTILS_SRC)/alpha.h
starfish.o: $(srcdir)/screenhack.h
-starfish.o: $(srcdir)/../config.h
+starfish.o: ../config.h
starfish.o: $(UTILS_SRC)/yarandom.h
starfish.o: $(UTILS_SRC)/usleep.h
starfish.o: $(UTILS_SRC)/resources.h
starfish.o: $(UTILS_SRC)/visual.h
starfish.o: $(UTILS_SRC)/spline.h
munch.o: $(srcdir)/screenhack.h
-munch.o: $(srcdir)/../config.h
+munch.o: ../config.h
munch.o: $(UTILS_SRC)/yarandom.h
munch.o: $(UTILS_SRC)/usleep.h
munch.o: $(UTILS_SRC)/resources.h
munch.o: $(UTILS_SRC)/grabscreen.h
munch.o: $(UTILS_SRC)/visual.h
fadeplot.o: $(srcdir)/xlockmore.h
-fadeplot.o: $(srcdir)/../config.h
+fadeplot.o: ../config.h
fadeplot.o: $(srcdir)/xlockmoreI.h
fadeplot.o: $(srcdir)/screenhack.h
fadeplot.o: $(UTILS_SRC)/yarandom.h
fadeplot.o: $(UTILS_SRC)/grabscreen.h
fadeplot.o: $(UTILS_SRC)/visual.h
rd-bomb.o: $(srcdir)/screenhack.h
-rd-bomb.o: $(srcdir)/../config.h
+rd-bomb.o: ../config.h
rd-bomb.o: $(UTILS_SRC)/yarandom.h
rd-bomb.o: $(UTILS_SRC)/usleep.h
rd-bomb.o: $(UTILS_SRC)/resources.h
rd-bomb.o: $(UTILS_SRC)/grabscreen.h
rd-bomb.o: $(UTILS_SRC)/visual.h
coral.o: $(srcdir)/screenhack.h
-coral.o: $(srcdir)/../config.h
+coral.o: ../config.h
coral.o: $(UTILS_SRC)/yarandom.h
coral.o: $(UTILS_SRC)/usleep.h
coral.o: $(UTILS_SRC)/resources.h
coral.o: $(UTILS_SRC)/visual.h
coral.o: $(UTILS_SRC)/erase.h
mountain.o: $(srcdir)/xlockmore.h
-mountain.o: $(srcdir)/../config.h
+mountain.o: ../config.h
mountain.o: $(srcdir)/xlockmoreI.h
mountain.o: $(srcdir)/screenhack.h
mountain.o: $(UTILS_SRC)/yarandom.h
mountain.o: $(UTILS_SRC)/grabscreen.h
mountain.o: $(UTILS_SRC)/visual.h
triangle.o: $(srcdir)/xlockmore.h
-triangle.o: $(srcdir)/../config.h
+triangle.o: ../config.h
triangle.o: $(srcdir)/xlockmoreI.h
triangle.o: $(srcdir)/screenhack.h
triangle.o: $(UTILS_SRC)/yarandom.h
triangle.o: $(UTILS_SRC)/grabscreen.h
triangle.o: $(UTILS_SRC)/visual.h
lissie.o: $(srcdir)/xlockmore.h
-lissie.o: $(srcdir)/../config.h
+lissie.o: ../config.h
lissie.o: $(srcdir)/xlockmoreI.h
lissie.o: $(srcdir)/screenhack.h
lissie.o: $(UTILS_SRC)/yarandom.h
lissie.o: $(UTILS_SRC)/grabscreen.h
lissie.o: $(UTILS_SRC)/visual.h
worm.o: $(srcdir)/xlockmore.h
-worm.o: $(srcdir)/../config.h
+worm.o: ../config.h
worm.o: $(srcdir)/xlockmoreI.h
worm.o: $(srcdir)/screenhack.h
worm.o: $(UTILS_SRC)/yarandom.h
worm.o: $(UTILS_SRC)/grabscreen.h
worm.o: $(UTILS_SRC)/visual.h
rotor.o: $(srcdir)/xlockmore.h
-rotor.o: $(srcdir)/../config.h
+rotor.o: ../config.h
rotor.o: $(srcdir)/xlockmoreI.h
rotor.o: $(srcdir)/screenhack.h
rotor.o: $(UTILS_SRC)/yarandom.h
rotor.o: $(UTILS_SRC)/grabscreen.h
rotor.o: $(UTILS_SRC)/visual.h
ant.o: $(srcdir)/xlockmore.h
-ant.o: $(srcdir)/../config.h
+ant.o: ../config.h
ant.o: $(srcdir)/xlockmoreI.h
ant.o: $(srcdir)/screenhack.h
ant.o: $(UTILS_SRC)/yarandom.h
ant.o: $(UTILS_SRC)/visual.h
ant.o: $(UTILS_SRC)/erase.h
xjack.o: $(srcdir)/screenhack.h
-xjack.o: $(srcdir)/../config.h
+xjack.o: ../config.h
xjack.o: $(UTILS_SRC)/yarandom.h
xjack.o: $(UTILS_SRC)/usleep.h
xjack.o: $(UTILS_SRC)/resources.h
xjack.o: $(UTILS_SRC)/grabscreen.h
xjack.o: $(UTILS_SRC)/visual.h
xlyap.o: $(srcdir)/screenhack.h
-xlyap.o: $(srcdir)/../config.h
+xlyap.o: ../config.h
xlyap.o: $(UTILS_SRC)/yarandom.h
xlyap.o: $(UTILS_SRC)/usleep.h
xlyap.o: $(UTILS_SRC)/resources.h
xlyap.o: $(UTILS_SRC)/visual.h
xlyap.o: $(UTILS_SRC)/vroot.h
puzzle.o: $(srcdir)/screenhack.h
-puzzle.o: $(srcdir)/../config.h
+puzzle.o: ../config.h
puzzle.o: $(UTILS_SRC)/yarandom.h
puzzle.o: $(UTILS_SRC)/usleep.h
puzzle.o: $(UTILS_SRC)/resources.h
puzzle.o: $(UTILS_SRC)/colors.h
puzzle.o: $(UTILS_SRC)/grabscreen.h
puzzle.o: $(UTILS_SRC)/visual.h
-puzzle.o: $(srcdir)/pieces/puzzle_a_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_n_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_ne_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_e_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_se_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_s_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_sw_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_w_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_nw_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_n_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_ne_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_e_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_se_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_s_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_sw_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_w_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_nw_h.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_n_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_ne_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_e_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_se_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_s_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_sw_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_w_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_a_nw_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_n_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_ne_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_e_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_se_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_s_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_sw_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_w_f.xbm
-puzzle.o: $(srcdir)/pieces/puzzle_b_nw_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_n_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_ne_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_e_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_se_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_s_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_sw_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_w_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_nw_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_n_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_ne_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_e_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_se_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_s_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_sw_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_w_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_nw_h.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_n_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_ne_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_e_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_se_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_s_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_sw_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_w_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_a_nw_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_n_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_ne_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_e_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_se_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_s_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_sw_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_w_f.xbm
+puzzle.o: $(srcdir)/images/puzzle/puzzle_b_nw_f.xbm
xscreensaver-sgigl.o: $(UTILS_SRC)/vroot.h
+cynosure.o: $(srcdir)/screenhack.h
+cynosure.o: ../config.h
+cynosure.o: $(UTILS_SRC)/yarandom.h
+cynosure.o: $(UTILS_SRC)/usleep.h
+cynosure.o: $(UTILS_SRC)/resources.h
+cynosure.o: $(UTILS_SRC)/hsv.h
+cynosure.o: $(UTILS_SRC)/colors.h
+cynosure.o: $(UTILS_SRC)/grabscreen.h
+cynosure.o: $(UTILS_SRC)/visual.h
+moire2.o: $(srcdir)/screenhack.h
+moire2.o: ../config.h
+moire2.o: $(UTILS_SRC)/yarandom.h
+moire2.o: $(UTILS_SRC)/usleep.h
+moire2.o: $(UTILS_SRC)/resources.h
+moire2.o: $(UTILS_SRC)/hsv.h
+moire2.o: $(UTILS_SRC)/colors.h
+moire2.o: $(UTILS_SRC)/grabscreen.h
+moire2.o: $(UTILS_SRC)/visual.h
"*count: -3 \n" \
"*cycles: 40000 \n" \
"*size: -7 \n" \
- "*ncolors: 64 \n" \
- "*eraseSpeed: 400 \n" \
- "*eraseMode: -1 \n"
+ "*ncolors: 64 \n"
# include "xlockmore.h" /* in xscreensaver distribution */
# include "erase.h"
#else /* STANDALONE */
# endif /* VMS */
#endif
-#include "default.xbm"
+#include "images/som.xbm"
static Display *dpy;
static Window window;
if (!strcmp (bitmap_name, "(default)"))
{
- width = logo_width;
- height = logo_height;
- bitmap = XCreatePixmapFromBitmapData (dpy, window, (char *) logo_bits,
+ width = som_width;
+ height = som_height;
+ bitmap = XCreatePixmapFromBitmapData (dpy, window, (char *) som_bits,
width, height, fg, bg, depth);
scale_up = True; /* definitely. */
}
+++ /dev/null
-#define bob_width 61
-#define bob_height 75
-static unsigned char bob_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x07,0x00,
- 0x00,0x00,0x00,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xfb,
- 0x00,0x00,0x00,0xc0,0xff,0xcf,0x9f,0xd1,0x03,0x00,0x00,0xf0,0x7f,0x8c,0x33,
- 0x91,0x07,0x00,0x00,0xf8,0xa7,0x18,0x27,0xb1,0x06,0x00,0x00,0xfc,0x47,0x31,
- 0x4e,0xa6,0x0e,0x00,0x00,0xfe,0x4f,0x21,0x4c,0xae,0x3d,0x00,0x00,0xff,0xdf,
- 0x23,0x8d,0xbe,0x7d,0x00,0x80,0xff,0xff,0x67,0xbd,0xfe,0xff,0x01,0x80,0xff,
- 0xff,0x7f,0xbf,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,0xbf,0xff,0xf8,0x07,0xc0,
- 0xff,0xff,0xff,0xbf,0x3f,0xf8,0x07,0xc0,0xff,0xff,0xff,0xff,0x07,0xf8,0x0f,
- 0xc0,0xff,0xff,0xff,0x3f,0x00,0xf8,0x0f,0xe0,0x7f,0x00,0xf8,0x07,0x00,0xf0,
- 0x0f,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,
- 0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf4,0x07,0xe0,0x3f,0x00,0x00,0x00,
- 0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00,
- 0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe7,0x07,0xe0,0x3f,0x00,
- 0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f,
- 0x00,0x00,0x00,0x00,0xe6,0x07,0xc0,0x3f,0x00,0x00,0x00,0x78,0xf6,0x07,0xa0,
- 0xbf,0xff,0x00,0x00,0xff,0xf7,0x07,0x70,0x9f,0xff,0x01,0x80,0xff,0xef,0x07,
- 0xf0,0x1c,0x80,0x03,0xe0,0x01,0xef,0x07,0xf0,0x1f,0xbe,0x07,0xf0,0x3f,0xee,
- 0x07,0xe0,0x9d,0x83,0x1f,0xf8,0xe1,0xdc,0x07,0xe0,0xc1,0x7f,0x1f,0xfc,0xff,
- 0xc8,0x07,0xe0,0xc1,0x69,0x1e,0x7e,0xca,0xc0,0x03,0xe0,0x81,0xb8,0x1f,0xc0,
- 0x0e,0xc0,0x03,0xe0,0x01,0xc0,0x1b,0xc0,0xcf,0xc1,0x03,0xc0,0x03,0xf7,0x11,
- 0x00,0x7f,0xc0,0x03,0xc0,0x03,0x7c,0x18,0x00,0x1c,0xc0,0x02,0xc0,0x02,0x30,
- 0x08,0x00,0x00,0x40,0x03,0x40,0x03,0x00,0x08,0x00,0x00,0x40,0x02,0x40,0x13,
- 0x00,0x0c,0x00,0x00,0x60,0x02,0x40,0x12,0x00,0x0e,0x00,0x00,0xc0,0x03,0x80,
- 0x33,0x80,0x0e,0x00,0x00,0xa8,0x01,0x00,0x33,0x40,0x0f,0xa0,0x03,0x2c,0x00,
- 0x00,0x74,0x30,0x0f,0x38,0x07,0x2e,0x00,0x00,0x74,0x98,0x1f,0x1e,0x1e,0x2f,
- 0x00,0x00,0xfc,0x8f,0xff,0x0f,0xfc,0x2f,0x00,0x00,0xf8,0xe3,0xff,0x03,0xf8,
- 0x2f,0x00,0x00,0xf8,0xfd,0xff,0x81,0xff,0x3f,0x00,0x00,0xb8,0xf9,0x1f,0xf8,
- 0x0f,0x1e,0x00,0x00,0x30,0xf1,0xf0,0x0f,0x03,0x0e,0x00,0x00,0x30,0xf1,0x01,
- 0x80,0x01,0x0f,0x00,0x00,0x20,0xf1,0xf7,0xff,0x00,0x07,0x00,0x00,0x60,0xe3,
- 0x01,0x60,0x80,0x07,0x00,0x00,0x60,0xc3,0xef,0x3f,0x80,0x03,0x00,0x00,0x40,
- 0xc2,0xff,0x0f,0xc0,0x03,0x00,0x00,0xc0,0xe6,0x1f,0x00,0xc0,0x01,0x00,0x00,
- 0x80,0xf4,0xfe,0x3f,0xe0,0x00,0x00,0x00,0x80,0x79,0xfe,0x1f,0xe0,0x00,0x00,
- 0xc0,0x01,0x3d,0x3e,0x00,0x70,0x00,0x00,0x30,0x06,0x3e,0x0f,0x00,0x38,0x00,
- 0x00,0xc8,0x8c,0x1f,0x07,0x00,0x38,0x00,0x00,0xf4,0xcc,0x8f,0x07,0x00,0x1c,
- 0x00,0x00,0x72,0xee,0xf7,0x07,0x00,0x0e,0x00,0x00,0x02,0xff,0xe3,0x07,0x00,
- 0x07,0x00,0x00,0x32,0xfe,0xc1,0xff,0x8f,0x03,0x00,0x00,0x3e,0xfe,0x80,0xff,
- 0xff,0x01,0x00,0x00,0x7e,0x7c,0x00,0x00,0x7e,0x00,0x00,0x00,0x7c,0x3c,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xfc,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x1c,
- 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
- 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00};
"*size: -7 \n" \
"*cycles: 100 \n" \
"*delay: 1000 \n" \
- "*ncolors: 64 \n" \
- "*eraseSpeed: 400 \n" \
- "*eraseMode: -1 \n"
+ "*ncolors: 64 \n"
# define UNIFORM_COLORS
# include "xlockmore.h" /* from the xscreensaver distribution */
# include "erase.h"
--- /dev/null
+/* bubbles_default.c - pick images for bubbles.c
+ * By Jamie Zawinski <jwz@netscape.com>, 20-Jan-98.
+ *
+ * Permission to use, copy, modify, distribute, and sell this software and its
+ * documentation for any purpose is hereby granted without fee, provided that
+ * the above copyright notice appear in all copies and that both that
+ * copyright notice and this permission notice appear in supporting
+ * documentation. No representations are made about the suitability of this
+ * software for any purpose. It is provided "as is" without express or
+ * implied warranty.
+ */
+
+#ifdef HAVE_CONFIG_H
+# include "config.h"
+#endif
+
+#include <stdio.h>
+#include <stdlib.h>
+#include "bubbles.h"
+#include "yarandom.h"
+
+#ifndef NO_DEFAULT_BUBBLE
+
+# define BLOOD 0
+# include "images/bubbles/blood1.xpm"
+# include "images/bubbles/blood2.xpm"
+# include "images/bubbles/blood3.xpm"
+# include "images/bubbles/blood4.xpm"
+# include "images/bubbles/blood5.xpm"
+# include "images/bubbles/blood6.xpm"
+# include "images/bubbles/blood7.xpm"
+# include "images/bubbles/blood8.xpm"
+# include "images/bubbles/blood9.xpm"
+# include "images/bubbles/blood10.xpm"
+# include "images/bubbles/blood11.xpm"
+
+# define BLUE 1
+# include "images/bubbles/blue1.xpm"
+# include "images/bubbles/blue2.xpm"
+# include "images/bubbles/blue3.xpm"
+# include "images/bubbles/blue4.xpm"
+# include "images/bubbles/blue5.xpm"
+# include "images/bubbles/blue6.xpm"
+# include "images/bubbles/blue7.xpm"
+# include "images/bubbles/blue8.xpm"
+# include "images/bubbles/blue9.xpm"
+# include "images/bubbles/blue10.xpm"
+# include "images/bubbles/blue11.xpm"
+
+# define GLASS 2
+# include "images/bubbles/glass1.xpm"
+# include "images/bubbles/glass2.xpm"
+# include "images/bubbles/glass3.xpm"
+# include "images/bubbles/glass4.xpm"
+# include "images/bubbles/glass5.xpm"
+# include "images/bubbles/glass6.xpm"
+# include "images/bubbles/glass7.xpm"
+# include "images/bubbles/glass8.xpm"
+# include "images/bubbles/glass9.xpm"
+# include "images/bubbles/glass10.xpm"
+# include "images/bubbles/glass11.xpm"
+
+# define JADE 3
+# include "images/bubbles/jade1.xpm"
+# include "images/bubbles/jade2.xpm"
+# include "images/bubbles/jade3.xpm"
+# include "images/bubbles/jade4.xpm"
+# include "images/bubbles/jade5.xpm"
+# include "images/bubbles/jade6.xpm"
+# include "images/bubbles/jade7.xpm"
+# include "images/bubbles/jade8.xpm"
+# include "images/bubbles/jade9.xpm"
+# include "images/bubbles/jade10.xpm"
+# include "images/bubbles/jade11.xpm"
+
+# define END 4
+
+
+char **default_bubbles[50];
+int num_default_bubbles;
+
+void init_default_bubbles(void)
+{
+ int i = 0;
+ switch (random() % END) {
+ case BLOOD:
+ default_bubbles[i++] = blood1;
+ default_bubbles[i++] = blood2;
+ default_bubbles[i++] = blood3;
+ default_bubbles[i++] = blood4;
+ default_bubbles[i++] = blood5;
+ default_bubbles[i++] = blood6;
+ default_bubbles[i++] = blood7;
+ default_bubbles[i++] = blood8;
+ default_bubbles[i++] = blood9;
+ default_bubbles[i++] = blood10;
+ default_bubbles[i++] = blood11;
+ break;
+
+ case BLUE:
+ default_bubbles[i++] = blue1;
+ default_bubbles[i++] = blue2;
+ default_bubbles[i++] = blue3;
+ default_bubbles[i++] = blue4;
+ default_bubbles[i++] = blue5;
+ default_bubbles[i++] = blue6;
+ default_bubbles[i++] = blue7;
+ default_bubbles[i++] = blue8;
+ default_bubbles[i++] = blue9;
+ default_bubbles[i++] = blue10;
+ default_bubbles[i++] = blue11;
+ break;
+
+ case GLASS:
+ default_bubbles[i++] = glass1;
+ default_bubbles[i++] = glass2;
+ default_bubbles[i++] = glass3;
+ default_bubbles[i++] = glass4;
+ default_bubbles[i++] = glass5;
+ default_bubbles[i++] = glass6;
+ default_bubbles[i++] = glass7;
+ default_bubbles[i++] = glass8;
+ default_bubbles[i++] = glass9;
+ default_bubbles[i++] = glass10;
+ default_bubbles[i++] = glass11;
+ break;
+
+ case JADE:
+ default_bubbles[i++] = jade1;
+ default_bubbles[i++] = jade2;
+ default_bubbles[i++] = jade3;
+ default_bubbles[i++] = jade4;
+ default_bubbles[i++] = jade5;
+ default_bubbles[i++] = jade6;
+ default_bubbles[i++] = jade7;
+ default_bubbles[i++] = jade8;
+ default_bubbles[i++] = jade9;
+ default_bubbles[i++] = jade10;
+ default_bubbles[i++] = jade11;
+ break;
+
+ default:
+ abort();
+ break;
+ }
+
+ default_bubbles[i] = 0;
+ num_default_bubbles = i;
+}
+
+#endif /* NO_DEFAULT_BUBBLE */
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Blood_Marble
- scale <2, 2, 2>
- rotate <0, 20, 0> }
- finish { Dull }
-}
-
-light_source {<6, 1, 0> color White}
-/* light_source {<6.1, 1, 0> color White} */
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Blue_Agate
- scale <0.7, 0.7, 0.7> }
- finish { phong 1 }
-}
-
-light_source {<6, 1, 0> color White}
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Glass
- scale <0.7, 0.7, 0.7>
- rotate y*clock
- normal {bumps 0.4 scale 0.1}
- finish { Shiny }
-# finish { phong 0.4 }
- }
-}
-
-light_source {<6, 7, 0> color White}
-light_source {<6.1, 1, 0> color Blue}
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Jade
- scale <0.7, 0.7, 0.7>
- rotate y*clock }
- finish { phong 0.4 }
-}
-
-light_source {<6, 1, 0> color White}
-light_source {<6.1, 1, 0> color White}
+++ /dev/null
-#!/usr/bin/perl
-#
-# $Id: bubblestodefault,v 1.1 1996/09/08 01:35:51 jwz Exp $
-#
-#----------------------------------------------------------------------------
-# Copyright (C) 1995-1996 James Macnicol
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by the
-# Free Software Foundation; either version 2, or (at your option) any later
-# version.
-#
-# This program is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
-# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# for more details.
-#-----------------------------------------------------------------------------
-#
-# Contact me (J.Macnicol@student.anu.edu.au) if you have problems.
-#
-# [ The moral of this story is use a version of rm which safely backs up
-# files when you delete them in case you do something stupid like
-# "rm * xpm" which trashed all the scripts in this directory so I had
-# to write them again. Grrrrrr..... ]
-#
-#-----------------------------------------------------------------------------
-#
-# This script takes a set of XPM files (from povbubbles, for example)
-# whose names are listed in file with extension .names (of same format
-# as output by povbubbles) and puts them together into a file which can
-# be used in place of the source file bubbles_default.c which comes with
-# bubbles/xscreensaver.
-#
-# To use it, provide as an argument the base-name of the .names file,
-# i.e. if you ran povbubbles on the file foo.pov by typing "povbubbles foo"
-# then this created a file "foo.names" so you can now make a new
-# bubbles_default.c by typing "bubblestodefault foo".
-#
-
-sub die_help {
- print STDERR "Usage: $0 [-help] base-name\n";
- print STDERR " -help gives this message.\n";
- print STDERR " base-name is the name of the file used to generate\n";
- print STDERR " the XPM files, e.g. if you invoked povbubbles with\n";
- print STDERR " \"povbubbles foo\"\n";
- print STDERR " then you should invoke $0 with\n";
- die(" \"$0 foo\"\n");
-}
-
-sub die_usage {
- die "Usage: $0 [-help] base-name\n";
-}
-
-$infile = undef;
-
-# Process command line arguments
-while ($op = shift) {
- if ($op eq "-help") {
- &die_help;
- } else {
- $infile = $op;
- # Ignore further arguments
- break;
- }
-}
-if ($infile eq undef) {
- &die_usage;
-}
-
-$namesfile = $infile . ".names";
-
-if (! -f $namesfile) {
- die("File list $namesfile doesn't exist\n");
-}
-
-if (-f "bubbles_default.c") {
- print "Backing up bubbles_default.c...\n";
- system("mv -f bubbles_default.c bubbles_default.c.bak");
-}
-
-open(OUT, ">bubbles_default.c") || die("Couldn't open bubbles_default.c\n");
-print OUT "#include <stdio.h>\n";
-print OUT "#include \"bubbles.h\"\n";
-print OUT "\n";
-print OUT "#ifndef NO_DEFAULT_BUBBLE\n";
-print OUT "\n";
-
-open(NAMES, $namesfile) || die ("Couldn't open $namesfile\n");
-$numbubbles = 0;
-while (<NAMES>) {
- if (/\s*(\S+)\:(\S+)\s*/) {
- $filename = $1;
- $xpmname = $2;
- $xpmlist = $xpmlist . $xpmname . ", ";
- open(CAT, $filename) || die("Couldn't open file $filename listed in\
-$namesfile\n");
- while (<CAT>) {
- print OUT;
- }
- close(CAT);
- $numbubbles++;
- } else {
- print STDERR "Can't understand the line \"$_\"\n";
- print STDERR " in $namesfile. Ignoring...\n";
- }
-}
-print OUT "char **default_bubbles[] = {$xpmlist";
-print OUT "(char **)0};\n";
-print OUT "\n";
-print OUT "int num_default_bubbles = $numbubbles;\n";
-print OUT "\n";
-print OUT "#endif /* NO_DEFAULT_BUBBLE */\n";
-
-close(NAMES);
-close(OUT);
+++ /dev/null
-#!/usr/bin/perl
-#
-# $Id: bubblestofile,v 1.1 1996/09/08 01:35:52 jwz Exp $
-#
-#----------------------------------------------------------------------------
-# Copyright (C) 1995-1996 James Macnicol
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by the
-# Free Software Foundation; either version 2, or (at your option) any later
-# version.
-#
-# This program is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
-# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# for more details.
-#-----------------------------------------------------------------------------
-#
-# Contact me (J.Macnicol@student.anu.edu.au) if you have problems.
-#
-# [ The moral of this story is use a version of rm which safely backs up
-# files when you delete them in case you do something stupid like
-# "rm * xpm" which trashed all the scripts in this directory so I had
-# to write them again. Grrrrrr..... ]
-#
-#-----------------------------------------------------------------------------
-#
-# This script takes a set of XPM files (from povbubbles, for example)
-# whose names are listed in file with extension .names (of same format
-# as output by povbubbles) and puts them together into a file which can
-# loaded with the -file option or place in a directory suitable for
-# use with the -directory option to bubbles. Note that neither of these
-# options are available if you have just compiled bubbles as provided.
-# You must edit bubbles.h to enable these. Files generated by this script
-# have by default the extension ".bub".
-#
-# To use it, provide as an argument the base-name of the .names file,
-# i.e. if you ran povbubbles on the file foo.pov by typing "povbubbles foo"
-# then this created a file "foo.names" so you can now make the loadable file
-# "foo.bub" by typing "bubblestofile foo".
-#
-
-sub die_help {
- print STDERR "Usage: $0 [-help] base-name\n";
- print STDERR " -help\n";
- print STDERR " gives this message.\n";
- print STDERR " base-name is the name of the file used to generate\n";
- print STDERR " the XPM files, e.g. if you invoked povbubbles with\n";
- print STDERR " \"povbubbles foo\"\n";
- print STDERR " then you should invoke $0 with\n";
- die(" \"$0 foo\"\n");
-}
-
-sub die_usage {
- die "Usage: $0 [-help] base-name\n";
-}
-
-$infile = undef;
-
-# Process command line arguments
-while ($op = shift) {
- if ($op eq "-help") {
- &die_help;
- } else {
- $infile = $op;
- # Ignore further arguments
- break;
- }
-}
-if ($infile eq undef) {
- &die_usage;
-}
-
-$namesfile = $infile . ".names";
-$outfile = $infile . ".bub";
-
-if (! -f $namesfile) {
- die("File list $namesfile doesn't exist\n");
-}
-
-if (-f $outfile) {
- print "Backing up $outfile\n";
- system("mv -f $outfile $outfile.bak");
-}
-
-open(OUT, ">$outfile") || die("Couldn't open $outfile\n");
-open(NAMES, $namesfile) || die ("Couldn't open $namesfile\n");
-$numbubbles = 0;
-while (<NAMES>) {
- if (/\s*(\S+)\:(\S+)\s*/) {
- $filename = $1;
- $xpmname = $2;
- open(CAT, $filename) || die("Couldn't open file $filename listed in\
-$namesfile\n");
- while (<CAT>) {
- print OUT;
- }
- close(CAT);
- } else {
- print STDERR "Can't understand the line \"$_\"\n";
- print STDERR " in $namesfile. Ignoring...\n";
- }
-}
-close(NAMES);
-close(OUT);
-
-
+++ /dev/null
-#!/usr/bin/perl
-#----------------------------------------------------------------------------
-# Copyright (C) 1995-1996 James Macnicol
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by the
-# Free Software Foundation; either version 1, or (at your option) any later
-# version.
-#
-# This program is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
-# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# for more details.
-#-----------------------------------------------------------------------------
-#
-# Prints to the stdout a file suitable for use as bubbles_default.c for the
-# bubbles screensaver (i.e. the default bubble which is compiled into the
-# executable). A list of XPMs is expected as input, e.g. output from the
-# pov2xpm script in this directory.
-#
-# Remember to change the path to your perl executable at the top of the
-# script if it is wrong.
-#
-# Examples of usage:
-#
-# pov2xpm sample.pov | xpm2default > bubbles_default.c
-#
-# A new set of bubbles is first created with pov2xpm then passed to this
-# script which places the C wrapper around the data and finally dumps the
-# output into bubbles_default.c.
-#
-# xpm2default < sample.xpm > bubbles_default.c
-#
-# Same as the previous example except the XPM data came from a file rather
-# than a pipe.
-#
-$numargs = @ARGV;
-print "#include \"bubbles.h\"\n";
-print "\n";
-print "#ifndef NO_DEFAULT_BUBBLE\n";
-print "\n";
-print "char *default_ball_data[] = {\n";
-while (<STDIN>) {
- chop;
- s/"/\\"/g;
- print "\"$_\",\n";
-}
-print "(char *)0\n";
-print "};\n";
-print "\n";
-print "#endif\n";
/* bubbles.c - frying pan / soft drink in a glass simulation */
-/*$Id: bubbles.c,v 1.10 1997/12/03 10:56:13 jwz Exp $*/
+/*$Id: bubbles.c,v 1.13 1998/02/21 21:55:14 jwz Exp $*/
/*
* Copyright (C) 1995-1996 James Macnicol
*
- * This program is free software; you can redistribute it and/or modify
- * it under the terms of the GNU General Public License as published by the
- * Free Software Foundation; either version 2, or (at your option) any later
- * version.
- *
- * This program is distributed in the hope that it will be useful, but
- * WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
- * or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * for more details.
+ * Permission to use, copy, modify, distribute, and sell this software and its
+ * documentation for any purpose is hereby granted without fee, provided that
+ * the above copyright notice appear in all copies and that both that
+ * copyright notice and this permission notice appear in supporting
+ * documentation. No representations are made about the suitability of this
+ * software for any purpose. It is provided "as is" without express or
+ * implied warranty.
*/
/*
#include "screenhack.h"
#include "bubbles.h"
-#ifdef BUBBLES_IO
-# include <dirent.h>
-# include <fcntl.h>
-# include <sys/types.h>
-#endif /* BUBBLES_IO */
-
#include <limits.h>
-#ifdef SIGNAL_NONSENSE /* what's this crap doing in here? */
-#include <signal.h>
-#endif /* SIGNAL_NONSENSE */
-
#include <stdio.h>
-#include <stdlib.h>
#include <string.h>
#ifndef VMS
#include "yarandom.h"
#ifdef HAVE_XPM
-#include <X11/xpm.h>
+# include <X11/xpm.h>
#endif
/*
* Public variables
*/
-#ifndef NO_DEFAULT_BUBBLE
+extern void init_default_bubbles(void);
extern int num_default_bubbles;
extern char **default_bubbles[];
-#endif /* NO_DEFAULT_BUBBLE */
char *progclass = "Bubbles";
char *defaults [] = {
- "*background: black",
- "*foreground: white",
- "*simple: false",
- "*broken: false",
- "*delay: 800",
-#ifdef BUBBLES_IO
- "*file: (default)",
- "*directory: (default)",
-#endif /* BUBBLES_IO */
- "*quiet: false",
- "*nodelay: false",
- "*3D: false",
- "*geometry: 400x300",
+ "Bubbles.background: black",
+ "*foreground: white",
+ "*simple: false",
+ "*broken: false",
+ "*delay: 800",
+ "*quiet: false",
+ "*nodelay: false",
+ "*3D: false",
0
};
{ "-quiet", ".quiet", XrmoptionNoArg, "true" },
{ "-nodelay", ".nodelay", XrmoptionNoArg, "true" },
{ "-3D", ".3D", XrmoptionNoArg, "true" },
-#ifdef BUBBLES_IO
- { "-file", ".file", XrmoptionSepArg, 0 },
- { "-directory", ".directory", XrmoptionSepArg, 0 },
-#endif /* BUBBLES_IO */
{ "-delay", ".delay", XrmoptionSepArg, 0 },
{ 0, 0, 0, 0 }
};
#ifdef HAVE_XPM
static int num_bubble_pixmaps;
static Bubble_Step **step_pixmaps;
-#ifdef BUBBLES_IO
-static char *pixmap_file;
-#endif /* BUBBLES_IO */
-static int use_default_bubble;
#endif /* HAVE_XPM */
/* Options stuff */
#ifdef HAVE_XPM
-static void
-free_pixmaps (void)
-/* Free resources associated with XPM */
-{
- int i;
-
-#ifdef DEBUG
- if (simple) {
- fprintf(stderr, "free_pixmaps() called in simple mode\n");
- exit(1);
- }
- printf("free_pixmaps()\n");
-#endif /* DEBUG */
-
- for(i = 0; i < (num_bubble_pixmaps - 1); i++) {
- XFreePixmap(defdsp, step_pixmaps[i]->ball);
- XFreePixmap(defdsp, step_pixmaps[i]->shape_mask);
- XFreeGC(defdsp, step_pixmaps[i]->draw_gc);
- XFreeGC(defdsp, step_pixmaps[i]->erase_gc);
- XFreeColors(defdsp, defcmap, step_pixmaps[i]->xpmattrs.pixels,
- step_pixmaps[i]->xpmattrs.npixels, 0);
- XpmFreeAttributes(&step_pixmaps[i]->xpmattrs);
- }
-}
-
-#ifdef SIGNAL_NONSENSE
-static void
-onintr(int a)
-/* This gets called when SIGINT or SIGTERM is received */
-{
- free_pixmaps();
- exit(0);
-}
-
-#ifdef DEBUG
-static void
-onsegv(int a)
-/* Called when SEGV detected. Hmmmmm.... */
-{
- fflush(stdout);
- fprintf(stderr, "SEGV detected! : %d\n", a);
- exit(1);
-}
-#endif /* DEBUG */
-#endif /* SIGNAL_NONSENSE */
-
-
/*
* Pixmaps without file I/O (but do have XPM)
*/
#endif /* DEBUG */
}
-#ifndef NO_DEFAULT_BUBBLE
static void
make_pixmap_from_default(char **pixmap_data, Bubble_Step *bl)
/* Read pixmap data which has been compiled into the program and a pointer
Bubble_Step *newpix, *tmppix;
char **pixpt;
- /* Make sure pixmaps are freed when program is terminated */
- /* This is when I hit ^C */
-#ifdef SIGNAL_NONSENSE
- if (signal(SIGINT, SIG_IGN) != SIG_IGN)
- signal(SIGINT, onintr);
- /* xscreensaver sends SIGTERM */
- if (signal(SIGTERM, SIG_IGN) != SIG_IGN)
- signal(SIGTERM, onintr);
-#ifdef DEBUG
- if (signal(SIGSEGV, SIG_IGN) != SIG_IGN) {
- printf("Setting signal handler for SIGSEGV\n");
- signal(SIGSEGV, onsegv);
- } else {
- printf("Didn't set signal hanlder for SIGSEGV\n");
- }
-#endif /* DEBUG */
-#endif /* SIGNAL_NONSENSE */
+ init_default_bubbles();
for (i = 0; i < num_default_bubbles; i++) {
pixpt = default_bubbles[i];
make_pixmap_array(pixmap_list);
}
-#endif /* NO_DEFAULT_BUBBLE */
-
#endif /* HAVE_XPM */
-/*
- * File I/O stuff
- */
-
-#ifdef BUBBLES_IO
-
-static DIR *
-my_opendir(char *name)
-/* Like opendir() but checks for things so we don't have to do it multiple
-times in the code. */
-{
- DIR *rv;
-
- if (name == (char *)NULL) {
- fprintf(stderr, "NULL directory name\n");
- return (DIR *)NULL;
- }
-
- if ((rv = opendir(name)) == NULL) {
- perror(name);
- return (DIR *)NULL;
- }
-
- return rv;
-}
-
-static int
-regular_file(char *name)
-/* Check to see if we can use the named file. This was broken under Linux
-1.3.45 but seems to be okay under 1.3.54. The parameter "name" was being
-trashed if the file didn't exist. Yeah, I know 1.3.x are development
-kernels....
-*/
-{
- int fd;
-
- if ((fd = open(name, O_RDONLY)) == -1) {
- perror(name);
- return 0;
- } else {
- close(fd);
- return 1;
- }
-}
-
-static char *
-get_random_name(char *dir)
-/* Pick an appropriate file at random out of the files in the directory dir */
-{
- STRUCT_DIRENT *dp;
- DIR *dfd;
- int numentries = 0;
- int entnum;
- int x;
- char buf[PATH_BUF_SIZE];
- char *rv;
-
- if ((dfd = my_opendir(dir)) == (DIR *)NULL)
- return (char *)NULL;
-
- while ((dp = readdir(dfd)) != NULL) {
- if ((strcmp(DIRENT_NAME, ".") == 0) || (strcmp(DIRENT_NAME, "..") == 0))
- continue;
- if ((strlen(dir)+strlen(DIRENT_NAME)+2) > 1024) {
- fprintf(stderr, "name %s/%s too long\n", dir, DIRENT_NAME);
- continue;
- }
- if (sprintf(buf, "%s/%s", dir, DIRENT_NAME) > (PATH_BUF_SIZE-1)) {
- fprintf(stderr, "path buffer overflowed in get_random_name()\n");
- continue;
- }
- if (regular_file(buf))
- ++numentries;
- }
- closedir(dfd);
- if (numentries == 0) {
- fprintf(stderr, "No suitable files found in %s\n", dir);
- return (char *)NULL;
- }
- entnum = ya_random() % numentries;
- x = 0;
-
- if ((dfd = my_opendir(dir)) == (DIR *)NULL)
- return (char *)NULL;
- while ((dp = readdir(dfd)) != NULL) {
- if ((strcmp(DIRENT_NAME, ".") == 0) || (strcmp(DIRENT_NAME, "..") == 0))
- continue;
- if ((strlen(dir)+strlen(DIRENT_NAME)+2) > 1024) {
- /* We warned about this previously */
- continue;
- }
- if (sprintf(buf, "%s/%s", dir, DIRENT_NAME) > (PATH_BUF_SIZE-1)) {
- fprintf(stderr, "path buffer overflowed in get_random_name()\n");
- continue;
- }
- if (regular_file(buf)) {
- if (x == entnum) {
- rv = (char *)xmalloc(1024 * sizeof(char));
- strcpy(rv, buf);
- closedir(dfd);
- return rv;
- }
- ++x;
- }
- }
- /* We've screwed up if we reach here - someone must have deleted all the
- files while we were counting them... */
- fprintf(stderr, "get_random_name(): Oops!\n");
- exit(1);
-}
-
-static int
-read_line(int fd, char **buf, int bufsize)
-/* A line is read from fd until a '\n' is found or EOF is reached. (*buf)
-is initially of length bufsize and is extended by bufsize chars if need
-be (for as many times as it takes). */
-{
- char x;
- int pos = 0;
- int size = bufsize;
- int rv;
- char *newbuf;
-
- while (1) {
- rv = read(fd, &x, 1);
- if (rv == -1) {
- perror("read_line(): ");
- return IO_ERROR;
- } else if (rv == 0) {
- (*buf)[pos] = '\0';
- return EOF_REACHED;
- } else if (x == '\n') {
- (*buf)[pos] = '\0';
- return LINE_READ;
- } else {
- (*buf)[pos++] = x;
- if (pos == (size - 1)) {
- /* We've come to the end of the space */
- newbuf = (char *)xmalloc((size+bufsize) * sizeof(char));
- strncpy(newbuf, *buf, (size - 1));
- free(*buf);
- *buf = newbuf;
- size += bufsize;
- }
- }
- }
-}
-
-static int
-create_temp_file(char **name)
-/* Create a temporary file in /tmp and return a filedescriptor to it */
-{
- int rv;
-
- if (*name != (char *)NULL)
- free(*name);
-
- if ((*name = tempnam("/tmp", "abxdfes")) == (char *)NULL) {
- fprintf(stderr, "Couldn't make new temporary file\n");
- exit(1);
- }
-/* printf("Temp file created : %s\n", *name); */
- if ((rv = creat(*name, 0644)) == -1) {
- fprintf(stderr, "Couldn't open temporary file\n");
- exit(1);
- }
-
- return rv;
-}
-
-
-#ifdef BUBBLES_IO
-static void
-make_pixmap_from_file(char *fname, Bubble_Step *bl)
-/* Read the pixmap in file fname into structure bl which must already
- be allocated. */
-{
- int result;
- XGCValues gcv;
-
- if (bl == (Bubble_Step *)NULL) {
- fprintf(stderr, "NULL pointer passed to make_pixmap()\n");
- exit(1);
- }
-
- bl->xpmattrs.closeness = 40000;
- bl->xpmattrs.valuemask = XpmColormap | XpmCloseness;
- bl->xpmattrs.colormap = defcmap;
-
- result = XpmReadFileToPixmap(defdsp, defwin, fname, &bl->ball,
- &bl->shape_mask, &bl->xpmattrs);
-
- switch(result) {
- case XpmColorError:
- fprintf(stderr, "xpm: color substitution performed\n");
- /* fall through */
- case XpmSuccess:
- bl->radius = MAX(bl->xpmattrs.width, bl->xpmattrs.height) / 2;
- bl->area = calc_bubble_area(bl->radius);
- break;
- case XpmColorFailed:
- fprintf(stderr, "xpm: color allocation failed\n");
- exit(1);
- case XpmNoMemory:
- fprintf(stderr, "xpm: out of memory\n");
- exit(1);
- default:
- fprintf(stderr, "xpm: unknown error code %d\n", result);
- exit(1);
- }
-
- gcv.plane_mask = AllPlanes;
- gcv.foreground = default_fg_pixel;
- gcv.function = GXcopy;
- bl->draw_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv);
- XSetClipMask(defdsp, bl->draw_gc, bl->shape_mask);
-
- gcv.foreground = default_bg_pixel;
- gcv.function = GXcopy;
- bl->erase_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv);
- XSetClipMask(defdsp, bl->erase_gc, bl->shape_mask);
-}
-#endif /* BUBBLES_IO */
-
-static void
-read_file_to_pixmaps(char *fname)
-/* Read the pixmaps contained in the file fname into memory. THESE SHOULD
-BE UNCOMPRESSED AND READY TO GO! */
-{
- int fd, tmpfd=0, rv;
- int inxpm = 0;
- int xpmseen = 0;
- char *buf = (char *)NULL;
- char *tmpname = (char *)NULL;
- Bubble_Step *pixmap_list = (Bubble_Step *)NULL;
- Bubble_Step *newpix, *tmppix;
-
- /* We first create a linked list of pixmaps before allocating
- memory for the array */
-
- if ((fd = open(fname, O_RDONLY)) == -1) {
- fprintf(stderr, "Couldn't open %s\n", fname);
- exit(1);
- }
-
-#ifdef SIGNAL_NONSENSE
- /* Make sure pixmaps are freed when program is terminated */
- /* This is when I hit ^C */
- if (signal(SIGINT, SIG_IGN) != SIG_IGN)
- signal(SIGINT, onintr);
- /* xscreensaver sends SIGTERM */
- if (signal(SIGTERM, SIG_IGN) != SIG_IGN)
- signal(SIGTERM, onintr);
-#ifdef DEBUG
- if (signal(SIGSEGV, SIGN_IGN) != SIG_IGN)
- signal(SIGSEGV, onsegv);
-#endif /* DEBUG */
-#endif /* SIGNAL_NONSENSE */
-
- while (1) {
- if (inxpm == 2)
- break;
-
- buf = (char *)malloc(READ_LINE_BUF_SIZE * sizeof(char));
-
- switch ((rv = read_line(fd, &buf, READ_LINE_BUF_SIZE))) {
- case IO_ERROR:
- fprintf(stderr, "An I/O error occurred\n");
- exit(1);
- case EOF_REACHED:
- if (inxpm) {
- fprintf(stderr, "EOF occurred inside an XPM block\n");
- exit(1);
- } else
- inxpm = 2;
- break;
- case LINE_READ:
- if (inxpm) {
- if (strncmp("};", buf, 2) == 0) {
- inxpm = 0;
- write(tmpfd, buf, strlen(buf));
- write(tmpfd, "\n", 1);
- close(tmpfd);
- /* Now process the tmpfile */
- newpix = (Bubble_Step *)xmalloc(sizeof(Bubble_Step));
- make_pixmap_from_file(tmpname, newpix);
- /* Now add to list */
- if (pixmap_list == (Bubble_Step *)NULL) {
- pixmap_list = newpix;
- } else {
- tmppix = pixmap_list;
- while (tmppix->next != (Bubble_Step *)NULL)
- tmppix = tmppix->next;
- tmppix->next = newpix;
- }
- newpix->next = (Bubble_Step *)NULL;
- unlink(tmpname);
- } else {
- write(tmpfd, buf, strlen(buf));
- write(tmpfd, "\n", 1);
- }
- } else {
- if (strncmp("/* XPM */", buf, 9) == 0) {
- tmpfd = create_temp_file(&tmpname);
-/* This proves XPM's performance is kinda pathetic */
-#ifdef DEBUG
- printf("New XPM detected : %s, fd=%d\n", tmpname, tmpfd);
-#endif /* DEBUG */
- inxpm = 1;
- xpmseen = 1;
- }
- write(tmpfd, buf, strlen(buf));
- write(tmpfd, "\n", 1);
- }
- break;
- default:
- fprintf(stderr, "read_line returned unknown code %d\n", rv);
- exit(1);
- }
-
- free(buf);
- }
-
- close(fd);
- if (buf != (char *)NULL)
- free(buf);
- if (tmpname != (char *)NULL)
- free(tmpname);
-
- if (! xpmseen) {
- fprintf(stderr, "There was no XPM data in the file %s\n", fname);
- exit(1);
- }
-
- /* Finally construct step_pixmaps[] */
- make_pixmap_array(pixmap_list);
-}
-
-static void
-shell_exec(char *command)
-/* Forks a shell to execute "command" then waits for command to finish */
-{
- int pid, status, wval;
-
- switch(pid=fork()) {
- case 0:
- if (execlp(BOURNESH, BOURNESH, "-c", command, (char *)NULL) == -1) {
- fprintf(stderr, "Couldn't exec shell %s\n", BOURNESH);
- exit(1);
- }
- /* fall through if execlp() fails */
- case -1:
- /* Couldn't fork */
- perror(progname);
- exit(1);
- default:
- while ((wval = wait(&status)) != pid)
- if (wval == -1) {
- perror(progname);
- exit(1);
- }
- }
-}
-
-static void
-uncompress_file(char *current, char *namebuf)
-/* If the file current is compressed (i.e. its name ends in .gz or .Z,
-no check is made to see if it is actually a compressed file...) then a
-new temporary file is created for it and it is decompressed into there,
-returning the name of the file to namebuf, else current is returned in
-namebuf */
-{
- int fd;
- char *tname = (char *)NULL;
- char argbuf[COMMAND_BUF_SIZE];
-
- if (((strlen(current) >=4) &&
- (strncmp(¤t[strlen(current)-3], ".gz", 3) == 0)) ||
- ((strlen(current) >=3) &&
- (strncmp(¤t[strlen(current)-2], ".Z", 2) == 0))) {
- fd = create_temp_file(&tname);
- /* close immediately but don't unlink so we should have a zero length
- file in /tmp which we can append to */
- close(fd);
- if (sprintf(argbuf, "%s -dc %s > %s", GZIP, current, tname) >
- (COMMAND_BUF_SIZE-1)) {
- fprintf(stderr, "command buffer overflowed in uncompress_file()\n");
- exit(1);
- }
- shell_exec(argbuf);
- strcpy(namebuf, tname);
- } else {
- strcpy(namebuf, current);
- }
- return;
-}
-
-#endif /* BUBBLES_IO */
/*
* Main stuff
/* Get the appropriate X resources and warn about any inconsistencies. */
{
Bool nodelay;
-#ifdef BUBBLES_IO
-#ifdef HAVE_XPM
- char *dirname;
-#else
- char *foo, *bar;
-#endif /* HAVE_XPM */
-#endif /* BUBBLES_IO */
-
XWindowAttributes xgwa;
Colormap cmap;
XGetWindowAttributes (dpy, window, &xgwa);
simple = 1;
#else
broken = get_boolean_resource("broken", "Boolean");
-#ifdef BUBBLES_IO
- pixmap_file = get_string_resource("file", "File");
- dirname = get_string_resource("directory", "Directory");
-#ifdef NO_DEFAULT_BUBBLE
- /* Must specify -file or -directory if no default bubble compiled in */
- if (strcmp(pixmap_file, "(default)") != 0) {
- } else if (strcmp(dirname, "(default)") != 0) {
- if ((pixmap_file = get_random_name(dirname)) == (char *)NULL) {
- /* Die if we can't open directory - make it consistent with -file
- when it fails, rather than falling back to default. */
- exit(1);
- }
- } else {
- fprintf(stderr,
- "No default bubble compiled in - use -file or -directory\n");
- exit(1);
- }
-#else
- if (strcmp(pixmap_file, "(default)") != 0) {
- } else if (strcmp(dirname, "(default)") != 0) {
- if ((pixmap_file = get_random_name(dirname)) == (char *)NULL) {
- exit(1);
- }
- } else {
- /* Use default bubble */
- use_default_bubble = 1;
- }
-#endif /* NO_DEFAULT_BUBBLE */
-#else
- use_default_bubble = 1;
-#endif /* BUBBLES_IO */
#endif /* HAVE_XPM */
}
}
XGCValues gcv;
XWindowAttributes xgwa;
int i;
-#ifdef BUBBLES_IO
- char uncompressed[1024];
-#endif /* BUBBLES_IO */
defdsp = dpy;
defwin = window;
#else
/* Make sure all #ifdef sort of things have been taken care of in
get_resources(). */
- if (use_default_bubble) {
-#ifdef NO_DEFAULT_BUBBLE
- fprintf(stderr,
- "Bug: use_default_bubble and NO_DEFAULT_BUBBLE both defined\n");
- exit(1);
-#else
- default_to_pixmaps();
-#endif /* NO_DEFAULT_BUBBLE */
+ default_to_pixmaps();
- /* Set mesh length */
- mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3;
- } else {
-#ifdef BUBBLES_IO
- if (! regular_file(pixmap_file)) {
- /* perror() in regular_file printed error message */
- exit(1);
- }
- uncompress_file(pixmap_file, uncompressed);
- read_file_to_pixmaps(uncompressed);
- if (strcmp(pixmap_file, uncompressed))
- unlink(uncompressed);
-
- mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3;
-#else
- fprintf(stderr,
- "Bug: use_default_bubble is not defined yet I/O is not compiled in\n");
- exit(1);
-#endif /* BUBBLES_IO */
- }
+ /* Set mesh length */
+ mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3;
#endif /* HAVE_XPM */
/* Am I missing something in here??? */
+++ /dev/null
-#ifdef HAVE_CONFIG_H
-# include "config.h"
-#endif
-
-#include <stdio.h>
-#include "bubbles.h"
-
-#ifndef NO_DEFAULT_BUBBLE
-
-/* XPM */
-static char *glass1[] = {
-/* width height ncolors chars_per_pixel */
-"10 10 61 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #29293F",
-"`c c #2C2C63",
-"`d c #353579",
-"`e c #242447",
-"`f c #222245",
-"`g c #25253E",
-"`h c #1C1C3F",
-"`i c #2B2B47",
-"`j c #252544",
-"`k c #222251",
-"`l c #323264",
-"`m c #212146",
-"`n c #37374B",
-"`o c #22223D",
-"`p c #252536",
-"`q c #232337",
-"`r c #34346C",
-"`s c #303068",
-"`t c #26264A",
-"`u c #5D5D97",
-"`v c #363674",
-"`w c #2C2C6A",
-"`x c #2E2E5B",
-"`y c #242451",
-"`z c #343464",
-"a` c #3C3C6F",
-"aa c #353572",
-"ab c #38386B",
-"ac c #242454",
-"ad c #181831",
-"ae c #28285B",
-"af c #37377A",
-"ag c #20203F",
-"ah c #26265C",
-"ai c #4C4C60",
-"aj c #383874",
-"ak c #333379",
-"al c #444458",
-"am c #272756",
-"an c #32326E",
-"ao c #30306C",
-"ap c #40407F",
-"aq c #292944",
-"ar c #212150",
-"as c #323271",
-"at c #2D2D76",
-"au c #21213F",
-"av c #25255A",
-"aw c #35356D",
-"ax c #313169",
-"ay c #2C2C6E",
-"az c #18182C",
-"b` c #232344",
-"ba c #292961",
-"bb c #202037",
-"bc c #1C1C33",
-"bd c #242452",
-"be c #45456F",
-"bf c #242455",
-/* pixels */
-"``````aibebebeal````",
-"`````n`zaw`ua``l`n``",
-"```i`xab`wasaj`r`x`q",
-"``auaean`daf`vao`c`t",
-"```haxahayatakbaaeb`",
-"``adbfav`wapao`sam`m",
-"``azagaracaaae`k`fbc",
-"````bb`ybd`aar`e`o``",
-"```````paq`j`b`g````",
-"````````````````````"
-};
-/* XPM */
-static char *glass2[] = {
-/* width height ncolors chars_per_pixel */
-"12 12 75 2",
-/* colors */
-"`` c None",
-"`a c #25254C",
-"`b c #23234A",
-"`c c #212148",
-"`d c #2E2E62",
-"`e c #29293F",
-"`f c #272754",
-"`g c #414188",
-"`h c #20202C",
-"`i c #2E2E68",
-"`j c #242447",
-"`k c #25253E",
-"`l c #B9B9ED",
-"`m c #6767A3",
-"`n c #2B2B47",
-"`o c #29295C",
-"`p c #252544",
-"`q c #29295F",
-"`r c #1F1F3E",
-"`s c #2F2F68",
-"`t c #2D2D66",
-"`u c #30305F",
-"`v c #4C4C6D",
-"`w c #2B2B53",
-"`x c #2F2F6E",
-"`y c #34346C",
-"`z c #3B3B55",
-"a` c #303068",
-"aa c #2C2C64",
-"ab c #26264A",
-"ac c #5D5D97",
-"ad c #363674",
-"ae c #3C3C66",
-"af c #252556",
-"ag c #30306E",
-"ah c #3E3E54",
-"ai c #2C2C6A",
-"aj c #4C4C68",
-"ak c #20204A",
-"al c #2E2E5B",
-"am c #343464",
-"an c #16162C",
-"ao c #292938",
-"ap c #333384",
-"aq c #3C3C6F",
-"ar c #1E1E37",
-"as c #38386B",
-"at c #242454",
-"au c #31316E",
-"av c #181831",
-"aw c #232349",
-"ax c #272739",
-"ay c #23234C",
-"az c #37377A",
-"b` c #1E1E3D",
-"ba c #313174",
-"bb c #3C3C78",
-"bc c #383874",
-"bd c #1B1B33",
-"be c #40407F",
-"bf c #292944",
-"bg c #212150",
-"bh c #2D2D76",
-"bi c #191937",
-"bj c #313169",
-"bk c #22224D",
-"bl c #18182C",
-"bm c #2D2D65",
-"bn c #232344",
-"bo c #292961",
-"bp c #27275F",
-"bq c #242452",
-"br c #484868",
-"bs c #262657",
-"bt c #242455",
-/* pixels */
-"`````````vajajajbr``````",
-"````ahaeae`yacasaq`zah``",
-"`````w`f`dagacbb`y`u`u``",
-"```naybm`i`mbabcaaamawar",
-"``bf`ua`adbpaz`gai`ial`j",
-"``bnbgbjaz`xbhapboaa`uav",
-"``b`aybtbcaube`x`s`tbqbd",
-"``anbiakafbb`l`i`q`o`rbl",
-"`````rakbkaf`wbsay`c`k``",
-"````ao`pay`aatab`bar`h``",
-"````````ax`e`n`kax``````",
-"````````````````````````"
-};
-/* XPM */
-static char *glass3[] = {
-/* width height ncolors chars_per_pixel */
-"14 14 90 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #383858",
-"`c c #2E2E62",
-"`d c #292967",
-"`e c #3535A1",
-"`f c #272751",
-"`g c #23234D",
-"`h c #29293F",
-"`i c #353579",
-"`j c #272754",
-"`k c #20202C",
-"`l c #2E2E3D",
-"`m c #242447",
-"`n c #25253E",
-"`o c #3E3E67",
-"`p c #1C1C3F",
-"`q c #6767A3",
-"`r c #2B2B47",
-"`s c #29295C",
-"`t c #2B2B61",
-"`u c #29295F",
-"`v c #1F1F3E",
-"`w c #2F2F68",
-"`x c #2D2D66",
-"`y c #222251",
-"`z c #2D2D69",
-"a` c #33335B",
-"aa c #37374B",
-"ab c #22223D",
-"ac c #28285A",
-"ad c #2B2B53",
-"ae c #2C2C36",
-"af c #424266",
-"ag c #232337",
-"ah c #525265",
-"ai c #32326A",
-"aj c #1B1B2F",
-"ak c #303068",
-"al c #232351",
-"am c #363674",
-"an c #3C3C66",
-"ao c #252556",
-"ap c #27275B",
-"aq c #363663",
-"ar c #4C4C68",
-"as c #2E2E5B",
-"at c #29294C",
-"au c #27274A",
-"av c #252548",
-"aw c #16162C",
-"ax c #292938",
-"ay c #353572",
-"az c #38386B",
-"b` c #4C4C85",
-"ba c #2F2F83",
-"bb c #20203F",
-"bc c #313174",
-"bd c #333379",
-"be c #444458",
-"bf c #272756",
-"bg c #47477C",
-"bh c #32326E",
-"bi c #1B1B33",
-"bj c #30306C",
-"bk c #40407F",
-"bl c #23233E",
-"bm c #141422",
-"bn c #343473",
-"bo c #2D2D76",
-"bp c #2E2E6D",
-"bq c #40406E",
-"br c #21213F",
-"bs c #8080BA",
-"bt c #25255A",
-"bu c #1B1B39",
-"bv c #35356D",
-"bw c #262651",
-"bx c #18182C",
-"by c #373786",
-"bz c #2B2B63",
-"c` c #202037",
-"ca c #1C1C33",
-"cb c #242452",
-"cc c #484868",
-"cd c #1F1F43",
-"ce c #2C2C5D",
-"cf c #3535DD",
-"cg c #262657",
-"ch c #242455",
-/* pixels */
-"``````````arccaharcc````````",
-"``````bea``obqbqbqanafaa````",
-"`````ladaqbv`qbsbgai`ca``b``",
-"````a`a`asaib`bhb`bhakasau``",
-"``c``j`c`d`dbd`eb`am`wce`aca",
-"``bxasaobt`ibdbycf`iay`u`abx",
-"``bl`a`t`ubnbdbocfbcbt`cbwbu",
-"``bi`fch`sbhbkbabp`z`u`w`gaj",
-"``bm`a`a`u`xbjaibgbzcgbf`paw",
-"````agbralazap`t`ucbacbbaj``",
-"`````kbrcdcbcbcgbw`y`vab`k``",
-"``````axbrauatav`r`m`n`n````",
-"``````````ax`h`r`nae````````",
-"````````````````````````````"
-};
-/* XPM */
-static char *glass4[] = {
-/* width height ncolors chars_per_pixel */
-"20 20 151 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #29293F",
-"`j c #2C2C63",
-"`k c #2A2A61",
-"`l c #33334C",
-"`m c #353579",
-"`n c #272754",
-"`o c #20202C",
-"`p c #2E2E3D",
-"`q c #2E2E68",
-"`r c #242447",
-"`s c #2C2C66",
-"`t c #222245",
-"`u c #181824",
-"`v c #25253E",
-"`w c #B9B9ED",
-"`x c #1C1C3F",
-"`y c #6767A3",
-"`z c #2B2B47",
-"a` c #272743",
-"aa c #222248",
-"ab c #292931",
-"ac c #29295C",
-"ad c #1D1D39",
-"ae c #252544",
-"af c #2B2B61",
-"ag c #29295F",
-"ah c #1F1F3E",
-"ai c #2F2F68",
-"aj c #2D2D66",
-"ak c #30305F",
-"al c #2C2C5B",
-"am c #11111C",
-"an c #262655",
-"ao c #31316D",
-"ap c #4C4C6D",
-"aq c #222251",
-"ar c #323264",
-"as c #43436E",
-"at c #212146",
-"au c #37374B",
-"av c #22223D",
-"aw c #252536",
-"ax c #1D1D42",
-"ay c #2A2A5C",
-"az c #28285A",
-"b` c #2B2B53",
-"ba c #333372",
-"bb c #2F2F6E",
-"bc c #2B2B3F",
-"bd c #2C2C36",
-"be c #232337",
-"bf c #34346C",
-"bg c #525265",
-"bh c #32326A",
-"bi c #303068",
-"bj c #21214C",
-"bk c #2C2C64",
-"bl c #292957",
-"bm c #232351",
-"bn c #26264A",
-"bo c #2F2F60",
-"bp c #5D5D97",
-"bq c #363674",
-"br c #3C3C66",
-"bs c #252556",
-"bt c #30306E",
-"bu c #414178",
-"bv c #2C2C6A",
-"bw c #20204A",
-"bx c #2E2E5B",
-"by c #29294C",
-"bz c #242451",
-"c` c #27274A",
-"ca c #343464",
-"cb c #4F4F64",
-"cc c #252548",
-"cd c #292938",
-"ce c #333384",
-"cf c #3C3C6F",
-"cg c #353572",
-"ch c #1E1E37",
-"ci c #38386B",
-"cj c #414156",
-"ck c #242454",
-"cl c #181831",
-"cm c #232349",
-"cn c #272739",
-"co c #4C4C85",
-"cp c #2F2F83",
-"cq c #28285B",
-"cr c #36366C",
-"cs c #48486D",
-"ct c #23234C",
-"cu c #37377A",
-"cv c #20203F",
-"cw c #26265C",
-"cx c #313174",
-"cy c #4C4C60",
-"cz c #27273F",
-"d` c #3C3C78",
-"da c #48485C",
-"db c #383874",
-"dc c #333379",
-"dd c #444458",
-"de c #272756",
-"df c #32326E",
-"dg c #1B1B33",
-"dh c #1E1E2C",
-"di c #30306C",
-"dj c #40407F",
-"dk c #292944",
-"dl c #212150",
-"dm c #141422",
-"dn c #323271",
-"do c #2D2D76",
-"dp c #2E2E6D",
-"dq c #21213F",
-"dr c #8080BA",
-"ds c #23232D",
-"dt c #25255A",
-"du c #35356D",
-"dv c #191937",
-"dw c #262651",
-"dx c #313169",
-"dy c #2C2C6E",
-"dz c #22224D",
-"e` c #18182C",
-"ea c #373786",
-"eb c #232344",
-"ec c #2B2B63",
-"ed c #292961",
-"ee c #202037",
-"ef c #1C1C33",
-"eg c #242452",
-"eh c #45456F",
-"ei c #535380",
-"ej c #1F1F43",
-"ek c #2C2C5D",
-"el c #3535DD",
-"em c #262657",
-"en c #393963",
-"eo c #242455",
-/* pixels */
-"``````````````cycyapbgcbcybg````````````",
-"``````````dacycsehcsehapehcsddcj````````",
-"````````au`cenbraseicibucicibrendd``````",
-"``````auau`ccacidudrbpdrcfcrarakau`p````",
-"`````p`lbx`nbhbfdxcobpcodjdu`sakalb`bd``",
-"`````zbybxbocicgbvbbdn`ydbdfbfekbxbybe``",
-"``dh`r`rbl`faidydndn`hd`dnbtecafakdwah`o",
-"``dhdqejcqajdfcg`meacu`hbqdfdibi`jblbndh",
-"``ch`rbxemaidudnbq`geldcbqdbdn`jafbxbnav",
-"``dm`x`bdxdxcwbqdycpdocxdcbvedbkcqalebdg",
-"```uccctdzbsag`qbqdpeacxbtaidiagekdwcvdm",
-"``dmcl`xeoandtdfbv`wdjcediecbiaydectatch",
-"``amdvcm`xaf`kagaodi`qdbbaecanazejdvdv`u",
-"````e``xcvandlcqckdtcgagcq`qaqay`tbjef``",
-"````dsclaxbwdzdebsckb`acegbjeg`eaaadds``",
-"``````eeeeejbzanegdw`abmdl`b`rcnavaw````",
-"````````eeczbc`b`dby`dbya``eae`iaw``````",
-"``````````bdawa`dkc`aeae`i`i`vab````````",
-"``````````````bd`pcdcdbdcdbd````````````",
-"````````````````````````````````````````"
-};
-/* XPM */
-static char *glass5[] = {
-/* width height ncolors chars_per_pixel */
-"24 24 164 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #272754",
-"`p c #414188",
-"`q c #20202C",
-"`r c #2E2E3D",
-"`s c #1C1C28",
-"`t c #2E2E68",
-"`u c #242447",
-"`v c #2C2C66",
-"`w c #181824",
-"`x c #25253E",
-"`y c #161622",
-"`z c #B9B9ED",
-"a` c #3E3E67",
-"aa c #1C1C3F",
-"ab c #6767A3",
-"ac c #2B2B47",
-"ad c #222248",
-"ae c #292931",
-"af c #29295C",
-"ag c #252544",
-"ah c #1E1E47",
-"ai c #2B2B61",
-"aj c #29295F",
-"ak c #1F1F3E",
-"al c #2F2F68",
-"am c #2D2D66",
-"an c #30305F",
-"ao c #2C2C5B",
-"ap c #11111C",
-"aq c #262655",
-"ar c #31316D",
-"as c #4C4C6D",
-"at c #323264",
-"au c #2D2D69",
-"av c #33335B",
-"aw c #212146",
-"ax c #37374B",
-"ay c #22223D",
-"az c #252536",
-"b` c #1D1D42",
-"ba c #28285A",
-"bb c #2B2B53",
-"bc c #333372",
-"bd c #2F2F6E",
-"be c #2C2C36",
-"bf c #424266",
-"bg c #232337",
-"bh c #2F2FB0",
-"bi c #34346C",
-"bj c #525265",
-"bk c #32326A",
-"bl c #1B1B2F",
-"bm c #3B3B55",
-"bn c #303068",
-"bo c #21214C",
-"bp c #2C2C64",
-"bq c #292957",
-"br c #26264A",
-"bs c #202044",
-"bt c #5D5D97",
-"bu c #2B2B5C",
-"bv c #363674",
-"bw c #3C3C66",
-"bx c #252556",
-"by c #30306E",
-"bz c #3E3E54",
-"c` c #2C2C6A",
-"ca c #25252E",
-"cb c #27275B",
-"cc c #363663",
-"cd c #4C4C68",
-"ce c #20204A",
-"cf c #2E2E5B",
-"cg c #29294C",
-"ch c #242451",
-"ci c #27274A",
-"cj c #343464",
-"ck c #252548",
-"cl c #16162C",
-"cm c #292938",
-"cn c #333384",
-"co c #3C3C6F",
-"cp c #353572",
-"cq c #1E1E37",
-"cr c #38386B",
-"cs c #414156",
-"ct c #242454",
-"cu c #31316E",
-"cv c #181831",
-"cw c #232349",
-"cx c #272739",
-"cy c #4C4C85",
-"cz c #2F2F83",
-"d` c #28285B",
-"da c #292952",
-"db c #48486D",
-"dc c #23234C",
-"dd c #37377A",
-"de c #1E1E3D",
-"df c #26265C",
-"dg c #313174",
-"dh c #4C4C60",
-"di c #27273F",
-"dj c #3C3C78",
-"dk c #48485C",
-"dl c white",
-"dm c #383874",
-"dn c #333379",
-"do c #444458",
-"dp c #272756",
-"dq c #1B1B33",
-"dr c #1E1E2C",
-"ds c #30306C",
-"dt c #40407F",
-"du c #292944",
-"dv c #212150",
-"dw c #23233E",
-"dx c #343473",
-"dy c #323271",
-"dz c #2D2D76",
-"e` c #2E2E6D",
-"ea c #40406E",
-"eb c #21213F",
-"ec c #8080BA",
-"ed c #23232D",
-"ee c #25255A",
-"ef c #35356D",
-"eg c #191937",
-"eh c #262651",
-"ei c #313169",
-"ej c #2C2C6E",
-"ek c #22224D",
-"el c #18182C",
-"em c #373786",
-"en c #2D2D65",
-"eo c #232344",
-"ep c #2B2B63",
-"eq c #292961",
-"er c #27275F",
-"es c #1C1C33",
-"et c #242452",
-"eu c #45456F",
-"ev c #484868",
-"ew c #1F1F43",
-"ex c #2C2C5D",
-"ey c #3535DD",
-"ez c #262657",
-"f` c #393963",
-"fa c #242455",
-/* pixels */
-"``````````````````dkdhbjbjbjbjdh````````````````",
-"``````````````csasascdevcdascddbevdh````````````",
-"``````````dodobfa`dbeubfeueueacrbfbfcsax````````",
-"````````bzcsbwf`bwcrbicobteccratcof`bmbzbz``````",
-"```````n`navavanefcjbibt`zcrcobicratccf``nax````",
-"``````acbbao`oat`fambycobtdldjbkbialan`can`n````",
-"````dicg`icj`fbi`fefdyauarabbybiefbnaicfbbcg`x``",
-"````ac`udcbqenbk`tdyabczdgdxdmdtbpcpcjeicwcgcq``",
-"```wdq`acfaiefcpe`bydn`hcyeydmc`ambcef`fcf`u`y`s",
-"```ydudaandfbnaubvdgerbhdd`h`pdyc`cu`tezcf`b`ubl",
-"``elad`abqezbndmdsbccncnczeydnbvdmdxamep`fcgcv`w",
-"```weoetdv`leidfdd`gbddzdzdncncneqeebpexan`ucvap",
-"``elcwdaexehd`epaubd`hdz`hcz`gdycucueeba`oekcl`w",
-"``eldebsdcbxfaeedmejcuemdtcnbdbyalafambuet`bdq`w",
-"```yclakboce`fbx`mcper`veccyauei`mbncbaqdpdaesap",
-"````clakegbsceetbxdsdjdt`zbt`tctajdvafahakayel``",
-"````eldqdeebetboenepetezbnbxencb`lbaeteoaabldr``",
-"``````blakb`ceetekambxctbbafezctdcbo`eew`xcq````",
-"``````ed`qakbsawekchchchetd``jboceaddwcxesed````",
-"````````cmazag`xdcek`bchctetbrci`deocqbg`q``````",
-"```````````qbgayckaybr`uacek`beo`x`xazca````````",
-"``````````````aecxdi`kagacag`xcxcxcm````````````",
-"``````````````````ca`rcmbebebeae````````````````",
-"````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass6[] = {
-/* width height ncolors chars_per_pixel */
-"30 30 181 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #3535A1",
-"`h c #23234D",
-"`i c #29293F",
-"`j c #2C2C63",
-"`k c #2A2A61",
-"`l c #33334C",
-"`m c #353579",
-"`n c #272754",
-"`o c #20202C",
-"`p c #2E2E3D",
-"`q c #1C1C28",
-"`r c #2E2E68",
-"`s c #242447",
-"`t c #2C2C66",
-"`u c #222245",
-"`v c #181824",
-"`w c #25253E",
-"`x c #161622",
-"`y c #B9B9ED",
-"`z c #3E3E67",
-"a` c #1C1C3F",
-"aa c #6767A3",
-"ab c #2B2B47",
-"ac c #272743",
-"ad c #292931",
-"ae c #29295C",
-"af c #1D1D39",
-"ag c #252544",
-"ah c #1E1E47",
-"ai c #2B2B61",
-"aj c #29295F",
-"ak c #1F1F3E",
-"al c #2F2F68",
-"am c #2D2D66",
-"an c #30305F",
-"ao c #2C2C5B",
-"ap c #11111C",
-"aq c #262655",
-"ar c #31316D",
-"as c #4C4C6D",
-"at c #222251",
-"au c #323264",
-"av c #2D2D69",
-"aw c #33335B",
-"ax c #43436E",
-"ay c #2B2B67",
-"az c #212146",
-"b` c #37374B",
-"ba c #22223D",
-"bb c #252536",
-"bc c #1D1D42",
-"bd c #28285A",
-"be c #2B2B53",
-"bf c #333372",
-"bg c #2F2F6E",
-"bh c #2C2C36",
-"bi c #424266",
-"bj c #232337",
-"bk c #2F2FB0",
-"bl c #34346C",
-"bm c #525265",
-"bn c #32326A",
-"bo c #1B1B2F",
-"bp c #3B3B55",
-"bq c #303068",
-"br c #21214C",
-"bs c #2C2C64",
-"bt c #292957",
-"bu c #232351",
-"bv c #26264A",
-"bw c #2F2F60",
-"bx c #202044",
-"by c #5D5D97",
-"bz c #2B2B5C",
-"c` c #363674",
-"ca c #3C3C66",
-"cb c #252556",
-"cc c #30306E",
-"cd c #3E3E54",
-"ce c #414178",
-"cf c #2C2C6A",
-"cg c #2F2F4F",
-"ch c #25252E",
-"ci c #27275B",
-"cj c #363663",
-"ck c #4C4C68",
-"cl c #20204A",
-"cm c #2E2E5B",
-"cn c #29294C",
-"co c #242451",
-"cp c #27274A",
-"cq c #343464",
-"cr c #4F4F64",
-"cs c #252548",
-"ct c #16162C",
-"cu c #292938",
-"cv c #333384",
-"cw c #3C3C6F",
-"cx c #353572",
-"cy c #1E1E37",
-"cz c #38386B",
-"d` c #414156",
-"da c #242454",
-"db c #31316E",
-"dc c #181831",
-"dd c #232349",
-"de c #272739",
-"df c #393979",
-"dg c #4C4C85",
-"dh c #2F2F83",
-"di c #28285B",
-"dj c #292952",
-"dk c #36366C",
-"dl c #48486D",
-"dm c #23234C",
-"dn c #37377A",
-"do c #20203F",
-"dp c #1E1E3D",
-"dq c #26265C",
-"dr c #313174",
-"ds c #4C4C60",
-"dt c #27273F",
-"du c #3C3C78",
-"dv c #48485C",
-"dw c white",
-"dx c #383874",
-"dy c #333379",
-"dz c #444458",
-"e` c #272756",
-"ea c #47477C",
-"eb c #32326E",
-"ec c #1E1E2C",
-"ed c #30306C",
-"ee c #40407F",
-"ef c #292944",
-"eg c #212150",
-"eh c #23233E",
-"ei c #141422",
-"ej c #343473",
-"ek c #323271",
-"el c #2D2D76",
-"em c #2E2E6D",
-"en c #40406E",
-"eo c #21213F",
-"ep c #272731",
-"eq c #8080BA",
-"er c #23232D",
-"es c #25255A",
-"et c #1B1B39",
-"eu c #35356D",
-"ev c #191937",
-"ew c #262651",
-"ex c #313169",
-"ey c #2C2C6E",
-"ez c #22224D",
-"f` c #18182C",
-"fa c #373786",
-"fb c #2D2D65",
-"fc c #232344",
-"fd c #2B2B63",
-"fe c #292961",
-"ff c #27275F",
-"fg c #202037",
-"fh c #1C1C33",
-"fi c #242452",
-"fj c #45456F",
-"fk c #484868",
-"fl c #535380",
-"fm c #1F1F43",
-"fn c #2C2C5D",
-"fo c #353573",
-"fp c #262657",
-"fq c #393963",
-"fr c #242455",
-/* pixels */
-"````````````````````````bmbmbmbmbmbmbm``````````````````````",
-"``````````````````dscrasasascrckasasasfkckbm````````````````",
-"````````````````dsdsdzbifjfjfjfjaxaxfjfjckdzdv``````````````",
-"````````````d`dvfqdzenfkfjencaendlaxaxcabibi`zdvb```````````",
-"``````````cd`zaw`cfqcacaceflczbydg`zencjcwca`cbpbpcd````````",
-"````````d`cdb``cawcqczdkeubycwbyczdwcwczcqaucaawb`b`b```````",
-"````````b``lcmcqaoczaublbndgeqdfeqczdgbn`jcmanfnawcg`l``````",
-"``````cu`w`wcmcmcqblardxeu`yceareqdueualbleuexdjcmbeba`p````",
-"````chabcg`acmbwbqczaiebcfdfdgekeqdudxebcxblbncmcm`ababjer``",
-"`````o`aeodmaobdalbn`rcfdf`mdhdrdyeaejdubscxffbwbwdd`b`w`q``",
-"````fhbadjcmbq`jcxcxekemeydr`gdy`geeekek`t`rexe`e``ndjdcdc``",
-"```q`veocnbtdialbleb`rfo`medfadnelbkc`bffeedeufn`jcmfmbvfg`x",
-"``ecbo`sbze`feaeayexavbgej`gbkdyeydhdudnemdbfdal`kfna``udc`v",
-"```xeieodjbtfpexfbc`avekbg`gbkelfa`g`gdxcxcfdxamfpbtcpfcdoap",
-"```vcya`btegex`kbldqdncfeycvdyelcv`gdycvfefeebaedianfmfcdc`q",
-"``fhcyetahfncobdbs`tbncfdybgcf`gdhcfavavav`tfraifnbtbteteoei",
-"```xdpaz`bbtcl`fesfbedfdekelbkdhaaavbgcf`jfe`fesbwez`bbxdcei",
-"```xfhdcbx`hfratbresfdedcfee`meedffded`t`tbqdiaee``nazazdcap",
-"`````vdp`sew`bbqaifpfpdbbsccdxdfekbyee`j`jdialbzfidmazafct``",
-"`````vbodpevbcaqbdatcb`tfdamar`ydg`taicbaje`dadaahaketevbo``",
-"`````qf`bjakdobdezegfbaidacibncxdgbddiajalatfibz`ubccyfh`q``",
-"``````chbjbcbcfmbdaediatcbfpfpajfpdaesfpbudmco`h`eewfhf`````",
-"`````````ocydp`waz`e`baqfiesfpdjfpfiaidacpewah`wafdpbb``````",
-"````````chfgfgfmddcofibdfi`bfi`ada`hegbu`h`seodtbafhec``````",
-"``````````cuepdo`wefdmfidd`b`hdae``bbvcn`dagakbabj`o````````",
-"````````````erbbdeefcsefcpabezcp`habef`sbx`wehbber``````````",
-"````````````````chbbba`ief`iacagabef`i`wba`wcu``````````````",
-"``````````````````chbb`p`p`w`w`pcu`p`icucuch````````````````",
-"````````````````````````adadcudeepadbh``````````````````````",
-"````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass7[] = {
-/* width height ncolors chars_per_pixel */
-"36 36 187 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #48486D",
-"dr c #23234C",
-"ds c #37377A",
-"dt c #1E1E3D",
-"du c #26265C",
-"dv c #313174",
-"dw c #4C4C60",
-"dx c #27273F",
-"dy c #3C3C78",
-"dz c #48485C",
-"e` c white",
-"ea c #383874",
-"eb c #333379",
-"ec c #444458",
-"ed c #272756",
-"ee c #47477C",
-"ef c #32326E",
-"eg c #1B1B33",
-"eh c #1E1E2C",
-"ei c #30306C",
-"ej c #40407F",
-"ek c #292944",
-"el c #212150",
-"em c #23233E",
-"en c #141422",
-"eo c #343473",
-"ep c #323271",
-"eq c #2D2D76",
-"er c #2E2E6D",
-"es c #40406E",
-"et c #21213F",
-"eu c #272731",
-"ev c #8080BA",
-"ew c #23232D",
-"ex c #25255A",
-"ey c #1B1B39",
-"ez c #35356D",
-"f` c #191937",
-"fa c #262651",
-"fb c #313169",
-"fc c #2C2C6E",
-"fd c #22224D",
-"fe c #18182C",
-"ff c #373786",
-"fg c #2D2D65",
-"fh c #232344",
-"fi c #2B2B63",
-"fj c #292961",
-"fk c #27275F",
-"fl c #202037",
-"fm c #1C1C33",
-"fn c #242452",
-"fo c #45456F",
-"fp c #484868",
-"fq c #535380",
-"fr c #1F1F43",
-"fs c #2C2C5D",
-"ft c #3535DD",
-"fu c #353573",
-"fv c #262657",
-"fw c #393963",
-"fx c #242455",
-/* pixels */
-"````````````````````````````````bsbsbsdwbs``````````````````````````````",
-"````````````````````````dwbsdwcqcxbscqdwcqcxdzcxbs``````````````````````",
-"````````````````````fpcxawcqawcqawawcqawfocqcqawfpcqcx``````````````````",
-"``````````````````ececfpfpbofodqdqdqesbababadqfobafpeccj````````````````",
-"``````````````dfeccjabcgesbobaabadcgabbaeefobaesbob`cgdfcjcj````````````",
-"````````````cjdfbvcgfwfwcgcgesbrevdbcdeeesdedbfwdbcgcpbvbvdfcj``````````",
-"``````````bdbvbvcg`ccpcwdecwayckcdeecddydcbrezdecpayfwb`ar`ncjbd````````",
-"```````````saecmcscpcscwbwaqayeaevfqdyckbtdefbcpeicscbcscpb`cmae````````",
-"`````````scvbjcmar`pcsfb`fbt`fcidmdecdcdefdyezaqbraz`farasasarek`s``````",
-"``````bnaecmdjayb`fscsbwaqfbbwdyaacddheacdfudbfbbrbtfbaqbzcsdpafcmcn````",
-"```````s`zbj`basfs`fbr`f`wdcepeqcfcdfue`dmdvcdbkbkbrfb`fbwbjcaaect`z````",
-"`````taeaoccdrcsfdfgbwbr`ubb`oadebdndvebe`eadsejbyavfgcwbtcsdjbjaeddbf``",
-"````eudidjbzdp`pbzbwbbefeperfjdabldadada`qcfdveofi`wfb`fay`ped`aeteg`k``",
-"`````yflfadpcsfs`lbrdcav`wcfeoepdsda`qbqebdydsepfiaveabwbz`maybc`abufe``",
-"````fmek`aararaiambwbyefcfcfbqfkeqejds`gft`qeofuclfkbw`ubibtcs`bcv`vfe``",
-"```ydi`v`xdpbzamaxaqfkavererbkfffcfc`hdaeqdscffudcclbkfgapanayaodpczeg`t",
-"``atbpao`adpbzdo`mfgbtepereperfcbqft`g`hffbqbkdlfucleiaqfbdg`bctfrfmfea`",
-"```yetfh`xdpelfbfsfbaz`mdsci`gblffdneqftebda`hdafjfjfgbybwdgardr`xdia`at",
-"``ateheycccredfsaxfgcibbeffjejdafc`g`heqblfjepclazazap`wfscbbz`jacfrflat",
-"``atczey`v`afsacfsdgco`lbb`gebffereqft`qffdaer`wfgfifififjbzcu`i`adda`at",
-"````a`dtcy`xdrcrexfxfvfgeabkbbdhffadejdndnblclepapdubhaqfvcefn`xdtegfe``",
-"````a`dieybxfnbx`jfsfxfkfgfgdheoev`qdncdfcdlfjfi`wfiapcuchaubzaceydiat``",
-"````atdifr`abz`bbzbranaifneifufidyckejepckffepfibyaianancu`bbgbgagegen``",
-"````atczegeyf`bgascrcrelchanefdyfieaaa`qaq`uexduanbhfxaicecraoemajfea```",
-"```````tfebedtccaled`dcoaqdoamdeaiandydyaifi`mfbaqfdfnbh`pagfrddfmfe````",
-"```````t`reydidjagbzaxchanfnaianchch`lbhcoaichauc`chdoelbgbgbcegfm`r````",
-"`````````reyaoacetcrfn`afd`ffvchc`fvbjaianfvco`bdrdgbz`e`vbe`zeyeg``````",
-"```````````regacem`vccfnbxc`cu`jbifnfvcoc`bi`ich`adjac`xflajemew````````",
-"``````````ewbpbpdtaobcbc`jchbic``ac``afafafnfd`jfncybcdxdkbedd`r````````",
-"````````````d`ddbeakfh`kdrfd`b`b`jcudged`bcacvct`dcyccddewd``r``````````",
-"``````````````eubndddxdxakaecvcaae`ecaagaecvafcabcfhbp`keucn````````````",
-"``````````````````d`flem`z`s`v`kbc`bekaeagaeetafekd`bmbf````````````````",
-"`````````````````````s`zdk`zae`kdxakaeekek`zekbfdkd`bn``````````````````",
-"````````````````````````bnbmd`dkdk`sbndxd`bmbfbnah``````````````````````",
-"````````````````````````````````cnbneu`sah``````````````````````````````",
-"````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass8[] = {
-/* width height ncolors chars_per_pixel */
-"44 44 189 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #36366C",
-"dr c #48486D",
-"ds c #23234C",
-"dt c #37377A",
-"du c #20203F",
-"dv c #1E1E3D",
-"dw c #26265C",
-"dx c #313174",
-"dy c #4C4C60",
-"dz c #27273F",
-"e` c #3C3C78",
-"ea c #48485C",
-"eb c white",
-"ec c #383874",
-"ed c #333379",
-"ee c #444458",
-"ef c #272756",
-"eg c #47477C",
-"eh c #32326E",
-"ei c #1B1B33",
-"ej c #1E1E2C",
-"ek c #30306C",
-"el c #40407F",
-"em c #292944",
-"en c #212150",
-"eo c #23233E",
-"ep c #141422",
-"eq c #343473",
-"er c #323271",
-"es c #2D2D76",
-"et c #2E2E6D",
-"eu c #40406E",
-"ev c #21213F",
-"ew c #272731",
-"ex c #8080BA",
-"ey c #23232D",
-"ez c #25255A",
-"f` c #1B1B39",
-"fa c #35356D",
-"fb c #191937",
-"fc c #262651",
-"fd c #313169",
-"fe c #2C2C6E",
-"ff c #22224D",
-"fg c #18182C",
-"fh c #373786",
-"fi c #2D2D65",
-"fj c #232344",
-"fk c #2B2B63",
-"fl c #292961",
-"fm c #27275F",
-"fn c #202037",
-"fo c #1C1C33",
-"fp c #242452",
-"fq c #45456F",
-"fr c #484868",
-"fs c #535380",
-"ft c #1F1F43",
-"fu c #2C2C5D",
-"fv c #3535DD",
-"fw c #353573",
-"fx c #262657",
-"fy c #393963",
-"fz c #242455",
-/* pixels */
-"````````````````````````````````````````````bs``````````````````````````````````````````",
-"````````````````````````````````dybseabsawbsbscxawcxbsdybs``````````````````````````````",
-"````````````````````````````eedycqcqcqdrcxawcqawawawawfrfrcxcq``````````````````````````",
-"````````````````````````eadyfrdybafrfqawawfqdrawawfrfrdrawcqeaeeee``````````````````````",
-"````````````````````eeeebofrboawbofqdrbadrfqeufqfqbababafqfrbobobocjee``````````````````",
-"``````````````````dfeebvfybvcgbaboeueueueuababfqdefqegeuabeufybocgdfeacj````````````````",
-"````````````````bvbo`nfydffybocgcgdedbegfsfqeuegexeudbdqdedbdeabfybvcjdfcj``````````````",
-"``````````````bdcjbvfyfyb`defyfydedbckexexebckdmaqdbdbdbayaydeaycpbvab`ccjbd````````````",
-"`````````````s`ccjb`b`b`b`ardededeaydcexadckaddbdbaadqdqbrbtbrayb`cpb``c`ccm`n``````````",
-"```````````n`n`ncmcsb`cpascpegfi`ucwbrcdcdebehaddbbrdmfaayaqcbb`arcscs`ccmb`ae`s````````",
-"``````````aeafcmaeasfu`paraycbbtfd`lavecckegcdcdaaec`qfa`ufa`f`ubwarbzb`cscs`kbm````````",
-"````````ewaectfjbzcsb`arcwbtdcapec`fdcaadmcd`ueqaddmekecav`fapbtecbwdparbjcmaoct`n``````",
-"````````bddzcmbjdparcscb`fdbfdfidcdlcieqbbdlciebexeletegbwbk`ubtbwfufucsdpcm`zctbm``````",
-"```````ycmdjdpctauaramefcsbwapehekereddleledcfdmdmdmerelecaqaqbrehcbbzarfc`vbjcyem`r````",
-"``````bpaobefjccbzasenbw`ufafdblcl`oeldldnbqededdtcdbkdldlet`lekamcbbw`fbjauctdp`zfn````",
-"`````yfoaj`bbzeodsfibhbrekavcfcletfldneddxeddadtdadmbkerercleh`ubwbwcbbzarbhdpfjdiei`t``",
-"````atfoemfcdpbzasfi`ffadcekbkazeqerbkerdadtdmfhbqdldleddxfkfdapdcfdfcam`pbz`e`ifoepa```",
-"````a`dd`v`bbzbjefdw`lbwbtehdceccf`hfeerbqfhedesbqfvdlcifwcifldhbrficbficsefcc`v`xajbp``",
-"````fnfgeo`vfubzbwdwco`ufm`m`ucfbler`ofh`hfveddndnbqdldldtcffmbkbwapbwaiefaybgctczfgei``",
-"`````yczacaodpbjayfxcobwapbkehdhblerdtdnfe`hbqfhbqfedtcfeqecaqeqbwfiapanbhbr`zdjbcaofo``",
-"````atczf``bbzbzbhax`laqbwaqdhciblfeclfhfhdafmbqdabqdacidldtdhflcf`wby`fauef`vccakev`y``",
-"``ata`fnagccbzenbhfiaifdehezdhdlet`geteddnbqesfvedbqesdndabbfmfmbtbyamfufuasbcccdidiepat",
-"````fgfgao`dbg`e`falcobwfkfmdh`o`gcidnesdn`gdabqed`geteretblekazfk`u`fdocb`j`abgf`ev`y``",
-"`````yeicv`v`b`pamfcbhfxfidwetazazdx`q`heted`qfveder`get`wciekehchcodgbhffefeffcczbu`y``",
-"````epdvfjfj`acubzenanbifxbyaqci`w`gereleddnesehdnazdxbkcl`wfmfm`f`lfmayenau`bfceidia```",
-"`````ybuev`xcc`j`pfzaxau`jezekcferblcifhfhdmdmdldtfmblekdhekaq`fbififzbzftbidudvdifgbu``",
-"````atfgfoaobgal`pc`auamaxcoekapdcfwaqe`edeldnele`ekelfm`manapaqficubi`pdjfcacf`bgdvep``",
-"`````ya`f`ag`bdpasbcfubraibifmfmdhcfanekdcdmdtdhflexblcifkbyfiaifian`pau`pagbgbceicza```",
-"``````epdif`dubcefbgauenaxfmco`f`mecekfied`uavexfkbbaqfmdwanapcubifxffbgacftbef`di`y````",
-"``````a`czbuf`ddddbcfffcfcdgdoancofdezbwecfkap`wehaifmbtfiandwaxenbibzagf`ccbpaj`t`y````",
-"`````````yfoeyaceoevenfpffbx`mam`mbifpdwchapehaicocoamaibibtezfxdgfxeffjccfpeiddfg``````",
-"````````ej`rdidvaobzalbzfp`mauchfpfkezfkau`f`fdechchchfzbic`axbxfpauff`ebg`pejej`t``````",
-"```````````tf`f`ajal`zcrfpendsffaycochfzdgfzbjcoancofpdo`ben`affce`edjbcbebef`di````````",
-"```````````t`rf`dvaoeobcdu`ece`bfpencucofxbic`auc`dgficuef`bbxffbg`ebedddvaobfew````````",
-"````````````cnejbpaodvftdj`jcr`pcoen`j`jcu`ifcbifx`jc``jen`bbx`vccbe`z`zddddcn``````````",
-"``````````````ewbpddfbddaccycr`dfp`jfpca`jcu`dc`cacv`dff`d`d`x`dft`z`zbeejcn````````````",
-"````````````````fgfneoduembmfj`vag`act`bds`ac``j`j`acv`bbcagak`xdudvbpcn`t``````````````",
-"``````````````````ewd`fnaeakemcyaecvdjaeaecrcvdsakaeakafcy`jao`zfnd`cn`t````````````````",
-"````````````````````d`dkfndzd``zbm`v`k`b`ecvemaeca`vaedudz`zafew`kbfey``````````````````",
-"````````````````````````bfdkd`dz`kafdzae`vemcyafakakaedzdzbed`dkcn``````````````````````",
-"````````````````````````````ahdkbnbnbm`z`sdk`s`zd`bm`safd`bn`s``````````````````````````",
-"````````````````````````````````bnbn`sd`d`dk`sbmbnah`s`sah``````````````````````````````",
-"````````````````````````````````````````````cn``````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass9[] = {
-/* width height ncolors chars_per_pixel */
-"50 50 188 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #292957",
-"bz c #232351",
-"c` c #26264A",
-"ca c #2F2F60",
-"cb c #202044",
-"cc c #5D5D97",
-"cd c #2B2B5C",
-"ce c #363674",
-"cf c #3C3C66",
-"cg c #252556",
-"ch c #30306E",
-"ci c #3E3E54",
-"cj c #414178",
-"ck c #2C2C6A",
-"cl c #2F2F4F",
-"cm c #25252E",
-"cn c #27275B",
-"co c #363663",
-"cp c #4C4C68",
-"cq c #20204A",
-"cr c #2E2E5B",
-"cs c #29294C",
-"ct c #242451",
-"cu c #27274A",
-"cv c #343464",
-"cw c #4F4F64",
-"cx c #252548",
-"cy c #16162C",
-"cz c #292938",
-"d` c #333384",
-"da c #3C3C6F",
-"db c #353572",
-"dc c #1E1E37",
-"dd c #38386B",
-"de c #414156",
-"df c #242454",
-"dg c #31316E",
-"dh c #181831",
-"di c #232349",
-"dj c #272739",
-"dk c #393979",
-"dl c #4C4C85",
-"dm c #2F2F83",
-"dn c #28285B",
-"do c #292952",
-"dp c #36366C",
-"dq c #48486D",
-"dr c #23234C",
-"ds c #37377A",
-"dt c #20203F",
-"du c #1E1E3D",
-"dv c #26265C",
-"dw c #313174",
-"dx c #4C4C60",
-"dy c #27273F",
-"dz c #3C3C78",
-"e` c #48485C",
-"ea c white",
-"eb c #383874",
-"ec c #333379",
-"ed c #444458",
-"ee c #272756",
-"ef c #47477C",
-"eg c #32326E",
-"eh c #1B1B33",
-"ei c #1E1E2C",
-"ej c #30306C",
-"ek c #40407F",
-"el c #292944",
-"em c #212150",
-"en c #23233E",
-"eo c #141422",
-"ep c #343473",
-"eq c #323271",
-"er c #2D2D76",
-"es c #2E2E6D",
-"et c #40406E",
-"eu c #21213F",
-"ev c #272731",
-"ew c #8080BA",
-"ex c #23232D",
-"ey c #25255A",
-"ez c #1B1B39",
-"f` c #35356D",
-"fa c #191937",
-"fb c #262651",
-"fc c #313169",
-"fd c #2C2C6E",
-"fe c #22224D",
-"ff c #18182C",
-"fg c #373786",
-"fh c #2D2D65",
-"fi c #232344",
-"fj c #2B2B63",
-"fk c #292961",
-"fl c #27275F",
-"fm c #202037",
-"fn c #1C1C33",
-"fo c #242452",
-"fp c #45456F",
-"fq c #484868",
-"fr c #535380",
-"fs c #1F1F43",
-"ft c #2C2C5D",
-"fu c #3535DD",
-"fv c #353573",
-"fw c #262657",
-"fx c #393963",
-"fy c #242455",
-/* pixels */
-"````````````````````````````````````````````````````````````````````````````````````````````````````",
-"``````````````````````````````````````e`bscwbscwbsbsbsbsbsbsbscw````````````````````````````````````",
-"````````````````````````````````bse`bscpbse`awawcwbsbsdqawawbsdxdxcwcw``````````````````````````````",
-"````````````````````````````e`eddxfqcwcpfqfqawawdqawdqawawfqcwawawfqfqe`cw``````````````````````````",
-"````````````````````````cie`e`dxfqboboawfpfpdqfpbafpawfpdqbofpabdqfqfqedcfdee```````````````````````",
-"``````````````````````edede`cifqbodqabfpfpbabobaccbabafpbaddbaetfpfqabbobobodee`````````````````````",
-"````````````````````deedbvbvfxfxcfetboetfpcfewetddetetdaefetbaetabetbofxabcfedcici``````````````````",
-"``````````````````bdedbd`cabdefxababfxddetddcccjefbacjeaetddddcfdpdaddababb``cdeedde````````````````",
-"````````````````bvbdbvfx`cb`fxcfcffxdddaddefccaaeaefewbwdldadaddcoayddcvcfb``cbvbdbvci``````````````",
-"```````````````s`cbvbdb`b`b`cocvdddaddayf`braadlfrccdldzewdddaebddfcbwayfxcfb``cbd`cbd`s````````````",
-"````````````bd`sclclbjb`crb`arcofr`ubtbtfcdkaaewewdlcjdabtdabtcvddebayaycadoarb``c`n`ncl`s``````````",
-"``````````bdbv`c`ccub`b`b`ascrdp`fcadzaqbwfjebcjeaccewaaccdlfrdlegbw`f`lcab`crcrcrclclelbpbd````````",
-"``````````bnbmcuclclcrb``pararcv`ff`fcegf`dzewcjcjeqdleabkavf`fc`mbrcaegfcaycabjararcrae`sbm````````",
-"````````evaedycragcacvb`apcrasbwf``faybtavekewaddleqdkccccdkbrdzfcavapbrfhf`biascac`bjcuel`kbf``````",
-"````````aeae`vcldo`acrcacr`fbtddaqapebceckbleqdzdseqaaadekdwebdkavceapbrbt`fftamcrbybjaeclbpbp``````",
-"```````rfnbeakdocubzarfw`faiarbraqegejbkcheqeqekd``oefekewdzchekbkaqfhbtbkapcrcacr`j`vdocbbpfn`t````",
-"``````cz`zdoakbccbbyasdr`fap`uf`fcejck`obkdl`odmfudwecdwaadzbkdzdbaz`legaqftar`fcadofbdobjafdccm````",
-"``````bfehdc`aeefifbftaiambw`gavbkblck`gckd`eqecec`hfgd`addsepbkfvfkapazavf`fw`fbycrcd`a`vehbubp````",
-"`````tbuehdyfbasdocaapayayebebbteq`geqchfvdwecbqdkaddsfudwdzbkckdwfjbrapf`bwf`byfwbyasdr`iezbucy`t``",
-"`````yfnfieu`bdi`abydn`mfcf`f`egdbavdbec`odwcefgecdsd`dmbqepceeqf`az`wejdbbrambi`lcdft`bcbc``va`ei``",
-"````a`eoenfifsaycrbyfl`mfc`uan`webceebdmer`gdwbqdsdsdmdmbqekdkeccechckfkejegfhbiftarby`a`v`vfiffbu``",
-"````fmcycxdidt`iardpdnemanavflejazeqesepcefgblerfud`fgfderfgdkdsdkdzfkeqbkapapbt`lctfceuas`vcydhfn``",
-"````ehdheudtagbybjcabidnapapfcebejblchcheqer`hbqbqerbqfufgecdsebcedkbkbleqf`fjambicaaycu`vcxa`du`y``",
-"````fnfndhdtbgdobybifocnbwameqckdgeqeqfdesfdfgfgdwflfddmfufudwch`odschflejebdvayby`pee`vcbacfndcbu``",
-"````bube`vacfe`iembyfc`f`ufc`wdveqdkeqflfddwfudm`her`hd`fgbqecd`ecbbflfkfjapdvbwdnftas`jfifieh`yeo``",
-"````ffehdhdhdrcqalft`jembtai`wfkdg`obbesbldmfddm`gecfud`dmbbdw`ochbl`ufkap`weganaiar`j`j`ddu`adhff``",
-"````ffdcdrdtbj`a`pfhfebibh`legfkesapaqeq`obqbqfddkfu`hd`dwfkchdw`wcheq`ufjemfyaucdby`peectduezdhbu``",
-"`````tfadhag`v`iee`fcqfweefleyanaqfjazazebfg`g`qfu`hadcher`q`h`gazdwaibbap`lfw`waybxct`aagcbeueofn``",
-"````eoa`ffcbfididr`eaxeybzbhcgaqepdlbkckazeqds`qfueqfdblefeqdzchdg`wfheyamey`laibyalbiagdraodheheo``",
-"````at`ydhdh`dfsal`pfyalfyemeyey`waqdgazckepbkdw`qekepecfjdmejflazfj`ubw`lbiftaxee`beecbcbbcdu`ta```",
-"````a`a`a`ficbalcqeeauct`fcgdffyflejapds`wefdleradewegaaegeseqbr`lfl`u`megamamctfb`vfebc`deudceoat``",
-"``````eofffacb`abyftcbbybtfcanfwaidvapepap`wegazdzdlek`uerfgepdgfj`laqdncn`mbyfoct`p`vbgacezdhbu````",
-"```````yffdhfsficbeealbybxbiemcncnamflch`u`uccew`udgdlf``wdldbcgflanbweefycnaxeeacezfsdyfmdh`y`t````",
-"```````teoeiezajdcdc`ealeeai`jaxaiamcgavaiew`ucc`w`mandzanebflfcamfldvbiemdffw`pfeezcbdcbpeh`yeo````",
-"`````````tfffffmaoakdtalamfbdremfjamaiaidffraiddegdbfhancnbrdn`mamegfwaxfocgftct`x`efeezeifn`t``````",
-"````````ex`tehbeezdubydialcdaxcnbidndfbhfwbweydf`mandfcgdvananfyfofycncgcnaxfoacbg`e`pfadueiex``````",
-"```````````rbufndcajacfscbbycqfofodnaifhfyai`paxcnfweyddcg`pcgfwfofedifeaxbyalfs`j`kduehfmfm````````",
-"```````````yeifndhbefsao`vaxbxbxcsfebyfwbzfybidfcgbjfwaidnambibybzbx`afocdbc`vfidtezajbueha`````````",
-"`````````````y`r`rezduaocxficb`jfw`abz`jct`jdnfwbzfwdnaufofofw`afo`i`ddiducb`zdudcezdu`rex``````````",
-"``````````````evbudjfmajcbagbcctbcfwcgaufoct`afofb`afodf`jbzemfobx`dfe`val`xczdjbebpdccm````````````",
-"````````````````evcmezfneufsaoelcqcxctfeaufecsfectbxbzfeae`b`jdrc``b`x`ecb`zbpfmfmeiev``````````````",
-"``````````````````ffbubpfiafafbmbc`vag`bc`csdr`j`bct`jfefbcxcx`j`xdificxacbeenbfev`t````````````````",
-"````````````````````cmczczdy`zak`kcucucudrcuaecxc`cxdrcxaeelak`vc``jajakbpafbfbf`r``````````````````",
-"``````````````````````cmczbpdjdc`kcxelaoelakagbc`aaeel`bbxakakeu`zdtbm`zdjbpevbf````````````````````",
-"````````````````````````cmbfeibfbmeuel`kelelafelelakaeelaf`k`k`zdjbebm`zbncmah``````````````````````",
-"````````````````````````````czbnczbp`zafbmaedyafelbmdy`zdybeczdjczbf`kbpex``````````````````````````",
-"`````````````````````````````````sevdjbncz`zdj`sczcz`k`k`s`sdjbfahevbn``````````````````````````````",
-"``````````````````````````````````````evah`sbncz`kev`sbnczbnczah````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass10[] = {
-/* width height ncolors chars_per_pixel */
-"60 60 189 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #36366C",
-"dr c #48486D",
-"ds c #23234C",
-"dt c #37377A",
-"du c #20203F",
-"dv c #1E1E3D",
-"dw c #26265C",
-"dx c #313174",
-"dy c #4C4C60",
-"dz c #27273F",
-"e` c #3C3C78",
-"ea c #48485C",
-"eb c white",
-"ec c #383874",
-"ed c #333379",
-"ee c #444458",
-"ef c #272756",
-"eg c #47477C",
-"eh c #32326E",
-"ei c #1B1B33",
-"ej c #1E1E2C",
-"ek c #30306C",
-"el c #40407F",
-"em c #292944",
-"en c #212150",
-"eo c #23233E",
-"ep c #141422",
-"eq c #343473",
-"er c #323271",
-"es c #2D2D76",
-"et c #2E2E6D",
-"eu c #40406E",
-"ev c #21213F",
-"ew c #272731",
-"ex c #8080BA",
-"ey c #23232D",
-"ez c #25255A",
-"f` c #1B1B39",
-"fa c #35356D",
-"fb c #191937",
-"fc c #262651",
-"fd c #313169",
-"fe c #2C2C6E",
-"ff c #22224D",
-"fg c #18182C",
-"fh c #373786",
-"fi c #2D2D65",
-"fj c #232344",
-"fk c #2B2B63",
-"fl c #292961",
-"fm c #27275F",
-"fn c #202037",
-"fo c #1C1C33",
-"fp c #242452",
-"fq c #45456F",
-"fr c #484868",
-"fs c #535380",
-"ft c #1F1F43",
-"fu c #2C2C5D",
-"fv c #3535DD",
-"fw c #353573",
-"fx c #262657",
-"fy c #393963",
-"fz c #242455",
-/* pixels */
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````bsbsbsbsbsbsbsbsbsbsbscxbs``````````````````````````````````````````````",
-"``````````````````````````````````````````dycxdydycxawawawbsbsbsawcxcxcqdycxcxbs````````````````````````````````````````",
-"````````````````````````````````````dyeacxfrawcqawfrawcqcxawcqawawawawawawfrfrcxcqeabs``````````````````````````````````",
-"````````````````````````````````dfeadydyawcqawawfrcqawawdrawcqawawfqawcqcqfrawawfrdyeaeadf``````````````````````````````",
-"``````````````````````````````eadyeadyfreedrboawfqfqfqdrfqeufqawbaawbabofqeufqdrcqfreeboeadf````````````````````````````",
-"``````````````````````````dydffrbocjfrfrdrfrfrfqfqbabofrfqfsbaeubafqfqcgeubafqdrbaabbobobocjeedf````````````````````````",
-"````````````````````````dfeeeadffyboeecgeufrfreufqeueueucgbaeubadrdbbacdbaeucgbabocpboboabboeaeebd``````````````````````",
-"``````````````````````bdbdcjbd`cfyeefybaabcgfyeubaabdmfseudbdefsaackdbeudebaeudedebocgbofyfycjcjeecj````````````````````",
-"````````````````````cjdfabbvb`cg`cfyfyfycgabcgdeckbrfscddecdcddmdmfsabdeeucwcpdbdbcgcgcp`cbvbvcjbvbdcj``````````````````",
-"``````````````````bdbddfbv`ccgfyb`cgcgcpfycwdedbdbcdadcdexexckcd`u`uegdedbdbaycpaydecpcpb`bvfybvbdcj`s`s````````````````",
-"````````````````dfbdcjbvbd`c`c`cb`cpcwcgdededqayfabrcdexdbcdcdcddeexebbrdbecdedqcwfdaycpcgarb`b`bd`cbd`sbd``````````````",
-"```````````````sbdbd`n`ncmcscsarcscwcpdbbtbwbwbtbrfaebexegexaddbdeeceldqbrbrdqbtbkaybt`fbjcscpb`b``ncmctbdbd````````````",
-"``````````````aebd`c`ncmcsb`cwayascsdebraybwbrfdbtazdmdeexaddladexckdedmdme`btay`lcbcscwarasfucpb`cmcmae`nbd````````````",
-"`````````````saeeo`nbjcmcsarar`paycsbtcb`fbrbtfkfdciecdmdqebcdaacddmece`elbrazfabr`f`wbwbtarbzcsascsarbjbm`kbn``````````",
-"``````````ewd`ae`z`c`zbjcsb`cscscwcwbrbravbtecbrfackaadmckexavciexdme`bkfabtapanbr`ffabtfdbtdpcscsbjbjdpbeae`s`s````````",
-"``````````ahcm`kcm`bdparaycsay`fcscsfdbrfibwbtbrfdeqcd`qdmelbkeldmexdmeqdce`faerdcapbtbwfa`waucscscvdpdpafcmae`n````````",
-"````````cncmaeakcmct`adpcsarcbcbbwdqdeapamdcehcfclbldlbldmeqeradexade`esecelehehdc`ubrbrbtfucsbhcsas`actbecmbpbpey``````",
-"````````ejbpeo`vctcv`abzb`ef`ffxfucbbwapbldcdheqetesdlfwdmescfcddmdmdmbkbleldldhaq`ubrfabtcbcsbtcs`pcccycm`veobe`t``````",
-"`````````rae`aajevdjdsasas`jbifiapbrbtav`uapclcfdlad`odndnfvdxededexegeceqe`e`cfbybydcbrfmcwcbfdcbbjdjca`bcv`zdd`t``````",
-"``````ej`rbu`vcvcv`vcyfcbzefbz`f`uclapfderfeerclerdldlerdada`hedfhe`aacferdtcfciazapfk`ubramcbfuararbzfc`zaeaofo`t`r````",
-"``````bpfodibedsdp`jcs`abwbh`lfadccidcecerclet`gfe`hdxdx`hededdt`hdaelcfereterer`wbk`ubtfdbtef`fefcb`paudpbcdiczdi`y````",
-"``````ejddddemfcbjefcscs`faycedcececapciazcieqbldterdxdnbqelcdfhfv`h`oe`ererdnetfkfdekfabwbtfubifxfcar`affdpf``yepfo````",
-"`````tej`ycyevcuctftbzefdoaiapaqbrbrehfw`udcfwda`oerekfhfhdxdtdaes`hbqfwcferbkehflfkekcffabwfuco`lbzcsbzftbccaevfneja```",
-"````atddddem`xaocscsar`pdwdwfibwapbyapeccfdlcf`hdnfmbl`hfhdtdt`hclfvbq`qfhdxbkcfcl`gfkehfa`ufufpamaycsaydjcc`v`vfoepat``",
-"````ejfgbucy`vccceaseffdfldgai`ubbfzfdazazcfblereqdt`hdnbq`hedbqfedndndte`dtdtdletfmdhehfkapapbt`mdgfubzacdp`xf`dicz`y``",
-"````budddi`x`vevdpcsbzcwfxai`mapfdflfaavblercibkcffhcl`gfvfvfvdadaedclcfcfdteqecdcfkercfav`lbt`famchfdcsbe`bcaczfjbefg``",
-"````a`buepccevcrdpbzbzcbfxbifdfififacfekazereretblfe`hfhbqesesdnfh`h`hbq`hfwecdldcerclavecaqaqfifxbhbzbzcv`xfjfodufnat``",
-"````atepbufodualfcdp`lauauchfi`lapek`gcicieretfecl`gfhed`hesfm`gfefvfvfvdxbl`oederetfm`wdlfkfxaybzau`d`j`xduf`fgdufga```",
-"`````yepddfjacccbz`benamfd`f`mfdbr`mdwcidtcfclfmfebldadneddnesdadadx`hdaededdaclflfmflfmehbyaiaydofuarasftccfjdidiei`t``",
-"````a``yczczfbbcbc`bacficucraqfdanfkflaz`oehbbesbldndxfefefeesfvbqbqdnbbdtedciciazaqfkazaz`ubw`laicbas`pdjcccc`advddat``",
-"````fo`yddccf`fcalcefucbcufpbi`fbyav`wazbt`ucldxed`hblescldn`hbqdndncl`gazedazazazfw`wekfzanameffucbbzbxbz`jf`fbevbuep``",
-"````at`yfbaccy`a`bdsceaiffbzbichfi`manekaq`uclbkcffheletfvesfh`hesdx`qclci`gfkapap`wekapezanfzaifubxeffcfc`bdubufgepat``",
-"````a`czdvf`bcdv`bffbzbicrax`fbiezcofifiekbkfk`geredeserbqdndndtadfhazcfblfecl`u`laiflaq`f`lez`ucbdgff`j`bdpccdddiepep``",
-"````atczdidvaocy`v`edsbcaxdwbxfzefchameqecdlbl`gazdh`qfhaaadelesfhdaflblbkblerazapfidwbhchaqdobibzalfp`pccbgdveiczepat``",
-"````a`epfoczdi`dccac`jaufzcraxaubxdwez`wfkehekbbclbkelaa`obqeleddldafkdmekfm`wfk`wfibwfidobhaiaxef`j`pdsbcacbcaodiddat``",
-"``````eifgczevccfbau`jefdgffbhamaxfxezfd`w`l`odl`udcbk`wdneldtegadaaazetdlfmanan`waqfkehfifpbic``p`dbzagftao`vdifbfg````",
-"``````a``yfgdv`b`v`ifcbz`b`ibwbtamfxfxfmfxekdhcfby`lciehec`wdlaverapcdecelaz`lby`lfidofiap`mcefxfp`idsagbcagajeicza`````",
-"``````ata`czfbdv`vdjceasac`ibiamfian`maifxanazehave`apekehap`uege`ecazcfbkekdwfkfifiauchefbiencuftbcdvfbfof`fbdi`y`y````",
-"`````````yczbudvdvdvfbcubgfcaucrbicraxfzchco`wekfke`aqflav`uaa`udm`u`w`uamfzchfmanameffpdgaidgfpaldvaoevf``zfbfgbu``````",
-"````````a``tejeif`ajddajdsccbz`pbi`jfpdoanfzanbtai`f`ufkfkdq`lanebexaidcfme`fafiancodgenenbiai`pcracccf`bpddbufg`t``````",
-"`````````t`yfgfgbpacaoakdubgbiauffdsenanfidoamaidgcdcoezbtecdc`mdmanbifidoanan`uapfzaxfpfpbhcecr`xbcbgbxddbufoej`t``````",
-"```````````t`yfoddaodidv`i`xaleffpc`chfxamchezaichezfmfzanbwanfpcb`famfkanfxfzezcoanbifxc`ffefacbgccacf`ddddej`t````````",
-"```````````tcnfobpdvbgdvbgbxftefbibxaiaudofzaxfichanfxfpfxezananfxchdgefezfzfxcuc`crdsfpcubz`jft`eeofcfbfoejfg`r````````",
-"````````````eyfgbudiaoajbgdvbecrfpfpff`bffefbwaichchdgdgbhdgbjbidoaicofxfpaicubxds`afpdgas`e`vduag`z`zajdibuey``````````",
-"```````````````t`rbuddeodvft`zalbccr`ec``bc`auenfp`jezchfxaidpc`fxdgfpfiamfcdgfxcvcrfcfpalcr`zbeajf`dvajbfey````````````",
-"```````````````rbfbpfofbbgdvaffjfjcc`jfxbxfcc``b`bdsbiau`jc`biaibifxfpfcch`afpc``d`d`vdvfjfj`zdvajfbdvbp`tcn````````````",
-"````````````````cnfnfnbpfnaoftftdj`ecuftfpaubidgfp`j`bfcfpfc`afpdgc``jfpencuc``b`j`e`vcrevdkdzewbefnfobfej``````````````",
-"``````````````````bffnfnajfodvddccftaf`e`b`jdgcuai`jcv`jc`fcdj`jbxcvcvdsdsbxbxdjcr`xbxdjft`z`zddbefnbf`r````````````````",
-"````````````````````d`eyewbeduak`zfjemcads`dfp`jdj`b`bcu`jcudgfpefds`bcacacvctct`dagak`xaoddbeeybpfn`r``````````````````",
-"``````````````````````eyfnbpdkdz`z`zbmakfj`bag`v`dctctctctem`d`ecvctaeaeafcu`v`ecc`zakafbp`kbpewbfew````````````````````",
-"````````````````````````eyeybfbpdk`zemcvcyafemakcvcvaeaeffdjcvcv`j`vae`vemaf`vagcc`z`z`zeodkbfd`ey``````````````````````",
-"``````````````````````````cnbnfobe`kbe`kevemdzfj`k`z`b`edjctaeaeemds`eaf`vevdzdjafemd`dk`zbfd`ey````````````````````````",
-"``````````````````````````````bncneybf`kbeaf`kememem`kcvafemakaeaeakemem`kdk`z`kbebm`zd`d`ah````````````````````````````",
-"````````````````````````````````ahcnewd`dk`z`zaeaf`kaf`k`vemaedzcvakak`z`kdzd`dkdkbmbfbnah``````````````````````````````",
-"````````````````````````````````````cncnbf`z`sd``s`k`z`s`zbm`s`kd`d``s`s`k`kd`ahd`bncn``````````````````````````````````",
-"``````````````````````````````````````````bnd``s`s`kbnd`d`bfd``kbnbnd`bnd`ewahbn````````````````````````````````````````",
-"````````````````````````````````````````````````ahbnahbnd`ewdkbfewahahewbn``````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass11[] = {
-/* width height ncolors chars_per_pixel */
-"72 72 189 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #36366C",
-"dr c #48486D",
-"ds c #23234C",
-"dt c #37377A",
-"du c #20203F",
-"dv c #1E1E3D",
-"dw c #26265C",
-"dx c #313174",
-"dy c #4C4C60",
-"dz c #27273F",
-"e` c #3C3C78",
-"ea c #48485C",
-"eb c white",
-"ec c #383874",
-"ed c #333379",
-"ee c #444458",
-"ef c #272756",
-"eg c #47477C",
-"eh c #32326E",
-"ei c #1B1B33",
-"ej c #1E1E2C",
-"ek c #30306C",
-"el c #40407F",
-"em c #292944",
-"en c #212150",
-"eo c #23233E",
-"ep c #141422",
-"eq c #343473",
-"er c #323271",
-"es c #2D2D76",
-"et c #2E2E6D",
-"eu c #40406E",
-"ev c #21213F",
-"ew c #272731",
-"ex c #8080BA",
-"ey c #23232D",
-"ez c #25255A",
-"f` c #1B1B39",
-"fa c #35356D",
-"fb c #191937",
-"fc c #262651",
-"fd c #313169",
-"fe c #2C2C6E",
-"ff c #22224D",
-"fg c #18182C",
-"fh c #373786",
-"fi c #2D2D65",
-"fj c #232344",
-"fk c #2B2B63",
-"fl c #292961",
-"fm c #27275F",
-"fn c #202037",
-"fo c #1C1C33",
-"fp c #242452",
-"fq c #45456F",
-"fr c #484868",
-"fs c #535380",
-"ft c #1F1F43",
-"fu c #2C2C5D",
-"fv c #3535DD",
-"fw c #353573",
-"fx c #262657",
-"fy c #393963",
-"fz c #242455",
-/* pixels */
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"``````````````````````````````````````````````````````````````bsbsbsbsbsbsdydybsbsea````````````````````````````````````````````````````````````",
-"``````````````````````````````````````````````````````eabsbsdybsbsbsbsbsbscqcxbsbsbsbsbscxdy````````````````````````````````````````````````````",
-"````````````````````````````````````````````````dydybsbsdycqcqdycxbsbsfrcqcxdyfrcqcxcxbseacxcxbsbs``````````````````````````````````````````````",
-"````````````````````````````````````````````eaeaeafrcqawawawdrdrawcxawawcqcqawawawawawbscqfrfrdycxcxea``````````````````````````````````````````",
-"````````````````````````````````````````frdfcxcqawcqcqawawfrcqdrawfrawawcqawawawfqawcqawcqdrawdrfrdycqdycx``````````````````````````````````````",
-"````````````````````````````````````eeeaeaeadycqdffrboboawfqfqfqdrdrfqbabadrdrdrdrbobodrdrbaawdrdyfreaeaboeeee``````````````````````````````````",
-"``````````````````````````````````eeeefreeeefrbofrfrbofrfqeudrbadrfqdrfqeubabababababafqdreufqfrbafrfreeeeeacjdf````````````````````````````````",
-"``````````````````````````````eecjboeebocjboboababboabdrfsfqfqbabobobafqfqawdrfqawbaeueudrdebafrbocgbobobobodfdfcjbd````````````````````````````",
-"````````````````````````````dfeeeedfcjbvab`ccgfyeuabboabbabaabdbadeucgdeabbabadbegfqfqfqbaeueueubobob`bocgcgdfeacjcjcj``````````````````````````",
-"``````````````````````````cjbddfcjbv`ccgdffycgfqbofyfyabdbeuabfqexbaeueudefqexadckdbbadedebaabdedeeufyboabcpfycjdfdfeecj````````````````````````",
-"````````````````````````cjcjdfdfbvb`cg`cfyfyfyfycgabcgdeeudbbregexdbdbadcddmegexeucgdedbdbayfydbdbabcgfycpb`bv`cbvcjdfbdcj``````````````````````",
-"``````````````````````bdbdcjbvbvfy`c`cb`cpcgfyfyfycpdededbdeegexdmaaebexckaadm`ucddbdedbdbcwcpcpfddedeb`fyb`bvfycjcmbdcj`s`s````````````````````",
-"````````````````````bd`nbvbvbv`ccg`c`ccscpcwcwcgdebrcwbraydqckdbcdegegcdcdade`btdcadbrdqfabrdebrcpbwaycpfyfyb``car`n`nbdcjbnbd``````````````````",
-"```````````````````n`s`n`ncj`nb`b`b`b`b`b`arcpdqfabrbrcwaybtbrexadcddbadaae`dedeexaddbdqdebrdedbdededeayb`b`cpb`b`fy`n`c`ncmbdbd````````````````",
-"```````````````````n`sbdaecmcmcscscscpcscscpcwfsbwfiaqfdaybtecadexaafsexe`exckdbbtecdedqfdaycpbrekcbcsaycb`icsaycpb`b``ncm`naebd````````````````",
-"`````````````````scj`c`ccmctbjcsb`cparasascsdqayaybwecbwbrbrbbe`dee`ebadegcdexadegdbcdade`ecbrbwfk`ffuarcwarcscscscpcscmcmct`nd`bd``````````````",
-"```````````````s`saecv`nbjaecmasarar`parcsayfdcb`fbrbtaq`fbtciecdmdbdeebcdebcdebehece`egfabtaqecbrcbazap`fayarcsas`casbjarcmem`n`sbn````````````",
-"``````````````ew`s`zcv`nevcmbjcscsbzcscwaydedqbwavfafdfadcdcckadebcke`aaehdhadebe`dcehdcbtbran`fbr`fbrfibtayaybzbjarcsb`bjbjafbm`sae````````````",
-"````````````bnaeae`kcmagdjfuaycsb``ffucscsbtbwdcaqfifdfabwave`exaaadcdcddh`oecadcddmfwapdbe`fdaqbrapbtbtfdecaqbhbzarcs`adpcmaf`zcmcncn``````````",
-"````````````dz`n`kctcmct`idparcwaybw`farfubrdqbr`ffdfafaecekerdcfeazeleqavdmexaddmelcibkegbrbtbkfa`uehbwfifiambzfxcscs`abjbjakctcmcm`z``````````",
-"``````````ey`saf`zafbjcv`befascsfuar`ffdbrde`faq`wdcdcbkerclesdlcfdmcdblfwcdebaddmdldxercdecbkavbkapbrbtfdbt`fcbbwcbbjbzcactaebectfn`zey````````",
-"``````````a`bf`zcacvdpcv`icucscsbi`fefbhar`fbr`uekbrekcierdxdxdlcieleqes`odmelelexdmcfere`eldcetaqfibwfadcapcbcscsbtcsfcccakdp`vcv`zfncn````````",
-"`````````tbpaecvao`vcccydsbzcsbzffaifiekbwbtbrap`uekbber`odladdteddndnbqdxeqedeqebeleceqdtelelerbyfkavdcfiancwarbtfdcsbjdjfcbjctaebpddbpbf``````",
-"````````bf`rfodpevcv`vfjcybz`idpefbhayapetblapfdciblcleqeteqeldldxdxdadadaesdadtadcdcfereqdldcekapap`wflbwayamcbbhcbasasdp`pbjakcvfjfo`y`y``````",
-"````````ewdddidvdj`abzagdpcu`p`lbzambwfdbbclehdcerfeetetflfedaedbldxdadndaeddada`qdmcfeqdxdheqblfkap`waqfddq`fdgaycs`pcsefef`afjeveieifo`k``````",
-"```````ybfevei`zft`afubzcsas`fam`fbwfaecdcdcdccfetbbblcieretedesed`h`heldm`qdafvdndleceqercledetaqbrapbkfaayfabwbz`fbiascs`p`j`vftf`a`epbu`t````",
-"```````y`ybufnaefc`bdpcucs`pfubw`lbwbrdqdcehavfw`wcfcfereqfwercidt`hdae``qdtbqbqeddle`cfdtdxercifk`uavavecbwbw`fbz`m`mefay`jbc`d`aaobua`fg`t````",
-"``````epbuddcvfjefca`bdsbzbzbhezbyaqaqbrdqehecdcfddccfeqdaedblazdtfhfhdxdtdnfednfvfvcfdtererdcehfl`wfkbkfafaap`fcefifiasasfudjbc`bcadudda``t````",
-"``````a`foeoemak`adparcsarefaidwamapbwapbyazeheccfeccfdxbqesfmblesbqeldtdtbq`g`hfvbq`q`qeqerfweqclbbfmdhbwfa`ufubifxbtarcscb`b`bcv`v`vfgfgbu````",
-"````atejfgfgcy`v`bbcfuasef`ffiezchco`uazezezap`uekdlererereqeddadnfvfved`ofvesesbqfvdle`dleddtdlclfmfkerbr`mapfibtbi`lbzfufuccfccvccdvfg`yfoat``",
-"`````yfodiaj`v`v`x`bdpcsbzdeamamaxfkaqehfm`wav`ueteretbkbkcffhdxfednfefv`hbqdadxesfedtfwcfdtfwe`dcflcldlbkfdfibtap`fanfpayasao`idpagczfneifg`t``",
-"````atfgfofgagccao`abjasbzcbfufxbibtbwfdapecdlavekerblbkeqeqdaesfedafvdndn`hfvfv`hdxeddtdtcffwdlecdhcleqehbkaqaqfkfkco`f`fayafctdjcadiajdv`yfo``",
-"````atejbpczaocc`aaldpbzbzfudoen`mbtfiambtbtereretererbletetfeesbq`hfv`g`gdn`hdafhdabqfvbkbkdldlfwerclfkekecaqaqfdfidgef`b`pctccftakfoajfgbua```",
-"````ata`befofoft`daldp`p`laubzambi`lby`lehfm`gavciererclfe`g`gfhdtdxed`g`gesfmdnfvfvdndnetdxedblblazfmfmapec`mfzcbarc`bzbxfcaoccftf`fgbcepfgbu``",
-"`````y`yevbefjdv`xfpdp`jenbifd`lfufkfdbtazdw`merdtdtci`g`gfebledfhesdnfeesdafvededfvdaed`hdadaclflfmflezfibtbycobwfudgfuarfuds`v`xaodidia`atat``",
-"````atfgaobudif`acfp`ebxacfu`fc`fxfdfdan`mdw`gaz`ocfekcletesdndxfecletesdn`h`hfvfhedclfheqfherek`gbyazfm`uaz`ubtamanfucbceaufcccccducaevfoatat``",
-"````atfoejfof`fbcc`jcrbheffufualaxamfiancifkbbciehekflcleleqdadxfedn`gbq`hfvesdnblfmflbberedcletazeqazehapfm`w`lfubzcbcsbzcr`jdpacf`ftdvfn`yat``",
-"````atfgbufodjfjdudp`afpfu`l`jfcbiefdoapavfkfketazbyazbldxdt`hes`hesdxdx`h`hesdndaet`gazeler`wazdhdhcidhanbxezfzchbibh`p`pfceffffcf`czfodd`yat``",
-"````atatczdif``b`v`v`afffu`facfcfubidgfmcoez`lapbbap`gbbedecfhedetdaesesfv`h`qcifhfhdadletfl`wekfianfkcifk`lfkchfl`lbzcrcufc`ift`aaodddda`buat``",
-"````at`tdif`dvagcycc`iff`pefcraxfz`fbianezfkap`uehfw`ufl`gcieqcderfh`hdnedeqdcfedmazdldxdl`gazaq`lfmfmdwfi`l`lan`wfdfucrc`fp`b`d`daoddbufnatat``",
-"``````fga`f`dvdvcycc`xffdsdscrchezcrfzeffxezfieqecdlbkfebbcidh`qfhfhad`qelfedndadnfkblcfclcierazapaqdwaibhchaqanfxcecealfpef`x`bdvf`eiczfg`y````",
-"``````at`yeiczeiajftftac`j`pfpaxalaxefbxfzch`maqfkbkerazclblbkdmdtdaaaedexfvaddafe`udmblflfkazbbazaqfiaqanbiamanaxfpbzds`pfcbcccdvftaoei`yep````",
-"``````a`a`didif`f`acbxalfp`pbxax`jcefufzfzfmfmbbfifkfibkdhaveqelexfv`qcddndmcdadfeekdl`hflanfkfm`wfdfkapapbhcuefchcuau`bbz`jacccf``vdidvat`y````",
-"``````a`epfoczdv`baoacefbxbzcscr`pfi`fcochchezez`mavekdcecfmfmdmfa`wdlapexcdcddmaabbazes`wfd`lan`maqaibwehapcofiauauau`befalbcdp`ddvfodieiat````",
-"````````ata`difbftao`a`bbzfu`bagbzfdbrfiandoaiaifp`wekeqfw`wfkeke`apckaqelecerfkckcdfherer`ufk`wbyaqaidoanamanbzcufx`b`pbgbcbgccagdieiczep``````",
-"````````at`yfgf`difbctagbzascrbcefaubififx`lananezdo`mcidhapav`uelcddcecape`dcflfaekbkeqekdwcofkfiapaidgefchbic`ffalftaldvf`bpf`fbdidia`a```````",
-"````````at`yczddeiaof`dvfb`jbgccasc`crbhcrfpenchchcoanekeh`we``wfkelececaaek`qcdaqfk`ufiezdgdwfman`lbhenfzfzaifpcealcraoaodueobeajdifg`ya```````",
-"``````````a`bueibueiajajddddbcbgalbzfcbh`j`pfpdoaichchavapdodmbtbyad`mfkbydweccfckaielfmbybt`l`mcodwanaxaxenbifxbzdsbxf`ftacfndkajfofgfg````````",
-"``````````a``teifgbubeftdvafccbgalamef`j`dbxcofkaqcodo`famdgdeanaidqanape``me`fiaianfk`m`mbwfdapaqfzffenfpc`bhfu`pftagagft`jddddfofofga`````````",
-"````````````fg`tbueibpf`dvevfbevbgfpfpcrenbxaxamfiananfkbiaxfpezezfxfkecbwbifzch`mezfiamdocochfi`lcobibibzfpfpbzcufjevccac`efgbubu`tej``````````",
-"`````````````tbu`rejf`aodidvdjfcagacbzbhaxdochfxanfzfpbiaichanbychchchbt`lfzbhezcofxaiaichchaufzc`fxch`jdoffenefbgalbgbcbccceiddfo`y`r``````````",
-"```````````````rejeifodvdvajacbcccccdgbibxfpdgaufuezfz`manfzanfxaufp`fcodocoezchchenauchfxchefff`jagffbxenbzbi`dftbc`edz`df`buddbudd````````````",
-"```````````````y`rbuf`diaoajacbgevevcrfpfpfp`afffffc`faqfxchchfzc`dgfxdgbjfxaiaiancofxfpcodg`bffds`adgbxbzbz`e`v`vftbeev`zajf`ddei`t````````````",
-"`````````````````yfoeyfbaj`zajbgevakalbxcccu`e`b`bc`efbic`axaxchfxfpezchbjfcdodochfx`fanbzcuaufxcv`bfp`pef`e`eeoeoaof`f`ajdv`rfn`r``````````````",
-"``````````````````cn`rejeidvacdveoak`vccccfffpbibx`ac``jcucu`jfxbifxfpfxfxfxcodgc`aybiai`i`jch`j`a`edjagacbc`x`zfnddajf`eodvey`t````````````````",
-"``````````````````eybfej`rejfoaoevcccc`v`xbcc`c`fffpbicubxcucuffc`cu`pfcfpdgbhdoaucu`jcuffbxbx`bcr`efjagbcfjeodkeodkevddfobpcney````````````````",
-"````````````````````eyejbpejbpdddvaoaodjbcagbcft`jefchfxbiauc``a`ac`c`fc`afcfccufcenfp`jfffp`jdsfpftcycrbcccdz`zdkbebebfddbf`r``````````````````",
-"``````````````````````cnbpeyfofofodudd`eacdjafcr`d`dcufpffef`jca`bff`jfcbxcuc`dsaecv`d`jds`dcy`vag`xagbcfteo`zbpfnbpbfej`r`r````````````````````",
-"````````````````````````d`bpddbfbebgak`zfj`z`kdsdsbxffff`bdj`b`b`jcucucudgcueffp`b`bcacacvcvctct`dagcyfjccevddeoeybpd`ej`r``````````````````````",
-"``````````````````````````eyddbp`r`k`z`zdzem`kfjfj`b`d`vdjcyctctcactctcv`dcr`bcvctaeaecv`b`jfjdsccakcveoakbedz`zd`ahewah````````````````````````",
-"````````````````````````````ewcnbnbndd`kdzfjdzemakemae`zcv`dcaaeaecy`e`acadsag`vaeaecvakaffjcacrbcajfj`zbp`z`kfnewewcn``````````````````````````",
-"```````````````````````````````rewbfbp`z`zbedzafcyakembeafctcaak`d`v`acvaeae`dff`dag`baeakfj`zcy`zbm`z`z`k`zbfd`ahcn````````````````````````````",
-"```````````````````````````````````sd`eyfnbmeobm`zdz`saf`v`k`kcvbcag`bcvemaeaecvagcyaecvevafaf`zem`zd`dkbmd`bfbf````````````````````````````````",
-"````````````````````````````````````ahewfoewbf`k`z`zdz`zafemememcvaf`kdz`vafaeafakemembmbpafdkdkbp`k`zbp`seyah``````````````````````````````````",
-"`````````````````````````````````````````sah`zewdk`z`zdzaeaf`kemdzakakaeae`kemakemeo`z`kemdkbfbpdk`kd`d`bn``````````````````````````````````````",
-"````````````````````````````````````````````ahbnbf`zd`d``sbm`kdz`sdkdk`sae`k`zbmd``k`sbmdz`kbnah`s`sbn``````````````````````````````````````````",
-"````````````````````````````````````````````````bncnbmbnd`dkdkdkdkbm`sbnbnbndzd`d``sbm`sbfd`bnewah``````````````````````````````````````````````",
-"``````````````````````````````````````````````````````cnd``s`s`sahd`dkbmbnbn`sbnd`bnbn`newah````````````````````````````````````````````````````",
-"``````````````````````````````````````````````````````````````ahcn`sbnahewbn`sewahbn````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
-};
-char **default_bubbles[] = {glass1, glass2, glass3, glass4, glass5, glass6, glass7, glass8, glass9, glass10, glass11, (char **)0};
-
-int num_default_bubbles = 11;
-
-#endif /* NO_DEFAULT_BUBBLE */
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BLITSPIN.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BOUBOULE.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BRAID.C
+$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES-DEFAULT.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES.C
-$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES_DEFAULT.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CORAL.C
+$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CYNOSURE.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECAYSCREEN.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECO.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DRIFT.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) LMORPH.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MAZE.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE.C
+$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE2.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOUNTAIN.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MUNCH.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) NOSEGUY.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BLITSPIN.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BOUBOULE.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BRAID.C
+$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES-DEFAULT.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES.C
-$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES_DEFAULT.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CORAL.C
+$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CYNOSURE.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECAYSCREEN.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECO.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DRIFT.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) LMORPH.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MAZE.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE.C
+$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE2.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOUNTAIN.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MUNCH.C
$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) NOSEGUY.C
"*seeds: 20", /* too many for 640x480, too few for 1280x1024 */
"*delay: 5",
"*delay2: 1000",
- "*eraseSpeed: 400",
- "*eraseMode: -1",
0
};
{ "-seeds", ".seeds", XrmoptionSepArg, 0 },
{ "-delay", ".delay", XrmoptionSepArg, 0 },
{ "-delay2", ".delay2", XrmoptionSepArg, 0 },
- { "-erase-speed", ".eraseSpeed", XrmoptionSepArg, 0 },
- { "-erase-mode", ".eraseMode", XrmoptionSepArg, 0 },
{ 0, 0, 0, 0 }
};
--- /dev/null
+/* cynosure --- draw some rectangles
+ *
+ * 01-aug-96: written in Java by ozymandias G desiderata <ogd@organic.com>
+ * 25-dec-97: ported to C and XScreenSaver by Jamie Zawinski <jwz@netscape.com>
+ *
+ * Original version:
+ * http://www.organic.com/staff/ogd/java/cynosure.html
+ * http://www.organic.com/staff/ogd/java/source/cynosure/Cynosure-java.txt
+ *
+ * Original comments and copyright:
+ *
+ * Cynosure.java
+ * A Java implementation of Stephen Linhart's Cynosure screen-saver as a
+ * drop-in class.
+ *
+ * Header: /home/ogd/lib/cvs/aoaioxxysz/graphics/Cynosure.java,v 1.2 1996/08/02 02:41:21 ogd Exp
+ *
+ * ozymandias G desiderata <ogd@organic.com>
+ * Thu Aug 1 1996
+ *
+ * COPYRIGHT NOTICE
+ *
+ * Copyright 1996 ozymandias G desiderata. Title, ownership rights, and
+ * intellectual property rights in and to this software remain with
+ * ozymandias G desiderata. This software may be copied, modified,
+ * or used as long as this copyright is retained. Use this code at your
+ * own risk.
+ *
+ * Revision: 1.2
+ *
+ * Log: Cynosure.java,v
+ * Revision 1.2 1996/08/02 02:41:21 ogd
+ * Added a few more comments, fixed messed-up header.
+ *
+ * Revision 1.1.1.1 1996/08/02 02:30:45 ogd
+ * First version
+ */
+
+#include "screenhack.h"
+static Display *dpy;
+static Window window;
+static XColor *colors;
+static int ncolors;
+static int fg_pixel, bg_pixel;
+static GC fg_gc, bg_gc, shadow_gc;
+
+static void paint(void);
+static int genNewColor(void);
+static int genConstrainedColor(int base, int tweak);
+static int c_tweak(int base, int tweak);
+
+/**
+ * The current color that is being tweaked to create the
+ * rectangles.
+ **/
+static int curColor;
+
+/**
+ * A variable used for the progression of the colors (yes, I know
+ * that's a lame explanation, but if your read the source, it should
+ * become obvious what I'm doing with this variable).
+ **/
+static int curBase;
+
+/**
+ * The width of the right and bottom edges of the rectangles.
+ **/
+static int shadowWidth;
+
+/* The offset of the dropshadow beneath the rectangles. */
+static int elevation;
+
+/**
+ * The approximate amount of time that will elapse before the base
+ * color is permanently changed.
+ *
+ * @see #tweak
+ **/
+static int sway;
+
+/**
+ * The counter of time left until the base color value used. This class
+ * variable is necessary because Java doesn't support static method
+ * variables (grr grr).
+ **/
+static int timeLeft;
+
+/**
+ * The amount by which the color of the polygons drawn will vary.
+ *
+ * @see #sway;
+ **/
+static int tweak;
+
+/**
+ * The smallest size for an individual cell.
+ **/
+#define MINCELLSIZE 16
+
+/**
+ * The narrowest a rectangle can be.
+ **/
+#define MINRECTSIZE 6
+
+/**
+ * The size of the grid that the rectangles are placed within.
+ **/
+static int gridSize;
+
+/**
+ * Every so often genNewColor() generates a completely random
+ * color. This variable sets how frequently that happens. It's
+ * currently set to happen 1% of the time.
+ *
+ * @see #genNewColor
+ **/
+#define THRESHOLD 100 /*0.01*/
+
+
+char *progclass = "Cynosure";
+char *defaults [] = {
+ "Cynosure.background: black", /* to placate SGI */
+ "*delay: 500000",
+ "*colors: 128",
+ "*iterations: 100",
+ "*shadowWidth: 2",
+ "*elevation: 5",
+ "*sway: 30",
+ "*tweak: 20",
+ "*gridSize: 12",
+ 0
+};
+
+XrmOptionDescRec options [] = {
+ { "-delay", ".delay", XrmoptionSepArg, 0 },
+ { "-ncolors", ".colors", XrmoptionSepArg, 0 },
+ { "-iterations", ".iterations", XrmoptionSepArg, 0 },
+ { 0, 0, 0, 0 }
+};
+
+
+void screenhack(Display *d, Window w)
+{
+ XWindowAttributes xgwa;
+ XGCValues gcv;
+ int delay;
+ int i, iterations;
+
+ dpy = d;
+ window = w;
+
+ curColor = 0;
+ curBase = curColor;
+ shadowWidth = get_integer_resource ("shadowWidth", "Integer");
+ elevation = get_integer_resource ("elevation", "Integer");
+ sway = get_integer_resource ("sway", "Integer");
+ tweak = get_integer_resource ("tweak", "Integer");
+ gridSize = get_integer_resource ("gridSize", "Integer");
+ timeLeft = 0;
+
+ XGetWindowAttributes (dpy, window, &xgwa);
+
+ ncolors = get_integer_resource ("colors", "Colors");
+ if (ncolors < 2) ncolors = 2;
+ if (ncolors <= 2) mono_p = True;
+
+ if (mono_p)
+ colors = 0;
+ else
+ colors = (XColor *) malloc(sizeof(*colors) * (ncolors+1));
+
+ if (mono_p)
+ ;
+ else {
+ make_smooth_colormap (dpy, xgwa.visual, xgwa.colormap, colors, &ncolors,
+ True, 0, True);
+ if (ncolors <= 2) {
+ mono_p = True;
+ ncolors = 2;
+ if (colors) free(colors);
+ colors = 0;
+ }
+ }
+
+ bg_pixel = get_pixel_resource("background", "Background", dpy,
+ xgwa.colormap);
+ fg_pixel = get_pixel_resource("foreground", "Foreground", dpy,
+ xgwa.colormap);
+
+ gcv.foreground = fg_pixel;
+ fg_gc = XCreateGC(dpy, window, GCForeground, &gcv);
+ gcv.foreground = bg_pixel;
+ bg_gc = XCreateGC(dpy, window, GCForeground, &gcv);
+
+ gcv.fill_style = FillStippled;
+ gcv.stipple = XCreateBitmapFromData(dpy, window, "\125\252", 8, 2);
+ shadow_gc = XCreateGC(dpy, window, GCForeground|GCFillStyle|GCStipple, &gcv);
+ XFreePixmap(dpy, gcv.stipple);
+
+ delay = get_integer_resource ("delay", "Delay");
+ iterations = get_integer_resource ("iterations", "Iterations");
+
+ while (1)
+ {
+ if (iterations > 0 && ++i >= iterations)
+ {
+ i = 0;
+ if (!mono_p)
+ XSetWindowBackground(dpy, window,
+ colors[random() % ncolors].pixel);
+ XClearWindow(dpy, window);
+ }
+ paint();
+ XSync(dpy, False);
+ if (delay)
+ usleep(delay);
+ }
+}
+
+/**
+ * paint adds a new layer of multicolored rectangles within a grid of
+ * randomly generated size. Each row of rectangles is the same color,
+ * but colors vary slightly from row to row. Each rectangle is placed
+ * within a regularly-sized cell, but each rectangle is sized and
+ * placed randomly within that cell.
+ *
+ * @param g the Graphics coordinate in which to draw
+ * @see #genNewColor
+ **/
+static void paint(void)
+{
+ int i;
+ int cellsWide, cellsHigh, cellWidth, cellHeight;
+ static int width, height;
+ static int size_check = 1;
+
+ if (--size_check <= 0)
+ {
+ XWindowAttributes xgwa;
+ XGetWindowAttributes (dpy, window, &xgwa);
+ width = xgwa.width;
+ height = xgwa.height;
+ size_check = 1000;
+ }
+
+ /* How many cells wide the grid is (equal to gridSize +/- (gridSize / 2))
+ */
+ cellsWide = c_tweak(gridSize, gridSize / 2);
+ /* How many cells high the grid is (equal to gridSize +/- (gridSize / 2))
+ */
+ cellsHigh = c_tweak(gridSize, gridSize / 2);
+ /* How wide each cell in the grid is */
+ cellWidth = width / cellsWide;
+ /* How tall each cell in the grid is */
+ cellHeight = height / cellsHigh;
+
+ /* Ensure that each cell is above a certain minimum size */
+
+ if (cellWidth < MINCELLSIZE) {
+ cellWidth = MINCELLSIZE;
+ cellsWide = width / cellWidth;
+ }
+
+ if (cellHeight < MINCELLSIZE) {
+ cellHeight = MINCELLSIZE;
+ cellsHigh = width / cellWidth;
+ }
+
+ /* fill the grid with randomly-generated cells */
+ for(i = 0; i < cellsHigh; i++) {
+ int j;
+
+ /* Each row is a different color, randomly generated (but constrained) */
+ if (!mono_p)
+ {
+ int c = genNewColor();
+ XSetForeground(dpy, fg_gc, colors[c].pixel);
+ }
+
+ for(j = 0; j < cellsWide; j++) {
+ int curWidth, curHeight, curX, curY;
+
+ /* Generate a random height for a rectangle and make sure that */
+ /* it's above a certain minimum size */
+ curHeight = random() % (cellHeight - shadowWidth);
+ if (curHeight < MINRECTSIZE)
+ curHeight = MINRECTSIZE;
+ /* Generate a random width for a rectangle and make sure that
+ it's above a certain minimum size */
+ curWidth = random() % (cellWidth - shadowWidth);
+ if (curWidth < MINRECTSIZE)
+ curWidth = MINRECTSIZE;
+ /* Figure out a random place to locate the rectangle within the
+ cell */
+ curY = (i * cellHeight) + (random() % ((cellHeight - curHeight) -
+ shadowWidth));
+ curX = (j * cellWidth) + (random() % ((cellWidth - curWidth) -
+ shadowWidth));
+
+ /* Draw the shadow */
+ if (elevation > 0)
+ XFillRectangle(dpy, window, shadow_gc,
+ curX + elevation, curY + elevation,
+ curWidth, curHeight);
+
+ /* Draw the edge */
+ if (shadowWidth > 0)
+ XFillRectangle(dpy, window, bg_gc,
+ curX + shadowWidth, curY + shadowWidth,
+ curWidth, curHeight);
+
+ XFillRectangle(dpy, window, fg_gc, curX, curY, curWidth, curHeight);
+
+ /* Draw a 1-pixel black border around the rectangle */
+ XDrawRectangle(dpy, window, bg_gc, curX, curY, curWidth, curHeight);
+ }
+
+ }
+}
+
+
+/**
+ * genNewColor returns a new color, gradually mutating the colors and
+ * occasionally returning a totally random color, just for variety.
+ *
+ * @return the new color
+ **/
+static int genNewColor(void)
+{
+ /* These lines handle "sway", or the gradual random changing of */
+ /* colors. After genNewColor() has been called a given number of */
+ /* times (specified by a random permutation of the tweak variable), */
+ /* take whatever color has been most recently randomly generated and */
+ /* make it the new base color. */
+ if (timeLeft == 0) {
+ timeLeft = c_tweak(sway, sway / 3);
+ curColor = curBase;
+ } else {
+ timeLeft--;
+ }
+
+ /* If a randomly generated number is less than the threshold value,
+ produce a "sport" color value that is completely unrelated to the
+ current palette. */
+ if (0 == (random() % THRESHOLD)) {
+ return (random() % ncolors);
+ } else {
+ curBase = genConstrainedColor(curColor, tweak);
+ return curBase;
+ }
+
+}
+
+/**
+ * genConstrainedColor creates a random new color within a certain
+ * range of an existing color. Right now this works with RGB color
+ * values, but a future version of the program will most likely use HSV
+ * colors, which should generate a more pleasing progression of values.
+ *
+ * @param base the color on which the new color will be based
+ * @param tweak the amount that the new color can be tweaked
+ * @return a new constrained color
+ * @see #genNewColor
+ **/
+static int genConstrainedColor(int base, int tweak)
+{
+ int i = 1 + (random() % tweak);
+ if (random() & 1)
+ i = -i;
+ i = (base + i) % ncolors;
+ while (i < 0)
+ i += ncolors;
+ return i;
+}
+
+/**
+ * Utility function to generate a tweaked color value
+ *
+ * @param base the byte value on which the color is based
+ * @param tweak the amount the value will be skewed
+ * @see #tweak
+ * @return the tweaked byte
+ **/
+static int c_tweak(int base, int tweak)
+{
+ int ranTweak = (random() % (2 * tweak));
+ int n = (base + (ranTweak - tweak));
+ if (n < 0) n = -n;
+ return (n < 255 ? n : 255);
+}
if (delay < 0) delay = 0;
+ XGetWindowAttributes (dpy, window, &xgwa);
+
gcv.function = GXcopy;
gcv.subwindow_mode = IncludeInferiors;
gcflags = GCForeground |GCFunction;
gcflags |= GCSubwindowMode;
gc = XCreateGC (dpy, window, gcflags, &gcv);
- XGetWindowAttributes (dpy, window, &xgwa);
sizex = xgwa.width;
sizey = xgwa.height;
+++ /dev/null
-#define logo_width 464
-#define logo_height 435
-static unsigned char logo_bits[] = {
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0x60,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x60,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0x0f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfc,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfc,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf8,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfc,0xff,0xdf,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xdf,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x8f,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0xff,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0xff,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xff,0xff,0x07,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xff,0xff,0x07,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0xff,0x07,0xfe,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0x03,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0x03,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0xfc,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xe0,0xff,0xff,0,0xf0,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xe0,0xff,0xff,0,0xf0,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf0,0x07,0,0,
-0x80,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,
-0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0xff,0x03,0,0,0xe0,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfc,0xff,0xff,0,0,0,0,0,0xe0,0xff,0x07,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,
-0x7f,0xfe,0,0,0,0,0,0,0xfc,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x01,0xfe,
-0x01,0,0,0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x01,0xfe,0x01,0,
-0,0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0xff,0x07,0,0xce,0x07,0,0,0,
-0,0,0,0xfe,0x1f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfe,0x7f,0,0,0x87,0x1f,0,0,0,0,0,
-0,0xc0,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0xff,0x07,0,0x80,0x03,0x3e,0,0,0,0,0,0,0,
-0xfe,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,
-0x3f,0,0,0x80,0x03,0xf8,0,0,0,0,0,0,0,0xe0,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0x3f,0,
-0,0x80,0x03,0xf8,0,0,0,0,0,0,0,0xe0,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0x07,0,0,0xc0,
-0x01,0xe0,0x01,0,0,0,0,0,0,0,0xff,0x01,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0xc0,0xfb,0xff,
-0x0f,0,0,0,0,0,0,0,0xf0,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0xff,0x07,0,0xc0,0xff,0xff,0x3f,0,
-0,0,0,0,0,0,0x80,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0xc0,0xff,0x7f,0,0xe0,0xff,0xff,0x7f,0,0,0,
-0,0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x80,0xff,0xc0,0xff,0x7f,0,0xe0,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0x1f,
-0,0xf8,0xff,0x0f,0xf0,0x0f,0xc0,0xff,0x01,0,0,0,0,0,0,
-0,0xf0,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xe0,0x0f,0,0,
-0xff,0x7f,0xf0,0x01,0,0xf8,0x03,0,0,0,0,0,0,0,0xc0,
-0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,0x80,0xff,
-0x7b,0,0,0xe0,0x07,0,0,0,0,0,0,0,0,0xfe,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf8,0,0,0,0,0xfc,0x3f,0,
-0,0x80,0x1f,0,0,0,0,0,0,0,0,0xf0,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0,0,0,0,0xfc,0x3f,0,0,0x80,
-0x1f,0,0,0,0,0,0,0,0,0xf0,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x3c,0,0,0,0,0xe0,0x7f,0,0,0,0x7e,0,
-0,0,0,0,0,0,0,0xe0,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x3e,0,0,0,0,0,0xff,0x03,0,0,0x70,0,0,0,
-0,0,0,0,0,0x80,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,
-0,0,0,0,0,0xf0,0x1f,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfc,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0x0f,0,0,
-0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,
-0,0,0xf8,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,0,0,
-0xf8,0x07,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xe0,0x03,0,0,0,0,0,0,0xe0,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0x01,0,0,0,0,0,0,0x80,0xff,0,0,
-0,0,0,0,0,0,0,0,0,0,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xf8,0x01,0,0,0,0,0,0,0,0xfc,0x07,0,0,0,
-0,0,0,0,0,0,0,0,0x7c,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,
-0,0,0,0xfe,0x03,0,0,0,0xf0,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0,0,
-0,0xfe,0x03,0,0,0,0xf0,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfc,0,0,0xf0,0xff,
-0x1f,0,0,0,0x80,0x7f,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x3f,0,0,0xfc,0xff,0x7f,0,
-0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,0,
-0xc0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0x1f,0,0,0xff,0x47,0x7f,0,0,0,
-0,0xf8,0x0f,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0,0,0,0,0xc0,
-0xff,0,0,0,0,0,0,0,0,0,0,0,0x3e,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0,0,0,0,0xc0,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0x3e,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,
-0x03,0xc0,0xff,0xfe,0xff,0x7d,0,0,0,0,0x80,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0x7c,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0,0x40,
-0,0,0xfe,0x7f,0,0,0,0,0x80,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0xf0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0x3f,0,0,0x80,0x03,
-0xf8,0x3f,0,0,0,0,0x80,0xe7,0x1f,0,0,0,0,0,0,
-0,0,0,0,0xf0,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0x0f,0,0,0xf0,0xff,0xff,0x1f,
-0,0,0,0,0x80,0xc7,0x7f,0,0,0,0,0,0,0,0,
-0,0,0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0x0f,0,0,0xf0,0xff,0xff,0x1f,0,0,
-0,0,0x80,0xc7,0x7f,0,0,0,0,0,0,0,0,0,0,
-0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0xff,0x03,0,0,0xf0,0xff,0xff,0x0f,0,0,0,0,
-0xc0,0x0f,0xff,0x01,0,0,0,0,0,0,0,0,0,0xc0,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0x7f,0,0,0,0xc0,0xff,0xff,0x01,0,0,0,0,0xc0,0x0f,
-0xfc,0x07,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0x0f,0xf0,0x0f,
-0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0x80,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0xe0,0x1f,0x80,0x3f,0,0,
-0,0,0,0,0,0,0,0,0x1c,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf8,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0x1c,0,0xfe,0x03,0,0,0,
-0,0,0,0,0,0,0x78,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0x1c,0,0xfe,0x03,0,0,0,0,0,
-0,0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0x70,0x1c,0,0xf0,0x07,0,0,0,0,0,0,0,
-0,0,0xf0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x70,0x38,0,0xc0,0x1f,0,0,0,0,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0x70,
-0x78,0,0,0x7f,0,0,0,0,0,0,0,0,0,0xc0,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x70,0x70,0,
-0,0xfc,0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0x70,0x70,0,0,0xfc,
-0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xc0,0x01,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x38,0x70,0,0,0xfe,0x03,0xfe,
-0x7f,0,0,0,0,0,0,0,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0x38,0xf0,0,0,0xfe,0x0f,0xff,0xff,0x01,
-0,0,0,0,0,0,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xe0,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x18,0xe0,0,0x80,0x9f,0xff,0x3f,0xfe,0x03,0,0,
-0,0,0,0,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x1c,0xe0,0,0x80,0x0f,0xff,0x07,0xc0,0x0f,0,0,0,0,
-0,0,0x1e,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x1c,0xe0,0,0x80,0x0f,0xff,0x07,0xc0,0x0f,0,0,0,0,0,0,
-0x1e,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xf1,
-0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0x0e,0xe0,
-0,0xc0,0x07,0xfc,0x01,0,0x1f,0,0,0,0,0,0,0x3e,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xe1,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0x0e,0xe0,0x01,0xe0,
-0x03,0x60,0,0,0x38,0,0,0,0,0,0,0x3c,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xc3,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0x07,0xc0,0x01,0xf0,0x01,0,
-0xe0,0x03,0xf0,0,0,0,0,0,0,0x38,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0x07,0xf0,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0x07,0xc0,0x03,0xf8,0,0,0xf8,0x1f,
-0xe0,0,0,0,0,0,0,0x38,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0x07,0xf0,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0x07,0xc0,0x03,0xf8,0,0,0xf8,0x1f,0xe0,0,
-0,0,0,0,0,0x38,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0x0f,0xc0,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0x07,0x80,0x03,0x78,0,0,0xf8,0x7f,0xe0,0x01,0,0,
-0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x0f,0x80,0x0f,0,0,0,0,0,0,0,0,0,0,
-0x80,0x03,0x80,0x03,0x3e,0,0,0x78,0x7e,0xc0,0x03,0,0,0,0,
-0,0x78,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x1e,0x1c,0x0f,0,0,0,0,0,0,0,0,0,0,0x80,0xf3,
-0x9f,0x03,0x1f,0,0,0,0xf0,0x80,0x03,0,0,0,0,0,0x70,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x1e,0xfe,
-0x0f,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x07,
-0x0f,0,0,0,0xe0,0,0x07,0,0,0,0,0,0x70,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x1e,0xfe,0x0f,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x07,0x0f,0,
-0,0,0xe0,0,0x07,0,0,0,0,0,0x70,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x7c,0xfc,0x0f,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0x87,0x07,0,0,0,
-0xe0,0,0x07,0,0,0,0,0,0x70,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x7c,0xf8,0x0f,0,0,0,0,0,
-0,0,0,0,0,0xc0,0x3f,0xf4,0xc7,0x07,0,0,0,0xe0,0,
-0x07,0,0,0,0,0,0x70,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0x03,0x80,0xe7,0x01,0,0,0,0xe0,0,0x07,0,
-0,0,0,0,0xe0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0,0,0xff,0x01,0,0,0,0xe0,0x80,0x07,0,0,0,
-0,0,0xe0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xff,0,0,0,0,0xf8,0x80,0x03,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xff,0,0,0,0,0xf8,0x80,0x03,0,0,0,0,0,0xe0,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x80,0x07,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x7e,0,
-0,0,0,0x7c,0xc0,0x01,0,0,0,0,0,0xe0,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x3e,0,0x80,0x07,
-0xe0,0x3f,0xe0,0x01,0,0,0,0,0,0xc0,0x01,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x1e,0,0xc0,0xff,0xff,0x0f,
-0xe0,0,0,0,0,0,0,0xc0,0x01,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x1e,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x1f,0,0xe0,0xff,0xff,0x03,0xe0,0,
-0,0,0,0,0,0xc0,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x1e,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x1f,0,0xe0,0xff,0xff,0x03,0xe0,0,0,0,
-0,0,0,0xc0,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x3f,0,0x1e,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0x07,0,0x80,0xff,0x7f,0,0xf8,0x01,0,0,0,0,
-0,0xc0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0x03,0x1e,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xc0,0x07,0,0,0,0,0,0xfc,0x07,0,0,0,0,0,0xc0,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x1e,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x03,
-0,0,0,0,0,0xfe,0x0f,0,0,0,0,0,0xc0,0x01,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,
-0,0,0x80,0xcf,0x3f,0,0,0xfe,0x01,0,0xc0,0x01,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,0,0,
-0x80,0xcf,0x3f,0,0,0xfe,0x01,0,0xc0,0x01,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0,0,0,0,0,0xe0,0xe7,
-0xff,0,0,0xfe,0x0f,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0x03,0,0xfc,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0x03,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x7c,0,0,0,0,0xf0,0xff,0xf9,0xff,0x01,
-0,0xe0,0x1f,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0x03,0,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0x03,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x7e,0,0,0,0xc0,0xff,0x7f,0xfe,0xe1,0x07,0,0xc0,
-0xff,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0x01,0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x03,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x1e,0,0,0,0xfc,0xff,0x1f,0xff,0x81,0x0f,0,0x80,0xf1,0x03,
-0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,
-0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0x1e,
-0,0,0,0xfc,0xff,0x1f,0xff,0x81,0x0f,0,0x80,0xf1,0x03,0xc0,0xe1,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0xc0,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x81,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,
-0,0xff,0x3f,0x80,0xff,0,0x1f,0,0x80,0xc1,0x07,0xc0,0xe1,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0,0,0,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xc1,0xff,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0x03,0xc0,0x3f,
-0,0xe0,0x7f,0,0x7e,0,0x80,0x01,0x1f,0xe0,0xe1,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0xfc,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0x80,0x0f,0x80,0x07,0xf0,0x07,0,0xf0,
-0x3f,0,0xf8,0,0x80,0x01,0x3c,0xe0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0x03,0,0,0,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0xc0,0x03,0x80,0xff,0xff,0x01,0,0xfc,0x1f,0,
-0xf0,0x01,0xc0,0x01,0x38,0xe0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0x7f,0xf0,0,0xf8,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0xe0,0x03,0,0xfe,0x1f,0,0x80,0xbf,0x07,0,0x80,0x07,
-0xc0,0x01,0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,
-0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x7f,0xf0,0,0xf8,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0xe0,0x03,0,0xfe,0x1f,0,0x80,0xbf,0x07,0,0x80,0x07,0xc0,0x01,
-0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,0,0,
-0,0,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,
-0xf0,0,0,0xfe,0x7f,0,0,0,0,0,0,0,0,0,0xf0,
-0x01,0,0xf8,0x03,0,0xc0,0xcf,0x03,0,0x80,0x1f,0xf0,0x01,0xe0,0x71,
-0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0,
-0,0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0xf0,0,
-0,0xe0,0xff,0x03,0,0,0,0,0,0,0,0,0xf8,0,0,
-0,0,0,0xe0,0xe7,0x03,0,0,0x7e,0xff,0,0xc0,0x73,0xf0,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0xfc,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0xf0,0,0,0,
-0xfc,0x1f,0,0,0,0,0,0,0,0,0x78,0,0,0,0,
-0,0xf8,0xf3,0,0,0,0xfc,0x7f,0,0,0x7f,0xf0,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0xf0,0xff,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0xf0,0,0,0,0xe0,0xff,
-0,0,0,0,0,0,0,0,0x3c,0,0,0,0,0,0x7c,
-0xf8,0,0,0,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x1f,
-0,0,0,0,0,0,0,0xf0,0,0,0,0xe0,0xff,0,0,
-0,0,0,0,0,0,0x3c,0,0,0,0,0,0x7c,0xf8,0,
-0,0,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x7f,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x3f,0,0,
-0,0,0,0,0,0x70,0,0,0,0x80,0xff,0x0f,0,0,0,
-0,0,0,0,0x3e,0,0,0,0,0,0x7f,0x7c,0,0,0,
-0xe0,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,
-0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0,0,0,0,
-0,0,0,0x78,0,0,0,0,0xfe,0x7f,0,0,0,0,0,
-0,0,0x1e,0,0,0,0,0xc0,0x1f,0x3e,0,0,0,0xc0,0xff,
-0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,
-0,0,0,0,0,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,
-0,0x7c,0,0,0,0,0xf0,0xff,0x03,0,0,0,0,0,0,
-0x0f,0,0,0,0,0xe0,0x07,0x1f,0,0,0,0x80,0x0f,0,0,
-0x3c,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0xfc,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0x3c,
-0,0,0,0,0,0xfe,0x0f,0,0,0,0,0,0,0x0f,0,
-0,0,0,0xfc,0x83,0x0f,0,0,0,0,0x0f,0,0,0x38,0xf0,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,
-0,0xfc,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0x3c,0,0,
-0,0,0,0xfe,0x0f,0,0,0,0,0,0,0x0f,0,0,0,
-0,0xfc,0x83,0x0f,0,0,0,0,0x0f,0,0,0x38,0xf0,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0xf0,
-0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0x1e,0,0,0,0xf8,
-0xff,0xff,0x3f,0,0,0,0,0,0x80,0x07,0,0,0,0,0xff,
-0x80,0x07,0,0,0,0,0x3e,0,0,0x38,0,0,0,0,0,
-0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0xff,0x7f,0,0,0,0,0,0,0x0f,0,0,0,0xff,0xff,0xff,
-0xff,0x03,0,0,0,0,0xe0,0x01,0,0,0,0xe0,0x1f,0xe0,0x03,
-0,0,0,0,0x78,0,0,0x1c,0,0,0,0,0xe0,0xff,0xff,
-0xff,0x0f,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,
-0,0,0,0,0,0x80,0x0f,0,0,0,0xff,0x3f,0xe0,0xff,0x0f,
-0,0,0,0,0xf0,0x01,0,0,0,0xf8,0x07,0xf0,0x01,0,0,
-0,0,0xf0,0x01,0,0x1e,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x03,0,
-0,0,0,0x80,0x07,0,0,0,0xe0,0xff,0x01,0xfe,0x3f,0,0,
-0,0,0xf0,0,0,0,0,0xfe,0x01,0xf8,0,0,0,0,0,
-0xc0,0x03,0,0x0e,0,0,0,0,0xfc,0xff,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x03,0,0,0,
-0,0x80,0x07,0,0,0,0xe0,0xff,0x01,0xfe,0x3f,0,0,0,0,
-0xf0,0,0,0,0,0xfe,0x01,0xf8,0,0,0,0,0,0xc0,0x03,
-0,0x0e,0,0,0,0,0xfc,0xff,0xff,0xff,0x01,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0x07,0,0,0,0,0x80,
-0x07,0,0,0,0,0xf8,0x07,0xc0,0xff,0x01,0,0,0,0xf8,0,
-0,0,0x80,0x7f,0,0x78,0,0,0,0,0,0xc0,0x0f,0,0x0e,
-0,0,0,0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,
-0,0,0,0xf0,0xff,0xff,0xff,0x1f,0,0,0,0,0xc0,0xe3,0xff,
-0xff,0,0,0xc0,0x1f,0x80,0xff,0x03,0,0,0,0x3c,0,0,0,
-0xe0,0x1f,0,0x3e,0,0,0,0,0,0,0x0f,0,0x07,0,0,
-0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0x7f,0,0,0,0,0xc0,0xfb,0xff,0xff,0x0f,
-0,0,0x3e,0x80,0xf3,0x1f,0,0,0,0x3e,0,0,0,0xf8,0x07,
-0,0x1e,0,0,0,0,0,0,0x1e,0,0x07,0,0,0,0xe0,
-0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,
-0xff,0xff,0xff,0xff,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0,0,
-0x7c,0xc0,0x81,0xff,0,0,0,0x1f,0,0,0,0xff,0x01,0,0x0f,
-0,0,0,0,0,0,0x7c,0x80,0x07,0,0,0,0xf0,0xff,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0xff,0xff,0x03,0,0,0,0xc0,0x7f,0,0xe0,0xff,0x3f,0,0xf0,0xc0,
-0x01,0xfe,0x03,0,0,0x0f,0,0,0xc0,0x7f,0,0xc0,0x07,0,0,
-0,0,0,0,0xf0,0xc0,0x03,0,0,0,0xfc,0xff,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,
-0x03,0,0,0,0xc0,0x7f,0,0xe0,0xff,0x3f,0,0xf0,0xc0,0x01,0xfe,
-0x03,0,0,0x0f,0,0,0xc0,0x7f,0,0xc0,0x07,0,0,0,0,
-0,0,0xf0,0xc0,0x03,0,0,0,0xfc,0xff,0xff,0xff,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0x07,0,
-0,0,0xc0,0x0f,0,0,0xfc,0xff,0x03,0xc0,0xe3,0x01,0xf0,0x07,0,
-0x80,0x07,0,0,0xf0,0x1f,0,0xc0,0x07,0,0,0,0,0,0,
-0xf0,0xc1,0x01,0,0,0,0xff,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x1f,0,0,0,
-0xc0,0x07,0,0,0,0xfc,0xff,0,0xf7,0,0,0x3f,0,0xc0,0x03,
-0,0,0xff,0,0,0xe0,0x01,0,0,0,0,0,0,0xc0,0xe3,
-0x01,0,0,0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0,0,0,0xc0,0x01,
-0,0,0,0xc0,0xff,0x07,0x7f,0,0,0xfc,0,0xe0,0x03,0,0xe0,
-0x3f,0,0,0xf0,0x01,0,0,0,0,0,0,0x80,0xff,0,0,
-0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfe,0xff,0xff,0xff,0,0,0,0xc0,0x01,0,0,
-0,0,0xfe,0x7f,0x7f,0,0,0xf8,0x01,0xe0,0x01,0,0xfc,0x07,0,
-0,0xf8,0,0,0,0,0,0,0,0,0xff,0,0,0,0xfc,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfe,0xff,0xff,0xff,0,0,0,0xc0,0x01,0,0,0,0,
-0xfe,0x7f,0x7f,0,0,0xf8,0x01,0xe0,0x01,0,0xfc,0x07,0,0,0xf8,
-0,0,0,0,0,0,0,0,0xff,0,0,0,0xfc,0xff,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0xff,0x03,0,0,0xc0,0x03,0,0,0,0,0xe0,0xff,
-0x3f,0,0,0xf0,0x07,0xf0,0,0,0xff,0x03,0,0,0x7c,0,0,
-0,0,0,0,0,0,0x7e,0,0,0,0xff,0xff,0xff,0x7f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0xff,0x0f,0,0,0xc0,0x03,0,0,0,0,0,0xfe,0x3f,0,
-0,0xc0,0x3f,0xf8,0,0xf8,0x3f,0,0,0,0x3c,0,0,0,0,
-0,0,0,0,0x3c,0,0,0x80,0xff,0xff,0xff,0x3f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,
-0x3f,0,0,0xc0,0x03,0,0,0,0,0,0xf0,0xff,0x0f,0,0,
-0x7f,0x7c,0,0xfe,0x07,0,0,0,0x1e,0,0,0,0,0,0,
-0,0,0x1e,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,
-0,0x80,0x07,0,0,0,0,0,0,0xff,0x7f,0,0,0xfc,0x3e,
-0xe0,0x7f,0,0,0,0,0x1f,0,0,0,0,0,0,0,0,
-0x1f,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,0,0x80,
-0x07,0,0,0,0,0,0,0xff,0x7f,0,0,0xfc,0x3e,0xe0,0x7f,
-0,0,0,0,0x1f,0,0,0,0,0,0,0,0,0x1f,0,
-0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x01,0,0x80,0x0f,0,
-0,0,0,0,0,0xf0,0xff,0x1f,0,0xf0,0x1f,0xfe,0x0f,0,0,
-0,0x80,0x0f,0,0,0,0,0,0,0,0,0x07,0,0,0xfc,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0x0f,0,0,0,
-0,0,0,0,0xfc,0xff,0x3f,0xc0,0xff,0xff,0,0,0,0,0xc0,
-0x07,0,0,0,0,0,0,0,0x80,0x03,0,0,0xff,0xff,0xff,
-0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0x0f,0,0,0x1e,0,0,0,0,0,
-0,0,0,0xfe,0xff,0xff,0xff,0x1f,0,0,0,0,0xe0,0x03,0,
-0,0,0,0,0,0,0xe0,0x03,0,0xc0,0xff,0xff,0xff,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x80,0xff,0xff,0xff,0x7f,0,0,0x3c,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0xff,0x03,0,0,0,0,0xf0,0x01,0,0,0,
-0,0,0,0,0xf8,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,
-0xff,0xff,0x7f,0,0,0x3c,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0x03,0,0,0,0,0xf0,0x01,0,0,0,0,0,
-0,0,0xf8,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,
-0xff,0,0,0x78,0,0,0,0,0,0,0,0,0,0,0xf8,
-0xff,0x1f,0,0,0,0,0xf0,0,0,0,0,0,0,0,0,
-0x7c,0,0,0xfc,0xff,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,
-0,0xf0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0x7f,
-0,0,0,0,0x7c,0,0,0,0,0,0,0,0,0x3e,0,
-0,0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0,0xe0,
-0x01,0,0,0,0,0,0,0,0,0,0,0x7c,0xfe,0,0,
-0,0,0x3c,0,0,0,0,0,0,0,0x80,0x1f,0,0xc0,0xff,
-0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x1f,0,0xc0,0x03,0,
-0,0,0,0,0,0,0,0,0,0x78,0xf8,0x03,0,0,0,
-0x1e,0,0,0,0,0,0,0,0xc0,0x07,0,0xe0,0xff,0xff,0xff,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,0x80,0x07,0,0,0,
-0,0,0,0,0,0,0,0x70,0xe0,0x0f,0,0,0,0x0f,0,
-0,0,0,0,0,0,0xf0,0x03,0,0xf8,0xff,0xff,0xff,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0xff,0xff,0x7f,0,0x80,0x07,0,0,0,0,0,
-0,0,0,0,0,0x70,0xe0,0x0f,0,0,0,0x0f,0,0,0,
-0,0,0,0,0xf0,0x03,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0xff,0xff,0,0x80,0x0f,0,0,0,0,0,0,0,
-0,0,0,0x70,0,0x3f,0,0,0x80,0x0f,0,0,0,0,0,
-0,0,0xf8,0x01,0,0xfe,0xff,0xff,0x7f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,
-0xff,0xff,0xff,0x03,0,0x1f,0,0,0,0,0,0,0,0,0,
-0,0x70,0,0xfe,0,0,0xc0,0x03,0,0,0,0,0,0,0,
-0x7e,0,0x80,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,
-0xff,0x0f,0,0x3e,0,0,0,0,0,0,0,0,0,0,0x70,
-0,0xf8,0x01,0,0xc0,0x03,0,0,0,0,0,0,0,0x3e,0,
-0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,
-0,0xf8,0,0,0,0,0,0,0,0,0,0,0x70,0,0x80,
-0x0f,0,0xf0,0x01,0,0,0,0,0,0,0xc0,0x0f,0,0xf8,0xff,
-0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,0,0xf8,
-0,0,0,0,0,0,0,0,0,0,0x70,0,0x80,0x0f,0,
-0xf0,0x01,0,0,0,0,0,0,0xc0,0x0f,0,0xf8,0xff,0xff,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,0,0xe0,0x01,0,
-0,0,0,0,0,0,0,0,0x70,0,0,0x3e,0,0xf0,0,
-0,0,0,0,0,0,0xe0,0x07,0,0xfe,0xff,0xff,0xff,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,0xc0,0x03,0,0,0,
-0,0,0,0,0,0,0x70,0,0,0xfc,0,0x78,0,0,0,
-0,0,0,0,0xf8,0x01,0x80,0xff,0xff,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0xff,0xff,0xff,0x0f,0xc0,0x07,0,0,0,0,0,
-0,0,0,0,0x78,0,0,0xe0,0x03,0x3c,0,0,0,0,0,
-0,0,0x7c,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0x1f,0,0x0f,0,0,0,0,0,0,0,
-0,0,0x7c,0,0,0xc0,0x1f,0x1e,0,0,0,0,0,0,0,
-0x3e,0,0xf0,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0x1f,0,0x0f,0,0,0,0,0,0,0,0,0,
-0x7c,0,0,0xc0,0x1f,0x1e,0,0,0,0,0,0,0,0x3e,0,
-0xf0,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,
-0xff,0x7f,0,0x1e,0,0,0,0,0,0,0,0,0,0x7c,0,
-0,0,0x3f,0x0f,0,0,0,0,0,0,0x80,0x0f,0,0xfc,0xff,
-0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,
-0x01,0x7c,0,0,0,0,0,0,0,0,0,0x3c,0,0,0,
-0xfc,0x0f,0,0,0,0,0,0,0xe0,0x07,0,0xff,0xff,0xff,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,0x78,
-0,0,0,0,0,0,0,0,0,0x3c,0,0,0,0xf8,0x07,
-0,0,0,0,0,0,0xf0,0x01,0xc0,0xff,0xff,0xff,0x1f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0,
-0,0,0,0,0,0,0,0x1c,0,0,0,0xfc,0x03,0,0,
-0,0,0,0,0xf8,0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0,0,0,
-0,0,0,0,0,0x1c,0,0,0,0xfc,0x03,0,0,0,0,
-0,0,0xf8,0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0xff,0x1f,0xe0,0x03,0,0,0,0,0,
-0,0,0,0x1c,0,0,0,0xfc,0x01,0,0,0,0,0,0,
-0x7e,0,0xf8,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xff,0xff,0xff,0xff,0x80,0x0f,0,0,0,0,0,0,0,
-0,0x1e,0,0,0,0xff,0,0,0,0,0,0,0x80,0x0f,0,
-0xfe,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0xff,0x01,0x1f,0,0,0,0,0,0,0,0,0x0e,
-0,0,0x80,0x7f,0,0,0,0,0,0,0xc0,0x07,0x80,0xff,0xff,
-0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,
-0xff,0xff,0x07,0x3e,0,0,0,0,0,0,0,0,0x0e,0,0,
-0xc0,0x3f,0,0,0,0,0,0,0xf0,0x01,0xe0,0xff,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,
-0x0f,0x7c,0,0,0,0,0,0,0,0,0x0f,0,0,0xe0,0x3f,
-0,0,0,0,0,0,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,0x7c,
-0,0,0,0,0,0,0,0,0x0f,0,0,0xe0,0x3f,0,0,
-0,0,0,0,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,0xf0,0,0,
-0,0,0,0,0,0,0x0f,0,0,0xf0,0x1f,0,0,0,0,
-0,0,0x7e,0,0xfc,0xff,0xff,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfe,0xff,0xff,0x7f,0xe0,0x01,0,0,0,
-0,0,0,0x80,0x07,0,0,0xfc,0x1f,0,0,0,0,0,0,
-0x3e,0,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfc,0xff,0xff,0xff,0xe0,0x03,0,0,0,0,0,
-0,0x80,0x07,0,0,0xfc,0x0f,0,0,0,0,0,0,0x1f,0xc0,
-0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0xc1,0x07,0,0,0,0,0,0,0xc0,
-0x03,0,0,0xfe,0x07,0,0,0,0,0,0xc0,0x0f,0xf0,0xff,0xff,
-0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0xff,0xc1,0x07,0,0,0,0,0,0,0xc0,0x03,0,
-0,0xfe,0x07,0,0,0,0,0,0xc0,0x0f,0xf0,0xff,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0xff,0x83,0x0f,0,0,0,0,0,0,0xc0,0x01,0,0,0xff,
-0x07,0,0,0,0,0,0xc0,0x07,0xf8,0xff,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,
-0x0f,0x1e,0,0,0,0,0,0,0xe0,0x01,0,0xc0,0xef,0x03,0,
-0,0,0,0,0xe0,0x01,0xff,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0x0f,0x1c,
-0,0,0,0,0,0,0xf0,0,0,0xe0,0xf3,0x01,0,0,0,
-0,0,0xf0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x1f,0x38,0,0,
-0,0,0,0,0x70,0,0,0xf0,0xf9,0,0,0,0,0,0,
-0x78,0xe0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfc,0xff,0xff,0x1f,0x38,0,0,0,0,
-0,0,0x70,0,0,0xf0,0xf9,0,0,0,0,0,0,0x78,0xe0,
-0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0x7f,0xf0,0,0,0,0,0,0,
-0x78,0,0,0x78,0x7c,0,0,0,0,0,0,0x3c,0xf0,0xff,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0xff,0xff,0xe0,0,0,0,0,0,0,0x78,0,
-0,0x7e,0x7c,0,0,0,0,0,0,0x3c,0xf8,0xff,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0xff,0xe0,0x01,0,0,0,0,0,0x3c,0,0,0x3e,
-0x3e,0,0,0,0,0,0,0x1f,0xfe,0xff,0xff,0x7f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xff,0xc1,0x03,0,0,0,0,0,0x3c,0,0,0x0f,0x1e,0,
-0,0,0,0,0,0x0f,0xfe,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,
-0xc1,0x03,0,0,0,0,0,0x3c,0,0,0x0f,0x1e,0,0,0,
-0,0,0,0x0f,0xfe,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x83,0x07,
-0,0,0,0,0,0x1e,0,0xc0,0x07,0x0f,0,0,0,0,0,
-0x80,0x07,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0x07,0x0f,0,0,
-0,0,0,0x0f,0,0xe0,0x83,0x0f,0,0,0,0,0,0x80,0xc7,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xc0,0xff,0xff,0x0f,0x0f,0,0,0,0,
-0,0x07,0,0xf0,0x81,0x07,0,0,0,0,0,0xc0,0xc3,0xff,0xff,
-0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xff,0xff,0x1f,0x1c,0,0,0,0,0x80,0x03,
-0,0x7c,0xc0,0x03,0,0,0,0,0,0xe0,0xe1,0xff,0xff,0x7f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x3f,0x3c,0,0,0,0,0xc0,0x03,0,0x3f,
-0xe0,0x01,0,0,0,0,0,0xe0,0xe0,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0x3f,0x3c,0,0,0,0,0xc0,0x03,0,0x3f,0xe0,0x01,
-0,0,0,0,0,0xe0,0xe0,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,
-0xff,0x3f,0x3c,0,0,0,0,0xe0,0x01,0x80,0x1f,0xe0,0x01,0,0,
-0,0,0,0xf0,0xe0,0xff,0xff,0x07,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,
-0x38,0,0,0,0,0xe0,0,0xe0,0x07,0xf0,0,0,0,0,0,
-0,0x78,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,
-0,0,0,0xf0,0,0xf0,0x03,0x70,0,0,0,0,0,0,0x78,
-0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,
-0,0x70,0,0xfe,0,0x38,0,0,0,0,0,0,0x3c,0xfc,0xff,
-0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,0,0x70,
-0,0xfe,0,0x38,0,0,0,0,0,0,0x3c,0xfc,0xff,0x3f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,0,0x38,0x80,0x3f,
-0,0x3c,0,0,0,0,0,0,0x1c,0xfc,0xff,0x3f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0x3f,0x38,0,0,0,0,0x1c,0xc0,0x0f,0,0x1c,
-0,0,0,0,0,0,0x1e,0xfc,0xff,0x3f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0x38,0,0,0,0,0x1e,0xf0,0x03,0,0x1e,0,0,
-0,0,0,0,0x1e,0xfc,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,
-0x1f,0x38,0,0,0,0,0x0f,0x7f,0,0,0x0f,0,0,0,0,
-0,0,0x0f,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x1f,0x38,
-0,0,0,0,0x0f,0x7f,0,0,0x0f,0,0,0,0,0,0,
-0x0f,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x1f,0x38,0,0,
-0,0,0xe7,0x3f,0,0,0x07,0,0,0,0,0,0,0x0f,0xfc,
-0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xff,0xff,0x0f,0x38,0,0,0,0x80,
-0xfb,0x0f,0,0x80,0x03,0,0,0,0,0,0,0x07,0xfc,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xff,0xff,0x07,0x38,0,0,0,0xc0,0xff,0x01,
-0,0xc0,0x03,0,0,0,0,0,0x80,0x07,0xf8,0xff,0xff,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0xff,0x07,0x38,0,0,0,0xe0,0x3f,0,0,0xc0,
-0x01,0,0,0,0,0,0xc0,0x03,0xf8,0xff,0xff,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0x38,0,0,0,0xe0,0x3f,0,0,0xc0,0x01,0,
-0,0,0,0,0xc0,0x03,0xf8,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,
-0xff,0x07,0x38,0,0,0,0xe0,0x0f,0,0,0xe0,0,0,0,0,
-0,0,0xc0,0x03,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,
-0x38,0,0,0,0xf0,0x03,0,0,0xf0,0,0,0,0,0,0,
-0xe0,0x01,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0x38,0,
-0,0,0x70,0,0,0,0x70,0,0,0,0,0,0,0xe0,0x01,
-0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0x01,0x38,0,0,0,
-0,0,0,0,0x78,0,0,0,0,0,0,0xe0,0,0xf0,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,
-0,0,0x38,0,0,0,0,0,0,0xf0,0,0xf0,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,0,0,
-0x38,0,0,0,0,0,0,0xf0,0,0xf0,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,0,0,0x3c,0,
-0,0,0,0,0,0xf0,0,0xe0,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0xff,0,0x38,0,0,0,0,0,0,0,0x1e,0,0,0,
-0,0,0,0x78,0,0xe0,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,
-0,0x18,0,0,0,0,0,0,0,0x1e,0,0,0,0,0,
-0,0x78,0,0xc0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0x18,
-0,0,0,0,0,0,0,0x0f,0,0,0,0,0,0,0x3c,
-0,0xc0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0x18,0,0,
-0,0,0,0,0,0x0f,0,0,0,0,0,0,0x3c,0,0xc0,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x7f,0,0x1c,0,0,0,0,
-0,0,0x80,0x07,0,0,0,0,0,0,0x3c,0,0x80,0xff,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x3f,0,0x1c,0,0,0,0,0,0,
-0x80,0x07,0,0,0,0,0,0,0x1e,0,0x80,0xff,0xff,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,
-0,0,0,0,0,0,0x1e,0,0x80,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,0,0,
-0,0,0,0,0x1f,0,0,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,0,0,0,0,
-0,0,0x1f,0,0,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,
-0x1c,0,0,0,0,0,0,0xe0,0x01,0,0,0,0,0,0,
-0x0f,0,0,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0x1c,0,
-0,0,0,0,0,0xe0,0,0,0,0,0,0,0,0x0f,0,
-0,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0x07,0,0x1c,0,0,0,
-0,0,0,0xf0,0,0,0,0,0,0,0x80,0x07,0,0,0xfe,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,
-0,0x70,0,0,0,0,0,0,0x80,0x07,0,0,0xfe,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,0,0x70,
-0,0,0,0,0,0,0x80,0x07,0,0,0xfe,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,0,0x78,0,0,
-0,0,0,0,0x80,0x07,0,0,0xfc,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,
-0xff,0x03,0,0x1e,0,0,0,0,0,0,0x38,0,0,0,0,
-0,0,0x80,0x03,0,0,0xfc,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,
-0,0x1e,0,0,0,0,0,0,0x3c,0,0,0,0,0,0,
-0xc0,0x03,0,0,0xfc,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0,0x1e,
-0,0,0,0,0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,
-0,0,0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0,0x1e,0,0,
-0,0,0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,0,0,
-0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xc0,0xff,0xff,0x01,0,0x1e,0,0,0,0,
-0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,0,0,0xf8,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0x01,0,0x1c,0,0,0,0,0,0,
-0x0f,0,0,0,0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0xff,0xff,0,0,0x1c,0,0,0,0,0,0x80,0x07,0,
-0,0,0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0xff,0,0,0x3c,0,0,0,0,0,0x80,0x07,0,0,0,
-0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,
-0,0,0x3c,0,0,0,0,0,0x80,0x03,0,0,0,0,0,
-0,0xc0,0x01,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,
-0x3c,0,0,0,0,0,0x80,0x03,0,0,0,0,0,0,0xc0,
-0x01,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0x38,0,
-0,0,0,0,0xc0,0x03,0,0,0,0,0,0,0xc0,0x01,0,
-0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x3f,0,0,0x38,0,0,0,
-0,0,0xc0,0x01,0,0,0,0,0,0,0xc0,0x01,0,0,0xe0,
-0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x3f,0,0,0x38,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0x1f,0,0,0x38,0,0,0,0,0,0xe0,0,
-0,0,0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,0x07,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0,0,0x38,0,0,0,0,0,0xe0,0,0,0,
-0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,0x07,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0x1f,0,0,0x38,0,0,0,0,0,0xf0,0,0,0,0,0,
-0,0,0xc0,0x01,0,0,0x80,0xff,0xff,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,
-0,0x38,0,0,0,0,0,0x78,0,0,0,0,0,0,0,
-0xc0,0x03,0,0,0x80,0xff,0xff,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x38,
-0,0,0,0,0,0x78,0,0,0,0,0,0,0,0xc0,0x03,
-0,0,0,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x3c,0,0,
-0,0,0,0x3c,0,0,0,0,0,0,0,0x80,0x07,0,0,
-0,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x3c,0,0,0,0,
-0,0x3c,0,0,0,0,0,0,0,0x80,0x07,0,0,0,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0x07,0,0,0xfc,0x3f,0,0,0,0,0,0x3e,
-0,0,0,0,0,0,0,0x80,0x07,0,0,0,0xfe,0xff,0x1f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x0f,0,0xe0,0xff,0xff,0x3f,0,0,0,0,0,0x1e,0,0,
-0,0,0,0,0,0,0x0f,0,0,0,0xfe,0xff,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0xff,0x3f,0,0,0,0,0,0x0f,0,0,0,0,
-0,0,0,0,0x0f,0,0,0,0xfe,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0xff,0x0f,0x3c,0,0,0,0,0,0x0f,0,0,0,0,0,0,
-0,0,0x0e,0,0,0,0xfc,0xff,0x3f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,
-0x3c,0,0,0,0,0,0x0f,0,0,0,0,0,0,0,0,
-0x0e,0,0,0,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x01,0,0x38,0,
-0,0,0,0x80,0x07,0,0,0,0,0,0,0,0,0x1e,0,
-0,0,0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0xff,0xff,0,0,0,0x38,0,0,0,
-0,0x80,0x07,0,0,0,0,0,0,0,0,0x3c,0,0,0,
-0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0xff,0x03,0,0,0,0x38,0,0,0,0,0xc0,
-0x03,0,0,0,0,0,0,0,0,0x78,0,0,0,0xf8,0xff,
-0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0,0,0,0,0x78,0,0,0,0,0xc0,0x01,0,
-0,0,0,0,0,0,0,0x70,0,0,0,0xf8,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0x01,0,0,0,0,0x70,0,0,0,0,0xe0,0x01,0,0,0,
-0,0,0,0,0,0xf0,0x01,0,0,0xf0,0xff,0xff,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x01,0,
-0,0,0,0x70,0,0,0,0,0xe0,0x01,0,0,0,0,0,
-0,0,0,0xf0,0x01,0,0,0xf0,0xff,0xff,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xff,0xff,0x07,0,0xfe,0,0,
-0,0x70,0,0,0,0,0xe0,0,0,0,0,0,0,0,0,
-0,0xe0,0x03,0,0,0xf0,0xff,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0xff,0x1f,0,0xf8,0xff,0,0,0,0x70,
-0,0,0,0,0xf0,0,0,0,0,0,0,0,0,0,0xc0,
-0x03,0,0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0x7f,0,0xe0,0xff,0x7f,0,0,0,0x70,0,0,
-0,0,0xf8,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,
-0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0xff,0x03,0,0xf0,0xff,0x3f,0,0,0,0x70,0,0,0,0,
-0x78,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0xe0,
-0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,
-0x03,0,0xf0,0xff,0x3f,0,0,0,0x70,0,0,0,0,0x78,0,
-0,0,0,0,0,0,0,0,0,0x1f,0,0,0xe0,0xff,0xff,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0x7f,0,0,
-0xf8,0xff,0x3f,0,0,0,0x70,0,0,0,0,0x78,0,0,0,
-0,0,0,0,0,0,0,0x7c,0,0,0xe0,0xff,0xff,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x80,0xff,0x07,0,0,0xf8,0xff,
-0x1f,0,0,0,0xe0,0,0,0,0,0x3c,0,0,0,0,0,
-0,0,0,0,0,0xf8,0x01,0,0xe0,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xc0,0xff,0,0,0,0xfc,0xff,0x1f,0,
-0,0,0xe0,0,0,0,0,0x3c,0,0,0,0,0,0,0,
-0,0,0,0xe0,0x07,0,0xc0,0xff,0xff,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xc0,0x1f,0,0,0,0xfe,0xff,0x1f,0,0,0,
-0xe0,0,0,0,0,0x3c,0,0,0x60,0,0,0,0,0,0,
-0,0xc0,0x3f,0,0xc0,0xff,0xff,0x07,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0x1f,0,0,0,0xfe,0xff,0x1f,0,0,0,0xe0,0,
-0,0,0,0x3c,0,0,0x60,0,0,0,0,0,0,0,0xc0,
-0x3f,0,0xc0,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x80,0x03,0,0,0,0xfe,0xff,0x0f,0,0,0,0xe0,0,0,0,
-0,0x3e,0,0,0x70,0,0,0,0,0,0,0,0,0xff,0x01,
-0x80,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x0f,0,0,0,0xe0,0,0,0,0,0x3f,
-0,0,0x38,0,0,0,0,0,0,0,0,0xf8,0x3f,0x80,0xff,
-0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0,0,0,0xc0,0x01,0,0,0,0xff,0,0,
-0x38,0,0,0,0,0,0,0,0,0xc0,0xff,0,0xfc,0xff,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0x07,0,0,0,0xc0,0x01,0,0,0,0xf7,0x03,0,0x3c,0,
-0,0,0,0,0,0,0,0,0xff,0x0f,0xc0,0xff,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0x07,
-0,0,0,0xc0,0x01,0,0,0,0xf7,0x03,0,0x3c,0,0,0,
-0,0,0,0,0,0,0xff,0x0f,0xc0,0xff,0x0f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,
-0,0xc0,0x01,0,0,0x80,0xe3,0x0f,0,0x3f,0,0,0,0,0,
-0,0,0,0,0xf0,0x7f,0,0xf8,0x1f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,0,0xc0,
-0x01,0,0,0x80,0xe3,0xff,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0x03,0x80,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,0,0xc0,0x01,0,
-0,0x80,0xc3,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0xfe,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0x01,0,0,0,0xc0,0x01,0,0,0xc0,
-0x01,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0,0,0,0,0xc0,0x01,0,0,0xc0,0x01,0xfe,
-0x7f,0x38,0,0,0,0,0,0,0,0,0,0,0,0xfe,0x1f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0,0,0,0,0xc0,0x01,0,0,0xc0,0x01,0xfe,0x7f,0x38,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0x1f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0,0,0,0,0xc1,0x01,0,0,0xe0,0,0x3e,0,0x38,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0xff,0x01,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0,0,
-0,0x80,0xc3,0x01,0,0,0xe0,0,0x7c,0,0x3c,0,0,0,0,
-0,0,0,0,0,0,0,0,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0,0xf0,
-0xc3,0x01,0,0,0xf0,0,0xf0,0,0x3c,0,0,0,0,0,0,
-0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x7f,0,0,0,0xf8,0xc3,0x01,
-0,0,0xf0,0,0xe0,0x01,0x3c,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x7f,0,0,0,0xf8,0xc3,0x01,0,0,
-0xf0,0,0xe0,0x01,0x3c,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0xff,0x7f,0,0,0,0xff,0xc3,0x03,0,0,0x70,0,
-0xc0,0x03,0x3c,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0xff,0x3f,0,0,0x80,0xff,0xc3,0x03,0,0,0x70,0,0xc0,0x03,
-0x3c,0,0,0,0,0,0,0,0,0,0,0,0xf0,0x01,0,
-0xf0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,
-0x1f,0,0,0xe0,0xff,0xc3,0x03,0,0,0x78,0,0x80,0x07,0x3c,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0x7f,0,0,0,
-0xfc,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,
-0,0xf8,0xff,0xc3,0x03,0,0,0x78,0,0,0x0f,0x3c,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0x0f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,0,0xf8,
-0xff,0xc3,0x03,0,0,0x78,0,0,0x0f,0x3c,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0x0f,0,0,0xfe,0xff,0x83,
-0x03,0,0,0x3c,0,0,0x1e,0x1c,0,0,0,0,0,0,0,
-0,0xfc,0xff,0x01,0xe0,0xff,0xff,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0x0f,0,0x80,0xff,0xff,0x87,0x03,0,
-0,0x3c,0,0,0x3c,0x1c,0,0,0,0,0,0,0xf8,0xff,0xff,
-0xff,0xff,0xe1,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x0f,0,0xc0,0xff,0xff,0x87,0x03,0,0,0x3c,
-0,0,0x78,0x1c,0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0xff,
-0xe1,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0,0xf8,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,
-0xe0,0x1c,0,0,0,0x80,0xff,0xff,0xff,0x01,0,0,0,0xc0,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0x07,0,0xf8,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0xe0,0x1c,
-0,0,0,0x80,0xff,0xff,0xff,0x01,0,0,0,0xc0,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0x03,
-0,0xfe,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0xe0,0x1f,0,0,
-0,0xf0,0xff,0xff,0,0,0,0,0,0x80,0xff,0xff,0x07,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0xff,
-0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0x80,0x1f,0,0,0,0xff,
-0xff,0x03,0,0,0,0xfc,0x03,0x80,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,
-0xc7,0x03,0,0,0x1e,0,0,0,0x1f,0,0,0xf8,0xff,0x0f,0,
-0x80,0xff,0xff,0xff,0x1f,0,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0x01,0xf0,0xff,0xff,0xff,0xc3,0x03,
-0,0,0xfe,0xff,0,0,0x1f,0,0xe0,0xff,0x3f,0,0,0x80,0xff,
-0xff,0xff,0x3f,0,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0,0,
-0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0x80,0xff,0xff,0xff,
-0x7f,0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0,0,0xfe,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0x80,0xff,0xff,0xff,0x7f,0,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0xff,0x01,0xff,0xff,0xff,0xff,0x80,0x03,0,0,0xfe,0xff,0xff,0xff,
-0xff,0xff,0xff,0x07,0,0,0,0,0xfe,0xff,0xff,0xff,0x01,0xfe,0xff,
-0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0x80,0xff,0xff,0xff,0x3f,0,0,0,0,0x7c,0,0,0xf5,0xff,0xff,
-0x3f,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x07,0xfe,0xff,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0xf0,0xff,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0xff,0x1f,0xfe,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0xff,0xff,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0xff,0xff,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,
-0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0xff,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,
-0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0xff,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfc,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,
-0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,
-0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,
-0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0x1f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xf0,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,
-0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x0f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0xff,0x01,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0xff,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xe0,0xff,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0x3f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfe,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0x3f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0x7f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfe,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfc,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xc0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0x01,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfe,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf8,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x18,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x18,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-};
# define drift_opts xlockmore_opts
# define DEFAULTS "*count: 30 \n" \
"*delay: 10000 \n" \
- "*ncolors: 200 \n" \
- "*eraseSpeed: 400 \n" \
- "*eraseMode: -1 \n"
+ "*ncolors: 200 \n"
# define SMOOTH_COLORS
# include "xlockmore.h" /* from the xscreensaver distribution */
# include "erase.h"
* other special, indirect and consequential damages.
*
* Revision History:
+ * 22-Jan-98: jwz: made the flag wigglier; added xpm support.
+ * (I tried to do this by re-porting from xlockmore, but the
+ * current xlockmore version is completely inscrutable.)
* 13-May-97: jwz@netscape.com: turned into a standalone program.
* Made it able to animate arbitrary (runtime) text or bitmaps.
* 01-May-96: written.
# define DEF_TEXT ""
# include "xlockmore.h" /* from the xscreensaver distribution */
+# ifdef HAVE_XPM
+# include <X11/xpm.h>
+# ifndef PIXEL_ALREADY_TYPEDEFED
+# define PIXEL_ALREADY_TYPEDEFED /* Sigh, Xmu/Drawing.h needs this... */
+# endif
+# endif
+
#ifdef HAVE_XMU
# ifndef VMS
# include <X11/Xmu/Drawing.h>
# endif /* VMS */
#endif /* HAVE_XMU */
-#include "bob.xbm"
+#include "images/bob.xbm"
#else /* !STANDALONE */
# include "xlock.h" /* from the xlockmore distribution */
# include <sys/utsname.h>
#endif /* HAVE_UNAME */
+#ifdef STANDALONE
+static XrmOptionDescRec opts[] =
+{
+ { "-bitmap", ".flag.bitmap", XrmoptionSepArg, 0 }
+};
+
+#endif /* STANDALONE */
+
ModeSpecOpt flag_opts = {
- 0, NULL, 0, NULL, NULL };
+#ifdef STANDALONE
+ 1, opts, 0, NULL, NULL
+#else /* !STANDALONE */
+ 0, NULL, 0, NULL, NULL
+#endif /* STANDALONE */
+};
#include <string.h>
#include <X11/Xutil.h>
flagstruct *fp = &flags[MI_SCREEN(mi)];
int i;
+ /*-
+ * change the periodicity of the sin formula : the maximum of the
+ * periocity seem to be 16 ( 2^4 ), after the drawing isn't good looking
+ */
+ int periodicity = random_num(4);
+ int puissance = 1;
+
+ /* for (i=0;i<periodicity;i++) puissance*=2; */
+ puissance <<= periodicity;
for (i = 0; i < ANGLES; i++)
- fp->stab[i] = (int) (SINF(i * 4 * M_PI / ANGLES) * fp->samp) + fp->sofs;
+ fp->stab[i] = (int) (SINF(i * puissance * M_PI / ANGLES) * fp->samp) +
+ fp->sofs;
}
static void
fp->stab[(fp->sidx + x + y) % ANGLES];
yp = (int) (fp->size * (float) y) +
fp->stab[(fp->sidx + 4 * x + y + y) % ANGLES];
- if (XGetPixel(fp->image, x, y))
+
+ if (fp->image->depth > 1)
+ XSetForeground(display, MI_GC(mi),
+ XGetPixel(fp->image, x, y));
+ else if (XGetPixel(fp->image, x, y))
XSetForeground(display, MI_GC(mi), MI_WIN_BLACK_PIXEL(mi));
else if (MI_NPIXELS(mi) <= 2)
XSetForeground(display, MI_GC(mi), MI_WIN_WHITE_PIXEL(mi));
else
XSetForeground(display, MI_GC(mi),
MI_PIXEL(mi, (y + x + fp->sidx + fp->startcolor) % MI_NPIXELS(mi)));
+
if (fp->pointsize <= 1)
XDrawPoint(display, fp->cache, MI_GC(mi), xp, yp);
else if (fp->pointsize < 6)
*bitmap_name &&
!!strcmp(bitmap_name, "(default)"))
{
+#ifdef HAVE_XPM
+ Window window = MI_WINDOW(mi);
+ XWindowAttributes xgwa;
+ XpmAttributes xpmattrs;
+ int result;
+ Pixmap bitmap = 0;
+ int width = 0, height = 0;
+ xpmattrs.valuemask = 0;
+
+ XGetWindowAttributes (dpy, window, &xgwa);
+
+# ifdef XpmCloseness
+ xpmattrs.valuemask |= XpmCloseness;
+ xpmattrs.closeness = 40000;
+# endif
+# ifdef XpmVisual
+ xpmattrs.valuemask |= XpmVisual;
+ xpmattrs.visual = xgwa.visual;
+# endif
+# ifdef XpmDepth
+ xpmattrs.valuemask |= XpmDepth;
+ xpmattrs.depth = xgwa.depth;
+# endif
+# ifdef XpmColormap
+ xpmattrs.valuemask |= XpmColormap;
+ xpmattrs.colormap = xgwa.colormap;
+# endif
+
+ /* Uh, we don't need these now. We use the colors from the xpm.
+ It kinda sucks that we already allocated them. */
+ XFreeColors(dpy, xgwa.colormap, mi->pixels, mi->npixels, 0L);
+
+ result = XpmReadFileToPixmap (dpy, window, bitmap_name, &bitmap, 0,
+ &xpmattrs);
+ switch (result)
+ {
+ case XpmColorError:
+ fprintf (stderr, "%s: warning: xpm color substitution performed\n",
+ progname);
+ /* fall through */
+ case XpmSuccess:
+ width = xpmattrs.width;
+ height = xpmattrs.height;
+ break;
+ case XpmFileInvalid:
+ case XpmOpenFailed:
+ bitmap = 0;
+ break;
+ case XpmColorFailed:
+ fprintf (stderr, "%s: xpm: color allocation failed\n", progname);
+ exit (-1);
+ case XpmNoMemory:
+ fprintf (stderr, "%s: xpm: out of memory\n", progname);
+ exit (-1);
+ default:
+ fprintf (stderr, "%s: xpm: unknown error code %d\n", progname,
+ result);
+ exit (-1);
+ }
+
+ if (bitmap)
+ {
+ fp->image = XGetImage(dpy, bitmap, 0, 0, width, height, ~0L,
+ ZPixmap);
+ XFreePixmap(dpy, bitmap);
+ }
+ else
+#endif /* HAVE_XPM */
+
#ifdef HAVE_XMU
- int width, height, xh, yh;
- Pixmap bitmap =
- XmuLocateBitmapFile (DefaultScreenOfDisplay (dpy),
- bitmap_name, 0, 0, &width, &height, &xh, &yh);
- if (!bitmap)
{
- fprintf(stderr, "%s: unable to load bitmap file %s\n",
- progname, bitmap_name);
- exit (1);
+ int width, height, xh, yh;
+ Pixmap bitmap =
+ XmuLocateBitmapFile (DefaultScreenOfDisplay (dpy),
+ bitmap_name, 0, 0, &width, &height, &xh, &yh);
+ if (!bitmap)
+ {
+ fprintf(stderr, "%s: unable to load bitmap file %s\n",
+ progname, bitmap_name);
+ exit (1);
+ }
+ fp->image = XGetImage(dpy, bitmap, 0, 0, width, height,
+ 1L, XYPixmap);
+ XFreePixmap(dpy, bitmap);
}
- fp->image = XGetImage(dpy, bitmap, 0, 0, width, height,
- 1L, XYPixmap);
- XFreePixmap(dpy, bitmap);
#else /* !XMU */
fprintf (stderr,
# define DEFAULTS "*count: 100 \n" \
"*cycles: 200 \n" \
"*delay: 400000 \n" \
- "*ncolors: 100 \n" \
- "*eraseSpeed: 400 \n" \
- "*eraseMode: -1 \n"
+ "*ncolors: 100 \n"
# define UNIFORM_COLORS
# include "xlockmore.h" /* from the xscreensaver distribution */
# include "erase.h"
$(UTILS_SRC)/resources.o $(UTILS_SRC)/usleep.o \
$(UTILS_SRC)/visual.o $(UTILS_SRC)/yarandom.o
-SRCS = buildlwo.c escher.c gears.c morph3d.c pipeobjs.c pipes.c \
- s1_1.c s1_2.c s1_3.c s1_4.c s1_5.c s1_6.c s1_b.c \
- sproingies.c sproingiewrap.c superquadrics.c rubik.c \
- xlock-gl.c
-
-OBJS = buildlwo.o escher.o gears.o morph3d.o pipeobjs.o pipes.o \
- s1_1.o s1_2.o s1_3.o s1_4.o s1_5.o s1_6.o s1_b.o \
- sproingies.o sproingiewrap.o superquadrics.o rubik.o \
- xlock-gl.o
-
-GL_EXES = escher gears pipes sproingies superquadrics morph3d rubik
+SRCS = buildlwo.c cage.c gears.c moebius.c morph3d.c \
+ pipeobjs.c pipes.c rubik.c s1_1.c s1_2.c s1_3.c s1_4.c \
+ s1_5.c s1_6.c s1_b.c sproingies.c sproingiewrap.c stairs.c \
+ superquadrics.c xlock-gl.c
+
+OBJS = buildlwo.o cage.o gears.o moebius.o morph3d.o \
+ pipeobjs.o pipes.o rubik.o s1_1.o s1_2.o s1_3.o s1_4.o \
+ s1_5.o s1_6.o s1_b.o sproingies.o sproingiewrap.o stairs.o \
+ superquadrics.o xlock-gl.o
+
+GL_EXES = cage gears moebius pipes sproingies stairs superquadrics \
+ morph3d rubik
EXES = @GL_EXES@
HACK_OBJS = screenhack-gl.o xlock-gl.o $(HACK_BIN)/xlockmore.o \
-e 's@\.\./\.\./utils@$$(UTILS_SRC)@g' \
-e 's@\.\./glx/@@g' \
-e 's@ \.\./@ $$(HACK_SRC)/@g' \
- -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' ; \
+ -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \
+ -e 's@ $$(srcdir)/\(.*config.h\)@ \1@g' ; \
echo '' \
) > /tmp/distdepend.$$$$ && \
mv Makefile.in Makefile.in.bak && \
CC_HACK = $(CC) $(LDFLAGS)
-gears: gears.o $(HACK_OBJS)
+cage: cage.o $(HACK_OBJS)
$(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
-superquadrics: superquadrics.o $(HACK_OBJS)
+gears: gears.o $(HACK_OBJS)
$(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
-escher: escher.o $(HACK_OBJS)
+moebius: moebius.o $(HACK_OBJS)
$(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
pipes: pipes.o $(HACK_OBJS) pipeobjs.o buildlwo.o
$(CC_HACK) -o $@ $@.o $(HACK_OBJS) pipeobjs.o buildlwo.o \
$(HACK_LIBS)
+superquadrics: superquadrics.o $(HACK_OBJS)
+ $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
+
morph3d: morph3d.o $(HACK_OBJS)
$(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
rubik: rubik.o $(HACK_OBJS)
$(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
+stairs: stairs.o $(HACK_OBJS)
+ $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS)
+
SPROINGIES = sproingiewrap.o buildlwo.o \
s1_1.o s1_2.o s1_3.o s1_4.o s1_5.o s1_6.o s1_b.o
sproingies: sproingies.o $(HACK_OBJS) $(SPROINGIES)
# DO NOT DELETE: updated by make distdepend
buildlwo.o: $(srcdir)/buildlwo.h
-escher.o: $(HACK_SRC)/xlockmore.h
-escher.o: $(HACK_SRC)/../config.h
-escher.o: $(HACK_SRC)/xlockmoreI.h
-escher.o: $(HACK_SRC)/screenhack.h
-escher.o: $(UTILS_SRC)/yarandom.h
-escher.o: $(UTILS_SRC)/usleep.h
-escher.o: $(UTILS_SRC)/resources.h
-escher.o: $(UTILS_SRC)/hsv.h
-escher.o: $(UTILS_SRC)/colors.h
-escher.o: $(UTILS_SRC)/grabscreen.h
-escher.o: $(UTILS_SRC)/visual.h
-escher.o: $(srcdir)/e_textures.h
+cage.o: $(HACK_SRC)/xlockmore.h
+cage.o: $(HACK_SRC)/../config.h
+cage.o: $(HACK_SRC)/xlockmoreI.h
+cage.o: $(HACK_SRC)/screenhack.h
+cage.o: $(UTILS_SRC)/yarandom.h
+cage.o: $(UTILS_SRC)/usleep.h
+cage.o: $(UTILS_SRC)/resources.h
+cage.o: $(UTILS_SRC)/hsv.h
+cage.o: $(UTILS_SRC)/colors.h
+cage.o: $(UTILS_SRC)/grabscreen.h
+cage.o: $(UTILS_SRC)/visual.h
+cage.o: $(srcdir)/e_textures.h
gears.o: $(HACK_SRC)/xlockmore.h
gears.o: $(HACK_SRC)/../config.h
gears.o: $(HACK_SRC)/xlockmoreI.h
gears.o: $(UTILS_SRC)/colors.h
gears.o: $(UTILS_SRC)/grabscreen.h
gears.o: $(UTILS_SRC)/visual.h
+moebius.o: $(HACK_SRC)/xlockmore.h
+moebius.o: $(HACK_SRC)/../config.h
+moebius.o: $(HACK_SRC)/xlockmoreI.h
+moebius.o: $(HACK_SRC)/screenhack.h
+moebius.o: $(UTILS_SRC)/yarandom.h
+moebius.o: $(UTILS_SRC)/usleep.h
+moebius.o: $(UTILS_SRC)/resources.h
+moebius.o: $(UTILS_SRC)/hsv.h
+moebius.o: $(UTILS_SRC)/colors.h
+moebius.o: $(UTILS_SRC)/grabscreen.h
+moebius.o: $(UTILS_SRC)/visual.h
+moebius.o: $(srcdir)/e_textures.h
morph3d.o: $(HACK_SRC)/xlockmore.h
morph3d.o: $(HACK_SRC)/../config.h
morph3d.o: $(HACK_SRC)/xlockmoreI.h
pipes.o: $(UTILS_SRC)/grabscreen.h
pipes.o: $(UTILS_SRC)/visual.h
pipes.o: $(srcdir)/buildlwo.h
+rubik.o: $(HACK_SRC)/xlockmore.h
+rubik.o: $(HACK_SRC)/../config.h
+rubik.o: $(HACK_SRC)/xlockmoreI.h
+rubik.o: $(HACK_SRC)/screenhack.h
+rubik.o: $(UTILS_SRC)/yarandom.h
+rubik.o: $(UTILS_SRC)/usleep.h
+rubik.o: $(UTILS_SRC)/resources.h
+rubik.o: $(UTILS_SRC)/hsv.h
+rubik.o: $(UTILS_SRC)/colors.h
+rubik.o: $(UTILS_SRC)/grabscreen.h
+rubik.o: $(UTILS_SRC)/visual.h
s1_1.o: $(srcdir)/buildlwo.h
s1_2.o: $(srcdir)/buildlwo.h
s1_3.o: $(srcdir)/buildlwo.h
sproingiewrap.o: $(UTILS_SRC)/colors.h
sproingiewrap.o: $(UTILS_SRC)/grabscreen.h
sproingiewrap.o: $(UTILS_SRC)/visual.h
+stairs.o: $(HACK_SRC)/xlockmore.h
+stairs.o: $(HACK_SRC)/../config.h
+stairs.o: $(HACK_SRC)/xlockmoreI.h
+stairs.o: $(HACK_SRC)/screenhack.h
+stairs.o: $(UTILS_SRC)/yarandom.h
+stairs.o: $(UTILS_SRC)/usleep.h
+stairs.o: $(UTILS_SRC)/resources.h
+stairs.o: $(UTILS_SRC)/hsv.h
+stairs.o: $(UTILS_SRC)/colors.h
+stairs.o: $(UTILS_SRC)/grabscreen.h
+stairs.o: $(UTILS_SRC)/visual.h
+stairs.o: $(srcdir)/e_textures.h
superquadrics.o: $(HACK_SRC)/xlockmore.h
superquadrics.o: $(HACK_SRC)/../config.h
superquadrics.o: $(HACK_SRC)/xlockmoreI.h
superquadrics.o: $(UTILS_SRC)/colors.h
superquadrics.o: $(UTILS_SRC)/grabscreen.h
superquadrics.o: $(UTILS_SRC)/visual.h
-rubik.o: $(HACK_SRC)/xlockmore.h
-rubik.o: $(HACK_SRC)/../config.h
-rubik.o: $(HACK_SRC)/xlockmoreI.h
-rubik.o: $(HACK_SRC)/screenhack.h
-rubik.o: $(UTILS_SRC)/yarandom.h
-rubik.o: $(UTILS_SRC)/usleep.h
-rubik.o: $(UTILS_SRC)/resources.h
-rubik.o: $(UTILS_SRC)/hsv.h
-rubik.o: $(UTILS_SRC)/colors.h
-rubik.o: $(UTILS_SRC)/grabscreen.h
-rubik.o: $(UTILS_SRC)/visual.h
xlock-gl.o: $(HACK_SRC)/screenhack.h
xlock-gl.o: $(HACK_SRC)/../config.h
xlock-gl.o: $(UTILS_SRC)/yarandom.h
-This directory contains various graphics hacks that requre GL. These are
-independent from the xscreensaver program (in the ../../driver/ directory)
+This directory contains various graphics hacks that requre OpenGL. These are
+independent from the xscreensaver program (in the ../../driver/ directory)
but some of them use the utility functions found in the ../../utils/ directory.
If you have compilation problems, check the parameters in ../../config.h.
+
+If you're looking for a free implementation of the OpenGL library, check
+out <http://www.ssec.wisc.edu/~brianp/Mesa.html>. For general OpenGL info,
+see <http://www.opengl.org/>.
--- /dev/null
+/* -*- Mode: C; tab-width: 4 -*- */
+/* cage --- the Impossible Cage, an Escher like scene. */
+
+#if !defined( lint ) && !defined( SABER )
+static const char sccsid[] = "@(#)cage.c 4.07 98/01/04 xlockmore";
+
+#endif
+
+#undef DEBUG_LISTS
+
+/*-
+ * Permission to use, copy, modify, and distribute this software and its
+ * documentation for any purpose and without fee is hereby granted,
+ * provided that the above copyright notice appear in all copies and that
+ * both that copyright notice and this permission notice appear in
+ * supporting documentation.
+ *
+ * This file is provided AS IS with no warranties of any kind. The author
+ * shall have no liability with respect to the infringement of copyrights,
+ * trade secrets or any patents by this file or any part thereof. In no
+ * event will the author be liable for any lost revenue or profits or
+ * other special, indirect and consequential damages.
+ *
+ * The RotateAroundU() routine was adapted from the book
+ * "Computer Graphics Principles and Practice
+ * Foley - vanDam - Feiner - Hughes
+ * Second Edition" Pag. 227, exercise 5.15.
+ *
+ * This mode shows some interesting scenes that are impossible OR very
+ * wierd to build in the real universe. Much of the scenes are inspirated
+ * on Mauritz Cornelis Escher's works which derivated the mode's name.
+ * M.C. Escher (1898-1972) was a dutch artist and many people prefer to
+ * say he was a mathematician.
+ *
+ * Thanks goes to Brian Paul for making it possible and inexpensive to use
+ * OpenGL at home.
+ *
+ * Since I'm not a native English speaker, my apologies for any grammatical
+ * mistake.
+ *
+ * My e-mail addresses are
+ * vianna@cat.cbpf.br
+ * and
+ * m-vianna@usa.net
+ *
+ * Marcelo F. Vianna (Jun-01-1997)
+ *
+ * Revision History:
+ * 01-Jan-98: Mode separated from escher and renamed
+ * 08-Jun-97: New scene implemented: "Impossible Cage" based in a M.C. Escher's
+ * painting with the same name (quite similar). The first GL mode
+ * to use texture mapping.
+ * The "Impossible Cage" scene doesn't use DEPTH BUFFER, the
+ * wood planks are drawn consistently using GL_CULL_FACE, and
+ * the painter's algorithm is used to sort the planks.
+ * Marcelo F. Vianna.
+ * 07-Jun-97: Speed ups in Moebius Strip using GL_CULL_FACE.
+ * Marcelo F. Vianna.
+ * 03-Jun-97: Initial Release (Only one scene: "Moebius Strip")
+ * The Moebius Strip scene was inspirated in a M.C. Escher's
+ * painting named Moebius Strip II in wich ants walk across a
+ * Moebius Strip path, sometimes meeting each other and sometimes
+ * being in "opposite faces" (note that the moebius strip has
+ * only one face and one edge).
+ * Marcelo F. Vianna.
+ *
+ */
+
+/*-
+ * Texture mapping is only available on RGBA contexts, Mono and color index
+ * visuals DO NOT support texture mapping in OpenGL.
+ *
+ * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture
+ * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono
+ * is not officially supported for both OpenGL and Mesa, but seems to not crash
+ * Mesa.
+ *
+ * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know).
+ */
+
+#include <X11/Intrinsic.h>
+
+#ifdef STANDALONE
+# define PROGCLASS "Cage"
+# define HACK_INIT init_cage
+# define HACK_DRAW draw_cage
+# define cage_opts xlockmore_opts
+# define DEFAULTS "*cycles: 1 \n" \
+ "*delay: 1000 \n" \
+ "*wireframe: False \n"
+# include "xlockmore.h" /* from the xscreensaver distribution */
+#else /* !STANDALONE */
+# include "xlock.h" /* from the xlockmore distribution */
+
+#endif /* !STANDALONE */
+
+#ifdef USE_GL
+
+
+#include <GL/glu.h>
+#include "e_textures.h"
+
+ModeSpecOpt cage_opts =
+{0, NULL, 0, NULL, NULL};
+
+#ifdef USE_MODULES
+ModStruct cage_description =
+{"cage", "init_cage", "draw_cage", "release_cage",
+ "draw_cage", "change_cage", NULL, &cage_opts,
+ 1000, 1, 1, 1, 1.0, "",
+ "Shows the Impossible Cage, an Escher-like GL scene", 0, NULL};
+
+#endif
+
+#define Scale4Window 0.3
+#define Scale4Iconic 0.4
+
+#define sqr(A) ((A)*(A))
+
+#ifndef Pi
+#define Pi M_PI
+#endif
+
+/*************************************************************************/
+
+typedef struct {
+ GLint WindH, WindW;
+ GLfloat step;
+ int AreObjectsDefined[1];
+ GLXContext *glx_context;
+} cagestruct;
+
+static float front_shininess[] =
+{60.0};
+static float front_specular[] =
+{0.7, 0.7, 0.7, 1.0};
+static float ambient[] =
+{0.0, 0.0, 0.0, 1.0};
+static float diffuse[] =
+{1.0, 1.0, 1.0, 1.0};
+static float position0[] =
+{1.0, 1.0, 1.0, 0.0};
+static float position1[] =
+{-1.0, -1.0, 1.0, 0.0};
+static float lmodel_ambient[] =
+{0.5, 0.5, 0.5, 1.0};
+static float lmodel_twoside[] =
+{GL_TRUE};
+
+static float MaterialWhite[] =
+{0.7, 0.7, 0.7, 1.0};
+
+static cagestruct *cage = NULL;
+static GLuint objects;
+
+#define ObjWoodPlank 0
+
+#define PlankWidth 3.0
+#define PlankHeight 0.35
+#define PlankThickness 0.15
+
+static void
+draw_woodplank(cagestruct * cp)
+{
+ if (!cp->AreObjectsDefined[ObjWoodPlank]) {
+ glNewList(objects + ObjWoodPlank, GL_COMPILE_AND_EXECUTE);
+ glBegin(GL_QUADS);
+ glNormal3f(0, 0, 1);
+ glTexCoord2f(0, 0);
+ glVertex3f(-PlankWidth, -PlankHeight, PlankThickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(PlankWidth, -PlankHeight, PlankThickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(PlankWidth, PlankHeight, PlankThickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-PlankWidth, PlankHeight, PlankThickness);
+ glNormal3f(0, 0, -1);
+ glTexCoord2f(0, 0);
+ glVertex3f(-PlankWidth, PlankHeight, -PlankThickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(PlankWidth, PlankHeight, -PlankThickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(PlankWidth, -PlankHeight, -PlankThickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness);
+ glNormal3f(0, 1, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(-PlankWidth, PlankHeight, PlankThickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(PlankWidth, PlankHeight, PlankThickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(PlankWidth, PlankHeight, -PlankThickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-PlankWidth, PlankHeight, -PlankThickness);
+ glNormal3f(0, -1, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(PlankWidth, -PlankHeight, -PlankThickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(PlankWidth, -PlankHeight, PlankThickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-PlankWidth, -PlankHeight, PlankThickness);
+ glNormal3f(1, 0, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(PlankWidth, -PlankHeight, PlankThickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(PlankWidth, -PlankHeight, -PlankThickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(PlankWidth, PlankHeight, -PlankThickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(PlankWidth, PlankHeight, PlankThickness);
+ glNormal3f(-1, 0, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(-PlankWidth, PlankHeight, PlankThickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(-PlankWidth, PlankHeight, -PlankThickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-PlankWidth, -PlankHeight, PlankThickness);
+ glEnd();
+ glEndList();
+ cp->AreObjectsDefined[ObjWoodPlank] = 1;
+#ifdef DEBUG_LISTS
+ (void) printf("WoodPlank drawn SLOWLY\n");
+#endif
+ } else {
+ glCallList(objects + ObjWoodPlank);
+#ifdef DEBUG_LISTS
+ (void) printf("WoodPlank drawn quickly\n");
+#endif
+ }
+}
+
+static void
+draw_impossiblecage(cagestruct * cp)
+{
+ glPushMatrix();
+ glRotatef(90, 0, 1, 0);
+ glTranslatef(0.0, PlankHeight - PlankWidth, -PlankThickness - PlankWidth);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 0, 1);
+ glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - PlankThickness);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 1, 0);
+ glTranslatef(0.0, PlankWidth - PlankHeight, -PlankThickness - PlankWidth);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glTranslatef(0.0, PlankWidth - PlankHeight, 3 * PlankThickness - PlankWidth);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 0, 1);
+ glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - PlankThickness);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - 3 * PlankThickness);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glTranslatef(0.0, PlankHeight - PlankWidth, 3 * PlankThickness - PlankWidth);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 0, 1);
+ glTranslatef(0.0, PlankHeight - PlankWidth, PlankThickness - PlankWidth);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - 3 * PlankThickness);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 1, 0);
+ glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth + PlankThickness);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 0, 1);
+ glTranslatef(0.0, PlankWidth - PlankHeight, PlankThickness - PlankWidth);
+ draw_woodplank(cp);
+ glPopMatrix();
+ glPushMatrix();
+ glRotatef(90, 0, 1, 0);
+ glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth + PlankThickness);
+ draw_woodplank(cp);
+ glPopMatrix();
+}
+
+static void
+reshape(ModeInfo * mi, int width, int height)
+{
+ cagestruct *cp = &cage[MI_SCREEN(mi)];
+
+ glViewport(0, 0, cp->WindW = (GLint) width, cp->WindH = (GLint) height);
+ glMatrixMode(GL_PROJECTION);
+ glLoadIdentity();
+ glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0);
+ glMatrixMode(GL_MODELVIEW);
+ if (width >= 1024) {
+ glLineWidth(3);
+ glPointSize(3);
+ } else if (width >= 512) {
+ glLineWidth(2);
+ glPointSize(2);
+ } else {
+ glLineWidth(1);
+ glPointSize(1);
+ }
+ cp->AreObjectsDefined[ObjWoodPlank] = 0;
+}
+
+static void
+pinit(void)
+{
+ glClearDepth(1.0);
+ glClearColor(0.0, 0.0, 0.0, 1.0);
+
+ glLightfv(GL_LIGHT0, GL_AMBIENT, ambient);
+ glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse);
+ glLightfv(GL_LIGHT0, GL_POSITION, position0);
+ glLightfv(GL_LIGHT1, GL_AMBIENT, ambient);
+ glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse);
+ glLightfv(GL_LIGHT1, GL_POSITION, position1);
+ glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient);
+ glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside);
+ glEnable(GL_LIGHTING);
+ glEnable(GL_LIGHT0);
+ glEnable(GL_LIGHT1);
+ glEnable(GL_NORMALIZE);
+ glFrontFace(GL_CCW);
+ glCullFace(GL_BACK);
+
+ /* cage */
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
+ glShadeModel(GL_FLAT);
+ glDisable(GL_DEPTH_TEST);
+ glEnable(GL_TEXTURE_2D);
+ glEnable(GL_CULL_FACE);
+
+ glPixelStorei(GL_UNPACK_ALIGNMENT, 1);
+ gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight,
+ GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData);
+ glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST);
+
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess);
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular);
+}
+
+void
+init_cage(ModeInfo * mi)
+{
+ int screen = MI_SCREEN(mi);
+ cagestruct *cp;
+
+ if (cage == NULL) {
+ if ((cage = (cagestruct *) calloc(MI_NUM_SCREENS(mi),
+ sizeof (cagestruct))) == NULL)
+ return;
+ }
+ cp = &cage[screen];
+ cp->step = NRAND(90);
+
+ if ((cp->glx_context = init_GL(mi)) != NULL) {
+
+ reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ glDrawBuffer(GL_BACK);
+ if (!glIsList(objects))
+ objects = glGenLists(1);
+ pinit();
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
+}
+
+void
+draw_cage(ModeInfo * mi)
+{
+ cagestruct *cp = &cage[MI_SCREEN(mi)];
+
+ Display *display = MI_DISPLAY(mi);
+ Window window = MI_WINDOW(mi);
+
+ if (!cp->glx_context)
+ return;
+
+ glXMakeCurrent(display, window, *(cp->glx_context));
+
+ glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
+
+ glPushMatrix();
+
+ glTranslatef(0.0, 0.0, -10.0);
+
+ if (!MI_WIN_IS_ICONIC(mi)) {
+ glScalef(Scale4Window * cp->WindH / cp->WindW, Scale4Window, Scale4Window);
+ } else {
+ glScalef(Scale4Iconic * cp->WindH / cp->WindW, Scale4Iconic, Scale4Iconic);
+ }
+
+ /* cage */
+ glRotatef(cp->step * 100, 0, 0, 1);
+ glRotatef(25 + cos(cp->step * 5) * 6, 1, 0, 0);
+ glRotatef(204.5 - sin(cp->step * 5) * 8, 0, 1, 0);
+ draw_impossiblecage(cp);
+
+ glPopMatrix();
+
+ glFlush();
+
+ glXSwapBuffers(display, window);
+
+ cp->step += 0.025;
+}
+
+void
+change_cage(ModeInfo * mi)
+{
+ cagestruct *cp = &cage[MI_SCREEN(mi)];
+
+ if (!cp->glx_context)
+ return;
+
+ glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(cp->glx_context));
+ pinit();
+}
+
+void
+release_cage(ModeInfo * mi)
+{
+ if (cage != NULL) {
+ (void) free((void *) cage);
+ cage = NULL;
+ }
+ if (glIsList(objects)) {
+ glDeleteLists(objects, 1);
+ }
+ FreeAllGL(mi);
+}
+
+#endif
+++ /dev/null
-/* -*- Mode: C; tab-width: 4 -*-
- * escher.c - Shows some Escher like scenes
- */
-#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)escher.c 4.04 97/07/28 xlockmore";
-#endif
-
-#undef DEBUG_LISTS
-
-/* Permission to use, copy, modify, and distribute this software and its
- * documentation for any purpose and without fee is hereby granted,
- * provided that the above copyright notice appear in all copies and that
- * both that copyright notice and this permission notice appear in
- * supporting documentation.
- *
- * This file is provided AS IS with no warranties of any kind. The author
- * shall have no liability with respect to the infringement of copyrights,
- * trade secrets or any patents by this file or any part thereof. In no
- * event will the author be liable for any lost revenue or profits or
- * other special, indirect and consequential damages.
- *
- * The RotateAroundU() routine was adapted from the book
- * "Computer Graphics Principles and Practice
- * Foley - vanDam - Feiner - Hughes
- * Second Edition" Pag. 227, exercise 5.15.
- *
- * This mode shows some interesting scenes that are impossible OR very
- * wierd to build in the real universe. Much of the scenes are inspirated
- * on Mauritz Cornelis Escher's works which derivated the mode's name.
- * M.C. Escher (1898-1972) was a dutch artist and many people prefer to
- * say he was a mathematician.
- *
- * Thanks goes to Brian Paul for making it possible and inexpensive to use
- * OpenGL at home.
- *
- * Since I'm not a native english speaker, my apologies for any gramatical
- * mistake.
- *
- * My e-mail addresses are
- * vianna@cat.cbpf.br
- * and
- * marcelo@venus.rdc.puc-rio.br
- *
- * Marcelo F. Vianna (Jun-01-1997)
- *
- * Revision History:
- * 08-Jun-97: New scene implemented: "Impossible Cage" based in a M.C. Escher's
- * painting with the same name (quite similar). The first GL mode
- * to use texture mapping.
- * The "Impossible Cage" scene doesn't use DEPTH BUFFER, the
- * wood planks are drawn consistently using GL_CULL_FACE, and
- * the painter's algorithm is used to sort the planks.
- * Marcelo F. Vianna.
- * 07-Jun-97: Speed ups in Moebius Strip using GL_CULL_FACE.
- * Marcelo F. Vianna.
- * 03-Jun-97: Initial Release (Only one scene: "Moebius Strip")
- * The Moebious Strip scene was inspirated in a M.C. Escher's
- * painting named Moebius Strip II in wich ants walk across a
- * Moebius Strip path, sometimes meeting each other and sometimes
- * being in "opposite faces" (note that the moebius strip has
- * only one face and one edge).
- * Marcelo F. Vianna.
- *
- */
-
-/*-
- * Texture mapping is only available on RGBA contexts, Mono and color index
- * visuals DO NOT support texture mapping in OpenGL.
- *
- * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture
- * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono
- * is not officially supported for both OpenGL and Mesa, but seems to not crash
- * Mesa.
- *
- * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know).
- */
-
-#include <X11/Intrinsic.h>
-
-#ifdef STANDALONE
-# define PROGCLASS "Escher"
-# define HACK_INIT init_escher
-# define HACK_DRAW draw_escher
-# define escher_opts xlockmore_opts
-# define DEFAULTS "*count: 0 \n" \
- "*cycles: 1 \n" \
- "*delay: 100 \n" \
- "*wireframe: False \n"
-# include "xlockmore.h" /* from the xscreensaver distribution */
-#else /* !STANDALONE */
-# include "xlock.h" /* from the xlockmore distribution */
-#endif /* !STANDALONE */
-
-
-#ifdef USE_GL
-
-
-#include <GL/glu.h>
-#include "e_textures.h"
-
-#define DEF_SOLIDMOEBIUS "False"
-#define DEF_NOANTS "False"
-
-static int solidmoebius;
-static int noants;
-
-static XrmOptionDescRec opts[] =
-{
- {"-solidmoebius", ".escher.solidmoebius", XrmoptionNoArg, (caddr_t) "on"},
- {"+solidmoebius", ".escher.solidmoebius", XrmoptionNoArg, (caddr_t) "off"},
- {"-noants", ".escher.noants", XrmoptionNoArg, (caddr_t) "on"},
- {"+noants", ".escher.noants", XrmoptionNoArg, (caddr_t) "off"}
-};
-static argtype vars[] =
-{
- {(caddr_t *) & solidmoebius, "solidmoebius", "Solidmoebius", DEF_SOLIDMOEBIUS, t_Bool},
- {(caddr_t *) & noants, "noants", "Noants", DEF_NOANTS, t_Bool}
-};
-static OptionStruct desc[] =
-{
- {"-/+solidmoebius", "select between a SOLID or a NET Moebius Strip"},
- {"-/+noants", "turn on/off walking ants"}
-};
-
-ModeSpecOpt escher_opts =
-{4, opts, 2, vars, desc};
-
-#define Scale4Window 0.3
-#define Scale4Iconic 0.4
-
-#define sqr(A) ((A)*(A))
-
-#ifndef Pi
-#define Pi M_PI
-#endif
-
-/*************************************************************************/
-
-typedef struct {
- GLint WindH, WindW;
- GLfloat step;
- GLfloat ant_position;
- int scene;
- int AreObjectsDefined[3];
- GLXContext glx_context;
-} escherstruct;
-
-static float front_shininess[] =
-{60.0};
-static float front_specular[] =
-{0.7, 0.7, 0.7, 1.0};
-static float ambient[] =
-{0.0, 0.0, 0.0, 1.0};
-static float diffuse[] =
-{1.0, 1.0, 1.0, 1.0};
-static float position0[] =
-{1.0, 1.0, 1.0, 0.0};
-static float position1[] =
-{-1.0, -1.0, 1.0, 0.0};
-static float lmodel_ambient[] =
-{0.5, 0.5, 0.5, 1.0};
-static float lmodel_twoside[] =
-{GL_TRUE};
-
-static float MaterialRed[] =
-{0.7, 0.0, 0.0, 1.0};
-static float MaterialGreen[] =
-{0.1, 0.5, 0.2, 1.0};
-static float MaterialBlue[] =
-{0.0, 0.0, 0.7, 1.0};
-static float MaterialCyan[] =
-{0.2, 0.5, 0.7, 1.0};
-static float MaterialYellow[] =
-{0.7, 0.7, 0.0, 1.0};
-static float MaterialMagenta[] =
-{0.6, 0.2, 0.5, 1.0};
-static float MaterialWhite[] =
-{0.7, 0.7, 0.7, 1.0};
-static float MaterialGray[] =
-{0.2, 0.2, 0.2, 1.0};
-
-static escherstruct *escher = NULL;
-static GLuint objects;
-
-#define NUM_SCENES 2
-
-#define ObjMoebiusStrip 0
-#define ObjAntBody 1
-#define ObjWoodPlank 2
-
-#define PlankWidth 3.0
-#define PlankHeight 0.35
-#define PlankThickness 0.15
-
-static void
-mySphere(float radius)
-{
- GLUquadricObj *quadObj;
-
- quadObj = gluNewQuadric();
- gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL);
- gluSphere(quadObj, radius, 16, 16);
- gluDeleteQuadric(quadObj);
-}
-
-static void
-myCone(float radius)
-{
- GLUquadricObj *quadObj;
-
- quadObj = gluNewQuadric();
- gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL);
- gluCylinder(quadObj, radius, 0, radius * 3, 8, 1);
- gluDeleteQuadric(quadObj);
-}
-
-static void
-draw_escher_ant(escherstruct * ep, float *Material)
-{
- static float ant_step = 0;
- float cos1 = cos(ant_step);
- float cos2 = cos(ant_step + 2 * Pi / 3);
- float cos3 = cos(ant_step + 4 * Pi / 3);
- float sin1 = sin(ant_step);
- float sin2 = sin(ant_step + 2 * Pi / 3);
- float sin3 = sin(ant_step + 4 * Pi / 3);
-
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, Material);
- if (!ep->AreObjectsDefined[ObjAntBody]) {
- glNewList(objects + ObjAntBody, GL_COMPILE_AND_EXECUTE);
- glEnable(GL_CULL_FACE);
- glPushMatrix();
- glScalef(1, 1.3, 1);
- mySphere(0.18);
- glScalef(1, 1 / 1.3, 1);
- glTranslatef(0.00, 0.30, 0.00);
- mySphere(0.2);
-
- glTranslatef(-0.05, 0.17, 0.05);
- glRotatef(-90, 1, 0, 0);
- glRotatef(-25, 0, 1, 0);
- myCone(0.05);
- glTranslatef(0.00, 0.10, 0.00);
- myCone(0.05);
- glRotatef(25, 0, 1, 0);
- glRotatef(90, 1, 0, 0);
-
- glScalef(1, 1.3, 1);
- glTranslatef(0.15, -0.65, 0.05);
- mySphere(0.25);
- glScalef(1, 1 / 1.3, 1);
- glPopMatrix();
- glDisable(GL_CULL_FACE);
- glEndList();
- ep->AreObjectsDefined[ObjAntBody] = 1;
-#ifdef DEBUG_LISTS
- (void) printf("Ant drawn SLOWLY\n");
-#endif
- } else {
- glCallList(objects + ObjAntBody);
-#ifdef DEBUG_LISTS
- (void) printf("Ant drawn quickly\n");
-#endif
- }
-
- glDisable(GL_LIGHTING);
- /* ANTENNAS */
- glBegin(GL_LINES);
- glColor3fv(Material);
- glVertex3f(0.00, 0.30, 0.00);
- glColor3fv(MaterialGray);
- glVertex3f(0.40, 0.70, 0.40);
- glColor3fv(Material);
- glVertex3f(0.00, 0.30, 0.00);
- glColor3fv(MaterialGray);
- glVertex3f(0.40, 0.70, -0.40);
- glEnd();
- glBegin(GL_POINTS);
- glColor3fv(MaterialRed);
- glVertex3f(0.40, 0.70, 0.40);
- glVertex3f(0.40, 0.70, -0.40);
- glEnd();
-
- /* LEFT-FRONT ARM */
- glBegin(GL_LINE_STRIP);
- glColor3fv(Material);
- glVertex3f(0.00, 0.05, 0.18);
- glVertex3f(0.35 + 0.05 * cos1, 0.15, 0.25);
- glColor3fv(MaterialGray);
- glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45);
- glEnd();
-
- /* LEFT-CENTER ARM */
- glBegin(GL_LINE_STRIP);
- glColor3fv(Material);
- glVertex3f(0.00, 0.00, 0.18);
- glVertex3f(0.35 + 0.05 * cos2, 0.00, 0.25);
- glColor3fv(MaterialGray);
- glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45);
- glEnd();
-
- /* LEFT-BACK ARM */
- glBegin(GL_LINE_STRIP);
- glColor3fv(Material);
- glVertex3f(0.00, -0.05, 0.18);
- glVertex3f(0.35 + 0.05 * cos3, -0.15, 0.25);
- glColor3fv(MaterialGray);
- glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45);
- glEnd();
-
- /* RIGHT-FRONT ARM */
- glBegin(GL_LINE_STRIP);
- glColor3fv(Material);
- glVertex3f(0.00, 0.05, -0.18);
- glVertex3f(0.35 - 0.05 * sin1, 0.15, -0.25);
- glColor3fv(MaterialGray);
- glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45);
- glEnd();
-
- /* RIGHT-CENTER ARM */
- glBegin(GL_LINE_STRIP);
- glColor3fv(Material);
- glVertex3f(0.00, 0.00, -0.18);
- glVertex3f(0.35 - 0.05 * sin2, 0.00, -0.25);
- glColor3fv(MaterialGray);
- glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45);
- glEnd();
-
- /* RIGHT-BACK ARM */
- glBegin(GL_LINE_STRIP);
- glColor3fv(Material);
- glVertex3f(0.00, -0.05, -0.18);
- glVertex3f(0.35 - 0.05 * sin3, -0.15, -0.25);
- glColor3fv(MaterialGray);
- glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45);
- glEnd();
-
- glBegin(GL_POINTS);
- glColor3fv(MaterialMagenta);
- glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45);
- glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45);
- glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45);
- glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45);
- glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45);
- glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45);
- glEnd();
-
- glEnable(GL_LIGHTING);
-
- ant_step += 0.3;
-}
-
-static void
-RotateAaroundU(float Ax, float Ay, float Az,
- float Ux, float Uy, float Uz,
- float *Cx, float *Cy, float *Cz,
- float Theta)
-{
- float cosO = cos(Theta);
- float sinO = sin(Theta);
- float one_cosO = 1 - cosO;
- float Ux2 = sqr(Ux);
- float Uy2 = sqr(Uy);
- float Uz2 = sqr(Uz);
- float UxUy = Ux * Uy;
- float UxUz = Ux * Uz;
- float UyUz = Uy * Uz;
-
- *Cx = (Ux2 + cosO * (1 - Ux2)) * Ax + (UxUy * one_cosO - Uz * sinO) * Ay + (UxUz * one_cosO + Uy * sinO) * Az;
- *Cy = (UxUy * one_cosO + Uz * sinO) * Ax + (Uy2 + cosO * (1 - Uy2)) * Ay + (UyUz * one_cosO - Ux * sinO) * Az;
- *Cz = (UxUz * one_cosO - Uy * sinO) * Ax + (UyUz * one_cosO + Ux * sinO) * Ay + (Uz2 + cosO * (1 - Uz2)) * Az;
-}
-
-#define MoebiusDivisions 40
-#define MoebiusTransversals 4
-static void
-draw_moebius(ModeInfo * mi)
-{
- GLfloat Phi, Theta;
- GLfloat cPhi, sPhi;
- escherstruct *ep = &escher[MI_SCREEN(mi)];
- int i, j;
-
- float Cx, Cy, Cz;
-
- if (!ep->AreObjectsDefined[ObjMoebiusStrip]) {
- glNewList(objects + ObjMoebiusStrip, GL_COMPILE_AND_EXECUTE);
-
- if (solidmoebius) {
- glBegin(GL_QUAD_STRIP);
- Phi = 0;
- i = 0;
- while (i < (MoebiusDivisions * 2 + 1)) {
- Theta = Phi / 2;
- cPhi = cos(Phi);
- sPhi = sin(Phi);
-
- i++;
- if (i % 2)
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed);
- else
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray);
-
- RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
- glNormal3f(Cx, Cy, Cz);
- RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
- glVertex3f(cPhi * 3 + Cx, sPhi * 3 + Cy, +Cz);
- glVertex3f(cPhi * 3 - Cx, sPhi * 3 - Cy, -Cz);
-
- Phi += Pi / MoebiusDivisions;
- }
- glEnd();
- } else {
- for (j = -MoebiusTransversals; j < MoebiusTransversals; j++) {
- glPolygonMode(GL_FRONT_AND_BACK, GL_LINE);
- glBegin(GL_QUAD_STRIP);
- Phi = 0;
- i = 0;
- while (i < (MoebiusDivisions * 2 + 1)) {
- Theta = Phi / 2;
- cPhi = cos(Phi);
- sPhi = sin(Phi);
-
- RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
- glNormal3f(Cx, Cy, Cz);
- RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
- j++;
- if (j == MoebiusTransversals)
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
- else if (i % 2)
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed);
- else
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray);
- glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j);
- j--;
- if (j == -MoebiusTransversals)
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
- else if (i % 2)
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed);
- else
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray);
- glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j);
-
- Phi += Pi / MoebiusDivisions;
- i++;
- }
- glEnd();
- }
- glPolygonMode(GL_FRONT_AND_BACK, GL_FILL);
- }
-
- glEndList();
- ep->AreObjectsDefined[ObjMoebiusStrip] = 1;
-#ifdef DEBUG_LISTS
- (void) printf("Strip drawn SLOWLY\n");
-#endif
- } else {
- glCallList(objects + ObjMoebiusStrip);
-#ifdef DEBUG_LISTS
- (void) printf("Strip drawn quickly\n");
-#endif
- }
-
- if (!noants) {
- /* DRAW BLUE ANT */
- glPushMatrix();
- glRotatef(ep->ant_position + 180, 0, 0, 1);
- glTranslatef(3, 0, 0);
- glRotatef(ep->ant_position / 2 + 90, 0, 1, 0);
- glTranslatef(0.28, 0, -0.45);
- draw_escher_ant(ep, MaterialYellow);
- glPopMatrix();
-
- /* DRAW YELLOW ANT */
- glPushMatrix();
- glRotatef(ep->ant_position, 0, 0, 1);
- glTranslatef(3, 0, 0);
- glRotatef(ep->ant_position / 2, 0, 1, 0);
- glTranslatef(0.28, 0, -0.45);
- draw_escher_ant(ep, MaterialBlue);
- glPopMatrix();
-
- /* DRAW GREEN ANT */
- glPushMatrix();
- glRotatef(-ep->ant_position, 0, 0, 1);
- glTranslatef(3, 0, 0);
- glRotatef(-ep->ant_position / 2, 0, 1, 0);
- glTranslatef(0.28, 0, 0.45);
- glRotatef(180, 1, 0, 0);
- draw_escher_ant(ep, MaterialGreen);
- glPopMatrix();
-
- /* DRAW CYAN ANT */
- glPushMatrix();
- glRotatef(-ep->ant_position + 180, 0, 0, 1);
- glTranslatef(3, 0, 0);
- glRotatef(-ep->ant_position / 2 + 90, 0, 1, 0);
- glTranslatef(0.28, 0, 0.45);
- glRotatef(180, 1, 0, 0);
- draw_escher_ant(ep, MaterialCyan);
- glPopMatrix();
- }
- ep->ant_position += 1;
-}
-#undef MoebiusDivisions
-#undef MoebiusTransversals
-
-static void
-draw_woodplank(escherstruct * ep)
-{
- if (!ep->AreObjectsDefined[ObjWoodPlank]) {
- glNewList(objects + ObjWoodPlank, GL_COMPILE_AND_EXECUTE);
- glBegin(GL_QUADS);
- glNormal3f(0, 0, 1);
- glTexCoord2f(0, 0);
- glVertex3f(-PlankWidth, -PlankHeight, PlankThickness);
- glTexCoord2f(1, 0);
- glVertex3f(PlankWidth, -PlankHeight, PlankThickness);
- glTexCoord2f(1, 1);
- glVertex3f(PlankWidth, PlankHeight, PlankThickness);
- glTexCoord2f(0, 1);
- glVertex3f(-PlankWidth, PlankHeight, PlankThickness);
- glNormal3f(0, 0, -1);
- glTexCoord2f(0, 0);
- glVertex3f(-PlankWidth, PlankHeight, -PlankThickness);
- glTexCoord2f(1, 0);
- glVertex3f(PlankWidth, PlankHeight, -PlankThickness);
- glTexCoord2f(1, 1);
- glVertex3f(PlankWidth, -PlankHeight, -PlankThickness);
- glTexCoord2f(0, 1);
- glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness);
- glNormal3f(0, 1, 0);
- glTexCoord2f(0, 0);
- glVertex3f(-PlankWidth, PlankHeight, PlankThickness);
- glTexCoord2f(1, 0);
- glVertex3f(PlankWidth, PlankHeight, PlankThickness);
- glTexCoord2f(1, 1);
- glVertex3f(PlankWidth, PlankHeight, -PlankThickness);
- glTexCoord2f(0, 1);
- glVertex3f(-PlankWidth, PlankHeight, -PlankThickness);
- glNormal3f(0, -1, 0);
- glTexCoord2f(0, 0);
- glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness);
- glTexCoord2f(1, 0);
- glVertex3f(PlankWidth, -PlankHeight, -PlankThickness);
- glTexCoord2f(1, 1);
- glVertex3f(PlankWidth, -PlankHeight, PlankThickness);
- glTexCoord2f(0, 1);
- glVertex3f(-PlankWidth, -PlankHeight, PlankThickness);
- glNormal3f(1, 0, 0);
- glTexCoord2f(0, 0);
- glVertex3f(PlankWidth, -PlankHeight, PlankThickness);
- glTexCoord2f(1, 0);
- glVertex3f(PlankWidth, -PlankHeight, -PlankThickness);
- glTexCoord2f(1, 1);
- glVertex3f(PlankWidth, PlankHeight, -PlankThickness);
- glTexCoord2f(0, 1);
- glVertex3f(PlankWidth, PlankHeight, PlankThickness);
- glNormal3f(-1, 0, 0);
- glTexCoord2f(0, 0);
- glVertex3f(-PlankWidth, PlankHeight, PlankThickness);
- glTexCoord2f(1, 0);
- glVertex3f(-PlankWidth, PlankHeight, -PlankThickness);
- glTexCoord2f(1, 1);
- glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness);
- glTexCoord2f(0, 1);
- glVertex3f(-PlankWidth, -PlankHeight, PlankThickness);
- glEnd();
- glEndList();
- ep->AreObjectsDefined[ObjWoodPlank] = 1;
-#ifdef DEBUG_LISTS
- (void) printf("WoodPlank drawn SLOWLY\n");
-#endif
- } else {
- glCallList(objects + ObjWoodPlank);
-#ifdef DEBUG_LISTS
- (void) printf("WoodPlank drawn quickly\n");
-#endif
- }
-}
-
-static void
-draw_impossiblecage(escherstruct * ep)
-{
- glPushMatrix();
- glRotatef(90, 0, 1, 0);
- glTranslatef(0.0, PlankHeight - PlankWidth, -PlankThickness - PlankWidth);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 0, 1);
- glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - PlankThickness);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 1, 0);
- glTranslatef(0.0, PlankWidth - PlankHeight, -PlankThickness - PlankWidth);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glTranslatef(0.0, PlankWidth - PlankHeight, 3 * PlankThickness - PlankWidth);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 0, 1);
- glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - PlankThickness);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - 3 * PlankThickness);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glTranslatef(0.0, PlankHeight - PlankWidth, 3 * PlankThickness - PlankWidth);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 0, 1);
- glTranslatef(0.0, PlankHeight - PlankWidth, PlankThickness - PlankWidth);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - 3 * PlankThickness);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 1, 0);
- glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth + PlankThickness);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 0, 1);
- glTranslatef(0.0, PlankWidth - PlankHeight, PlankThickness - PlankWidth);
- draw_woodplank(ep);
- glPopMatrix();
- glPushMatrix();
- glRotatef(90, 0, 1, 0);
- glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth + PlankThickness);
- draw_woodplank(ep);
- glPopMatrix();
-}
-
-void
-draw_escher(ModeInfo * mi)
-{
- escherstruct *ep = &escher[MI_SCREEN(mi)];
-
- Display *display = MI_DISPLAY(mi);
- Window window = MI_WINDOW(mi);
-
- glXMakeCurrent(display, window, ep->glx_context);
-
- glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
-
- glPushMatrix();
-
- glTranslatef(0.0, 0.0, -10.0);
-
- if (!MI_WIN_IS_ICONIC(mi)) {
- glScalef(Scale4Window * ep->WindH / ep->WindW, Scale4Window, Scale4Window);
- } else {
- glScalef(Scale4Iconic * ep->WindH / ep->WindW, Scale4Iconic, Scale4Iconic);
- }
-
-
- switch (ep->scene) {
- case 1:
- glRotatef(ep->step * 100, 1, 0, 0);
- glRotatef(ep->step * 95, 0, 1, 0);
- glRotatef(ep->step * 90, 0, 0, 1);
- draw_moebius(mi);
- break;
- case 2: /* 196 - 213 */
- glRotatef(ep->step * 100, 0, 0, 1);
- glRotatef(25 + cos(ep->step * 5) * 6, 1, 0, 0);
- glRotatef(204.5 - sin(ep->step * 5) * 8, 0, 1, 0);
- draw_impossiblecage(ep);
- break;
- }
-
- glPopMatrix();
-
- glFlush();
-
- glXSwapBuffers(display, window);
-
- ep->step += 0.025;
-}
-
-static void
-reshape(ModeInfo * mi, int width, int height)
-{
- escherstruct *ep = &escher[MI_SCREEN(mi)];
-
- glViewport(0, 0, ep->WindW = (GLint) width, ep->WindH = (GLint) height);
- glMatrixMode(GL_PROJECTION);
- glLoadIdentity();
- glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0);
- glMatrixMode(GL_MODELVIEW);
- if (width >= 1024) {
- glLineWidth(3);
- glPointSize(3);
- } else if (width >= 512) {
- glLineWidth(2);
- glPointSize(2);
- } else {
- glLineWidth(1);
- glPointSize(1);
- }
- ep->AreObjectsDefined[ObjMoebiusStrip] = 0;
- ep->AreObjectsDefined[ObjAntBody] = 0;
- ep->AreObjectsDefined[ObjWoodPlank] = 0;
-}
-
-static void
-pinit(ModeInfo * mi)
-{
- escherstruct *ep = &escher[MI_SCREEN(mi)];
-
- glClearDepth(1.0);
- glClearColor(0.0, 0.0, 0.0, 1.0);
-
- glLightfv(GL_LIGHT0, GL_AMBIENT, ambient);
- glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse);
- glLightfv(GL_LIGHT0, GL_POSITION, position0);
- glLightfv(GL_LIGHT1, GL_AMBIENT, ambient);
- glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse);
- glLightfv(GL_LIGHT1, GL_POSITION, position1);
- glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient);
- glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside);
- glEnable(GL_LIGHTING);
- glEnable(GL_LIGHT0);
- glEnable(GL_LIGHT1);
- glEnable(GL_NORMALIZE);
- glFrontFace(GL_CCW);
- glCullFace(GL_BACK);
-
- switch (ep->scene) {
- case 1:
- glShadeModel(GL_SMOOTH);
- glEnable(GL_DEPTH_TEST);
- glDisable(GL_TEXTURE_2D);
- glDisable(GL_CULL_FACE);
- break;
- case 2:
- glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
- glShadeModel(GL_FLAT);
- glDisable(GL_DEPTH_TEST);
- glEnable(GL_TEXTURE_2D);
- glEnable(GL_CULL_FACE);
- break;
- }
-
- glPixelStorei(GL_UNPACK_ALIGNMENT, 1);
- gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight,
- GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData);
- glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE);
- glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT);
- glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT);
- glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST);
- glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST);
-
- glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess);
- glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular);
-}
-
-void
-init_escher(ModeInfo * mi)
-{
- int screen = MI_SCREEN(mi);
- escherstruct *ep;
-
- if (escher == NULL) {
- if ((escher = (escherstruct *) calloc(MI_NUM_SCREENS(mi),
- sizeof (escherstruct))) == NULL)
- return;
- }
- ep = &escher[screen];
- ep->step = NRAND(90);
- ep->ant_position = NRAND(90);
-
- ep->glx_context = init_GL(mi);
-
- reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
- ep->scene = MI_BATCHCOUNT(mi);
- if (ep->scene <= 0 || ep->scene > NUM_SCENES)
- ep->scene = NRAND(NUM_SCENES) + 1;
- glDrawBuffer(GL_BACK);
- objects = glGenLists(3);
- pinit(mi);
-
-}
-
-void
-change_escher(ModeInfo * mi)
-{
- escherstruct *ep = &escher[MI_SCREEN(mi)];
-
- ep->scene = (ep->scene) % NUM_SCENES + 1;
- glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), ep->glx_context);
- pinit(mi);
-}
-
-void
-release_escher(ModeInfo * mi)
-{
- if (escher != NULL) {
- (void) free((void *) escher);
- escher = NULL;
- }
- glDeleteLists(objects, 3);
-}
-
-#endif
-/* -*- Mode: C; tab-width: 4 -*-
- * gears.c --- 3D gear wheels
- */
+/* -*- Mode: C; tab-width: 4 -*- */
+/* gears --- 3D gear wheels */
+
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)gears.c 4.02 97/04/01 xlockmore";
+static const char sccsid[] = "@(#)gears.c 4.07 97/11/24 xlockmore";
+
#endif
-/* Permission to use, copy, modify, and distribute this software and its
+
+/*-
+ * Permission to use, copy, modify, and distribute this software and its
* documentation for any purpose and without fee is hereby granted,
* provided that the above copyright notice appear in all copies and that
* both that copyright notice and this permission notice appear in
* other special, indirect and consequential damages.
*
* Revision History:
+ * 10-May-97: Compatible with xscreensaver
* 22-Mar-97: Added support for -mono mode, and monochrome X servers.
- * Ed Mackey, emackey@early.com
+ * Ed Mackey, emackey@netaxs.com
* 13-Mar-97: Memory leak fix by Tom Schmidt <tschmidt@micron.com>
* 1996: "written" by Danny Sung <dannys@ucla.edu>
* Based on 3-D gear wheels by Brian Paul which is in the public domain.
ModeSpecOpt gears_opts = {
0, NULL, 0, NULL, NULL };
+#ifdef USE_MODULES
+ModStruct gears_description =
+{"gears", "init_gears", "draw_gears", "release_gears",
+ "draw_gears", "init_gears", NULL, &gears_opts,
+ 1000, 1, 2, 1, 1.0, "",
+ "Shows GL's gears", 0, NULL};
+
+#endif
+
typedef struct {
GLfloat view_rotx, view_roty, view_rotz;
GLuint gear1, gear2, gear3;
GLfloat angle;
- int mono;
- GLXContext glx_context;
+ GLXContext *glx_context;
+ Window window;
#if 0
Window win;
#endif
static gearsstruct *gears = NULL;
-/*
+/*-
* Draw a gear wheel. You'll probably want to call this function when
* building a display list since we do a lot of trig here.
*
draw(ModeInfo * mi)
{
gearsstruct *gp = &gears[MI_SCREEN(mi)];
- int wire = MI_WIN_IS_WIREFRAME(mi) || gp->mono;
+ int wire = MI_WIN_IS_WIREFRAME(mi);
if (!wire) {
glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
{0.0, 0.8, 0.2, 1.0};
static GLfloat blue[4] =
{0.2, 0.2, 1.0, 1.0};
- int wire = MI_WIN_IS_WIREFRAME(mi) || gp->mono;
+ static GLfloat gray[4] =
+ {0.5, 0.5, 0.5, 1.0};
+ static GLfloat white[4] =
+ {1.0, 1.0, 1.0, 1.0};
+ int wire = MI_WIN_IS_WIREFRAME(mi);
+ int mono = MI_WIN_IS_MONO(mi);
if (!wire) {
glLightfv(GL_LIGHT0, GL_POSITION, pos);
/* make the gears */
gp->gear1 = glGenLists(1);
glNewList(gp->gear1, GL_COMPILE);
- if (!wire)
- glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, red);
- else
- glColor4fv(red);
+ if (wire) {
+ if (mono)
+ glColor4fv(white);
+ else
+ glColor4fv(red);
+ } else {
+ if (mono)
+ glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, gray);
+ else
+ glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, red);
+ }
gear(1.0, 4.0, 1.0, 20, 0.7, wire);
glEndList();
gp->gear2 = glGenLists(1);
glNewList(gp->gear2, GL_COMPILE);
- if (!wire)
- glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, green);
- else
- glColor4fv(green);
+ if (wire) {
+ if (mono)
+ glColor4fv(white);
+ else
+ glColor4fv(green);
+ } else {
+ if (mono)
+ glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, gray);
+ else
+ glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, green);
+ }
gear(0.5, 2.0, 2.0, 10, 0.7, wire);
glEndList();
gp->gear3 = glGenLists(1);
glNewList(gp->gear3, GL_COMPILE);
- if (!wire)
- glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, blue);
- else
- glColor4fv(blue);
+ if (wire) {
+ if (mono)
+ glColor4fv(white);
+ else
+ glColor4fv(blue);
+ } else {
+ if (mono)
+ glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, gray);
+ else
+ glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, blue);
+ }
gear(1.3, 2.0, 0.5, 10, 0.7, wire);
glEndList();
if (!wire)
void
init_gears(ModeInfo * mi)
{
-#if 0
- Display *display = MI_DISPLAY(mi);
- Window window = MI_WINDOW(mi);
-
-#endif
int screen = MI_SCREEN(mi);
/*Colormap cmap; */
}
gp = &gears[screen];
-#if 0
- gp->win = window;
-#endif
+ gp->window = MI_WINDOW(mi);
gp->view_rotx = NRAND(360);
gp->view_roty = NRAND(360);
gp->view_rotz = NRAND(360);
gp->angle = NRAND(360);
- gp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0);
- gp->glx_context = init_GL(mi);
-
- reshape(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
- pinit(mi);
+ if ((gp->glx_context = init_GL(mi)) != NULL) {
+ reshape(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ pinit(mi);
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
}
void
int angle_incr = MI_CYCLES(mi) ? MI_CYCLES(mi) : 2;
int rot_incr = MI_BATCHCOUNT(mi) ? MI_BATCHCOUNT(mi) : 1;
+ if (!gp->glx_context)
+ return;
+
glDrawBuffer(GL_BACK);
- glXMakeCurrent(display, window, gp->glx_context);
+ glXMakeCurrent(display, window, *(gp->glx_context));
draw(mi);
/* let's do something so we don't get bored */
for (screen = 0; screen < MI_NUM_SCREENS(mi); screen++) {
gearsstruct *gp = &gears[screen];
- /* Display lists MUST be freed while their glXContext is current. */
- glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), gp->glx_context);
-
- if (glIsList(gp->gear1))
- glDeleteLists(gp->gear1, 1);
- if (glIsList(gp->gear2))
- glDeleteLists(gp->gear2, 1);
- if (glIsList(gp->gear3))
- glDeleteLists(gp->gear3, 1);
+ if (gp->glx_context) {
+ /* Display lists MUST be freed while their glXContext is current. */
+ glXMakeCurrent(MI_DISPLAY(mi), gp->window, *(gp->glx_context));
- /* Don't destroy the glXContext. init_GL does that. */
+ if (glIsList(gp->gear1))
+ glDeleteLists(gp->gear1, 1);
+ if (glIsList(gp->gear2))
+ glDeleteLists(gp->gear2, 1);
+ if (glIsList(gp->gear3))
+ glDeleteLists(gp->gear3, 1);
+ }
}
(void) free((void *) gears);
gears = NULL;
}
+ FreeAllGL(mi);
}
--- /dev/null
+/* -*- Mode: C; tab-width: 4 -*- */
+/* moebius --- Moebius Strip II, an Escher-like GL scene with ants. */
+
+#if !defined( lint ) && !defined( SABER )
+static const char sccsid[] = "@(#)moebius.c 4.08 97/01/04 xlockmore";
+
+#endif
+
+#undef DEBUG_LISTS
+
+/*-
+ * Permission to use, copy, modify, and distribute this software and its
+ * documentation for any purpose and without fee is hereby granted,
+ * provided that the above copyright notice appear in all copies and that
+ * both that copyright notice and this permission notice appear in
+ * supporting documentation.
+ *
+ * This file is provided AS IS with no warranties of any kind. The author
+ * shall have no liability with respect to the infringement of copyrights,
+ * trade secrets or any patents by this file or any part thereof. In no
+ * event will the author be liable for any lost revenue or profits or
+ * other special, indirect and consequential damages.
+ *
+ * The RotateAroundU() routine was adapted from the book
+ * "Computer Graphics Principles and Practice
+ * Foley - vanDam - Feiner - Hughes
+ * Second Edition" Pag. 227, exercise 5.15.
+ *
+ * This mode shows some interesting scenes that are impossible OR very
+ * wierd to build in the real universe. Much of the scenes are inspirated
+ * on Mauritz Cornelis Escher's works which derivated the mode's name.
+ * M.C. Escher (1898-1972) was a dutch artist and many people prefer to
+ * say he was a mathematician.
+ *
+ * Thanks goes to Brian Paul for making it possible and inexpensive to use
+ * OpenGL at home.
+ *
+ * Since I'm not a native English speaker, my apologies for any grammatical
+ * mistake.
+ *
+ * My e-mail addresses are
+ * vianna@cat.cbpf.br
+ * and
+ * m-vianna@usa.net
+ *
+ * Marcelo F. Vianna (Jun-01-1997)
+ *
+ * Revision History:
+ * 01-Jan-98: Mode separated from escher and renamed
+ * 08-Jun-97: New scene implemented: "Impossible Cage" based in a M.C. Escher's
+ * painting with the same name (quite similar). The first GL mode
+ * to use texture mapping.
+ * The "Impossible Cage" scene doesn't use DEPTH BUFFER, the
+ * wood planks are drawn consistently using GL_CULL_FACE, and
+ * the painter's algorithm is used to sort the planks.
+ * Marcelo F. Vianna.
+ * 07-Jun-97: Speed ups in Moebius Strip using GL_CULL_FACE.
+ * Marcelo F. Vianna.
+ * 03-Jun-97: Initial Release (Only one scene: "Moebius Strip")
+ * The Moebius Strip scene was inspirated in a M.C. Escher's
+ * painting named Moebius Strip II in wich ants walk across a
+ * Moebius Strip path, sometimes meeting each other and sometimes
+ * being in "opposite faces" (note that the moebius strip has
+ * only one face and one edge).
+ * Marcelo F. Vianna.
+ *
+ */
+
+/*-
+ * Texture mapping is only available on RGBA contexts, Mono and color index
+ * visuals DO NOT support texture mapping in OpenGL.
+ *
+ * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture
+ * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono
+ * is not officially supported for both OpenGL and Mesa, but seems to not crash
+ * Mesa.
+ *
+ * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know).
+ */
+
+#include <X11/Intrinsic.h>
+
+#ifdef STANDALONE
+# define PROGCLASS "Moebius"
+# define HACK_INIT init_moebius
+# define HACK_DRAW draw_moebius
+# define moebius_opts xlockmore_opts
+# define DEFAULTS "*cycles: 1 \n" \
+ "*delay: 1000 \n" \
+ "*wireframe: False \n"
+# include "xlockmore.h" /* from the xscreensaver distribution */
+#else /* !STANDALONE */
+# include "xlock.h" /* from the xlockmore distribution */
+
+#endif /* !STANDALONE */
+
+#ifdef USE_GL
+
+
+#include <GL/glu.h>
+#include "e_textures.h"
+
+#define DEF_SOLIDMOEBIUS "False"
+#define DEF_NOANTS "False"
+
+static int solidmoebius;
+static int noants;
+
+static XrmOptionDescRec opts[] =
+{
+ {"-solidmoebius", ".moebius.solidmoebius", XrmoptionNoArg, (caddr_t) "on"},
+ {"+solidmoebius", ".moebius.solidmoebius", XrmoptionNoArg, (caddr_t) "off"},
+ {"-noants", ".moebius.noants", XrmoptionNoArg, (caddr_t) "on"},
+ {"+noants", ".moebius.noants", XrmoptionNoArg, (caddr_t) "off"}
+};
+static argtype vars[] =
+{
+ {(caddr_t *) & solidmoebius, "solidmoebius", "Solidmoebius", DEF_SOLIDMOEBIUS, t_Bool},
+ {(caddr_t *) & noants, "noants", "Noants", DEF_NOANTS, t_Bool}
+};
+static OptionStruct desc[] =
+{
+ {"-/+solidmoebius", "select between a SOLID or a NET Moebius Strip"},
+ {"-/+noants", "turn on/off walking ants"}
+};
+
+ModeSpecOpt moebius_opts =
+{4, opts, 2, vars, desc};
+
+#ifdef USE_MODULES
+ModStruct moebius_description =
+{"moebius", "init_moebius", "draw_moebius", "release_moebius",
+ "draw_moebius", "change_moebius", NULL, &moebius_opts,
+ 1000, 1, 1, 1, 1.0, "",
+ "Shows Moebius Strip II, an Escher-like GL scene with ants", 0, NULL};
+
+#endif
+
+#define Scale4Window 0.3
+#define Scale4Iconic 0.4
+
+#define sqr(A) ((A)*(A))
+
+#ifndef Pi
+#define Pi M_PI
+#endif
+
+/*************************************************************************/
+
+typedef struct {
+ GLint WindH, WindW;
+ GLfloat step;
+ GLfloat ant_position;
+ int AreObjectsDefined[2];
+ GLXContext *glx_context;
+} moebiusstruct;
+
+static float front_shininess[] =
+{60.0};
+static float front_specular[] =
+{0.7, 0.7, 0.7, 1.0};
+static float ambient[] =
+{0.0, 0.0, 0.0, 1.0};
+static float diffuse[] =
+{1.0, 1.0, 1.0, 1.0};
+static float position0[] =
+{1.0, 1.0, 1.0, 0.0};
+static float position1[] =
+{-1.0, -1.0, 1.0, 0.0};
+static float lmodel_ambient[] =
+{0.5, 0.5, 0.5, 1.0};
+static float lmodel_twoside[] =
+{GL_TRUE};
+
+static float MaterialRed[] =
+{0.7, 0.0, 0.0, 1.0};
+static float MaterialGreen[] =
+{0.1, 0.5, 0.2, 1.0};
+static float MaterialBlue[] =
+{0.0, 0.0, 0.7, 1.0};
+static float MaterialCyan[] =
+{0.2, 0.5, 0.7, 1.0};
+static float MaterialYellow[] =
+{0.7, 0.7, 0.0, 1.0};
+static float MaterialMagenta[] =
+{0.6, 0.2, 0.5, 1.0};
+static float MaterialWhite[] =
+{0.7, 0.7, 0.7, 1.0};
+static float MaterialGray[] =
+{0.2, 0.2, 0.2, 1.0};
+static float MaterialGray5[] =
+{0.5, 0.5, 0.5, 1.0};
+static float MaterialGray6[] =
+{0.6, 0.6, 0.6, 1.0};
+static float MaterialGray8[] =
+{0.8, 0.8, 0.8, 1.0};
+
+static moebiusstruct *moebius = NULL;
+static GLuint objects;
+
+#define NUM_SCENES 2
+
+#define ObjMoebiusStrip 0
+#define ObjAntBody 1
+
+static void
+mySphere(float radius)
+{
+ GLUquadricObj *quadObj;
+
+ quadObj = gluNewQuadric();
+ gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL);
+ gluSphere(quadObj, radius, 16, 16);
+ gluDeleteQuadric(quadObj);
+}
+
+static void
+myCone(float radius)
+{
+ GLUquadricObj *quadObj;
+
+ quadObj = gluNewQuadric();
+ gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL);
+ gluCylinder(quadObj, radius, 0, radius * 3, 8, 1);
+ gluDeleteQuadric(quadObj);
+}
+
+static void
+draw_moebius_ant(moebiusstruct * mp, float *Material, int mono)
+{
+ static float ant_step = 0;
+ float cos1 = cos(ant_step);
+ float cos2 = cos(ant_step + 2 * Pi / 3);
+ float cos3 = cos(ant_step + 4 * Pi / 3);
+ float sin1 = sin(ant_step);
+ float sin2 = sin(ant_step + 2 * Pi / 3);
+ float sin3 = sin(ant_step + 4 * Pi / 3);
+
+ if (mono)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray5);
+ else
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, Material);
+ if (!mp->AreObjectsDefined[ObjAntBody]) {
+ glNewList(objects + ObjAntBody, GL_COMPILE_AND_EXECUTE);
+ glEnable(GL_CULL_FACE);
+ glPushMatrix();
+ glScalef(1, 1.3, 1);
+ mySphere(0.18);
+ glScalef(1, 1 / 1.3, 1);
+ glTranslatef(0.00, 0.30, 0.00);
+ mySphere(0.2);
+
+ glTranslatef(-0.05, 0.17, 0.05);
+ glRotatef(-90, 1, 0, 0);
+ glRotatef(-25, 0, 1, 0);
+ myCone(0.05);
+ glTranslatef(0.00, 0.10, 0.00);
+ myCone(0.05);
+ glRotatef(25, 0, 1, 0);
+ glRotatef(90, 1, 0, 0);
+
+ glScalef(1, 1.3, 1);
+ glTranslatef(0.15, -0.65, 0.05);
+ mySphere(0.25);
+ glScalef(1, 1 / 1.3, 1);
+ glPopMatrix();
+ glDisable(GL_CULL_FACE);
+ glEndList();
+ mp->AreObjectsDefined[ObjAntBody] = 1;
+#ifdef DEBUG_LISTS
+ (void) printf("Ant drawn SLOWLY\n");
+#endif
+ } else {
+ glCallList(objects + ObjAntBody);
+#ifdef DEBUG_LISTS
+ (void) printf("Ant drawn quickly\n");
+#endif
+ }
+
+ glDisable(GL_LIGHTING);
+ /* ANTENNAS */
+ glBegin(GL_LINES);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, 0.30, 0.00);
+ glColor3fv(MaterialGray);
+ glVertex3f(0.40, 0.70, 0.40);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, 0.30, 0.00);
+ glColor3fv(MaterialGray);
+ glVertex3f(0.40, 0.70, -0.40);
+ glEnd();
+ glBegin(GL_POINTS);
+ if (mono)
+ glColor3fv(MaterialGray6);
+ else
+ glColor3fv(MaterialRed);
+ glVertex3f(0.40, 0.70, 0.40);
+ glVertex3f(0.40, 0.70, -0.40);
+ glEnd();
+
+ /* LEFT-FRONT ARM */
+ glBegin(GL_LINE_STRIP);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, 0.05, 0.18);
+ glVertex3f(0.35 + 0.05 * cos1, 0.15, 0.25);
+ glColor3fv(MaterialGray);
+ glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45);
+ glEnd();
+
+ /* LEFT-CENTER ARM */
+ glBegin(GL_LINE_STRIP);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, 0.00, 0.18);
+ glVertex3f(0.35 + 0.05 * cos2, 0.00, 0.25);
+ glColor3fv(MaterialGray);
+ glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45);
+ glEnd();
+
+ /* LEFT-BACK ARM */
+ glBegin(GL_LINE_STRIP);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, -0.05, 0.18);
+ glVertex3f(0.35 + 0.05 * cos3, -0.15, 0.25);
+ glColor3fv(MaterialGray);
+ glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45);
+ glEnd();
+
+ /* RIGHT-FRONT ARM */
+ glBegin(GL_LINE_STRIP);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, 0.05, -0.18);
+ glVertex3f(0.35 - 0.05 * sin1, 0.15, -0.25);
+ glColor3fv(MaterialGray);
+ glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45);
+ glEnd();
+
+ /* RIGHT-CENTER ARM */
+ glBegin(GL_LINE_STRIP);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, 0.00, -0.18);
+ glVertex3f(0.35 - 0.05 * sin2, 0.00, -0.25);
+ glColor3fv(MaterialGray);
+ glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45);
+ glEnd();
+
+ /* RIGHT-BACK ARM */
+ glBegin(GL_LINE_STRIP);
+ if (mono)
+ glColor3fv(MaterialGray5);
+ else
+ glColor3fv(Material);
+ glVertex3f(0.00, -0.05, -0.18);
+ glVertex3f(0.35 - 0.05 * sin3, -0.15, -0.25);
+ glColor3fv(MaterialGray);
+ glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45);
+ glEnd();
+
+ glBegin(GL_POINTS);
+ if (mono)
+ glColor3fv(MaterialGray8);
+ else
+ glColor3fv(MaterialMagenta);
+ glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45);
+ glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45);
+ glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45);
+ glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45);
+ glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45);
+ glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45);
+ glEnd();
+
+ glEnable(GL_LIGHTING);
+
+ ant_step += 0.3;
+}
+
+static void
+RotateAaroundU(float Ax, float Ay, float Az,
+ float Ux, float Uy, float Uz,
+ float *Cx, float *Cy, float *Cz,
+ float Theta)
+{
+ float cosO = cos(Theta);
+ float sinO = sin(Theta);
+ float one_cosO = 1 - cosO;
+ float Ux2 = sqr(Ux);
+ float Uy2 = sqr(Uy);
+ float Uz2 = sqr(Uz);
+ float UxUy = Ux * Uy;
+ float UxUz = Ux * Uz;
+ float UyUz = Uy * Uz;
+
+ *Cx = (Ux2 + cosO * (1 - Ux2)) * Ax + (UxUy * one_cosO - Uz * sinO) * Ay + (UxUz * one_cosO + Uy * sinO) * Az;
+ *Cy = (UxUy * one_cosO + Uz * sinO) * Ax + (Uy2 + cosO * (1 - Uy2)) * Ay + (UyUz * one_cosO - Ux * sinO) * Az;
+ *Cz = (UxUz * one_cosO - Uy * sinO) * Ax + (UyUz * one_cosO + Ux * sinO) * Ay + (Uz2 + cosO * (1 - Uz2)) * Az;
+}
+
+#define MoebiusDivisions 40
+#define MoebiusTransversals 4
+static void
+draw_moebius_strip(ModeInfo * mi)
+{
+ GLfloat Phi, Theta;
+ GLfloat cPhi, sPhi;
+ moebiusstruct *mp = &moebius[MI_SCREEN(mi)];
+ int i, j;
+ int mono = MI_WIN_IS_MONO(mi);
+
+ float Cx, Cy, Cz;
+
+ if (!mp->AreObjectsDefined[ObjMoebiusStrip]) {
+ glNewList(objects + ObjMoebiusStrip, GL_COMPILE_AND_EXECUTE);
+
+ if (solidmoebius) {
+ glBegin(GL_QUAD_STRIP);
+ Phi = 0;
+ i = 0;
+ while (i < (MoebiusDivisions * 2 + 1)) {
+ Theta = Phi / 2;
+ cPhi = cos(Phi);
+ sPhi = sin(Phi);
+
+ i++;
+ if (mono)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
+ else if (i % 2)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed);
+ else
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray);
+
+ RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
+ glNormal3f(Cx, Cy, Cz);
+ RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
+ glVertex3f(cPhi * 3 + Cx, sPhi * 3 + Cy, +Cz);
+ glVertex3f(cPhi * 3 - Cx, sPhi * 3 - Cy, -Cz);
+
+ Phi += Pi / MoebiusDivisions;
+ }
+ glEnd();
+ } else {
+ for (j = -MoebiusTransversals; j < MoebiusTransversals; j++) {
+ glPolygonMode(GL_FRONT_AND_BACK, GL_LINE);
+ glBegin(GL_QUAD_STRIP);
+ Phi = 0;
+ i = 0;
+ while (i < (MoebiusDivisions * 2 + 1)) {
+ Theta = Phi / 2;
+ cPhi = cos(Phi);
+ sPhi = sin(Phi);
+
+ RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
+ glNormal3f(Cx, Cy, Cz);
+ RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta);
+ j++;
+ if (j == MoebiusTransversals || mono)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
+ else if (i % 2)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed);
+ else
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray);
+ glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j);
+ j--;
+ if (j == -MoebiusTransversals || mono)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
+ else if (i % 2)
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed);
+ else
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray);
+ glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j);
+
+ Phi += Pi / MoebiusDivisions;
+ i++;
+ }
+ glEnd();
+ }
+ glPolygonMode(GL_FRONT_AND_BACK, GL_FILL);
+ }
+
+ glEndList();
+ mp->AreObjectsDefined[ObjMoebiusStrip] = 1;
+#ifdef DEBUG_LISTS
+ (void) printf("Strip drawn SLOWLY\n");
+#endif
+ } else {
+ glCallList(objects + ObjMoebiusStrip);
+#ifdef DEBUG_LISTS
+ (void) printf("Strip drawn quickly\n");
+#endif
+ }
+
+ if (!noants) {
+ /* DRAW BLUE ANT */
+ glPushMatrix();
+ glRotatef(mp->ant_position + 180, 0, 0, 1);
+ glTranslatef(3, 0, 0);
+ glRotatef(mp->ant_position / 2 + 90, 0, 1, 0);
+ glTranslatef(0.28, 0, -0.45);
+ draw_moebius_ant(mp, MaterialYellow, mono);
+ glPopMatrix();
+
+ /* DRAW YELLOW ANT */
+ glPushMatrix();
+ glRotatef(mp->ant_position, 0, 0, 1);
+ glTranslatef(3, 0, 0);
+ glRotatef(mp->ant_position / 2, 0, 1, 0);
+ glTranslatef(0.28, 0, -0.45);
+ draw_moebius_ant(mp, MaterialBlue, mono);
+ glPopMatrix();
+
+ /* DRAW GREEN ANT */
+ glPushMatrix();
+ glRotatef(-mp->ant_position, 0, 0, 1);
+ glTranslatef(3, 0, 0);
+ glRotatef(-mp->ant_position / 2, 0, 1, 0);
+ glTranslatef(0.28, 0, 0.45);
+ glRotatef(180, 1, 0, 0);
+ draw_moebius_ant(mp, MaterialGreen, mono);
+ glPopMatrix();
+
+ /* DRAW CYAN ANT */
+ glPushMatrix();
+ glRotatef(-mp->ant_position + 180, 0, 0, 1);
+ glTranslatef(3, 0, 0);
+ glRotatef(-mp->ant_position / 2 + 90, 0, 1, 0);
+ glTranslatef(0.28, 0, 0.45);
+ glRotatef(180, 1, 0, 0);
+ draw_moebius_ant(mp, MaterialCyan, mono);
+ glPopMatrix();
+ }
+ mp->ant_position += 1;
+}
+#undef MoebiusDivisions
+#undef MoebiusTransversals
+
+static void
+reshape(ModeInfo * mi, int width, int height)
+{
+ moebiusstruct *mp = &moebius[MI_SCREEN(mi)];
+
+ glViewport(0, 0, mp->WindW = (GLint) width, mp->WindH = (GLint) height);
+ glMatrixMode(GL_PROJECTION);
+ glLoadIdentity();
+ glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0);
+ glMatrixMode(GL_MODELVIEW);
+ if (width >= 1024) {
+ glLineWidth(3);
+ glPointSize(3);
+ } else if (width >= 512) {
+ glLineWidth(2);
+ glPointSize(2);
+ } else {
+ glLineWidth(1);
+ glPointSize(1);
+ }
+ mp->AreObjectsDefined[ObjMoebiusStrip] = 0;
+ mp->AreObjectsDefined[ObjAntBody] = 0;
+}
+
+static void
+pinit(void)
+{
+ glClearDepth(1.0);
+ glClearColor(0.0, 0.0, 0.0, 1.0);
+
+ glLightfv(GL_LIGHT0, GL_AMBIENT, ambient);
+ glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse);
+ glLightfv(GL_LIGHT0, GL_POSITION, position0);
+ glLightfv(GL_LIGHT1, GL_AMBIENT, ambient);
+ glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse);
+ glLightfv(GL_LIGHT1, GL_POSITION, position1);
+ glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient);
+ glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside);
+ glEnable(GL_LIGHTING);
+ glEnable(GL_LIGHT0);
+ glEnable(GL_LIGHT1);
+ glEnable(GL_NORMALIZE);
+ glFrontFace(GL_CCW);
+ glCullFace(GL_BACK);
+
+ /* moebius */
+ glShadeModel(GL_SMOOTH);
+ glEnable(GL_DEPTH_TEST);
+ glDisable(GL_TEXTURE_2D);
+ glDisable(GL_CULL_FACE);
+
+ glPixelStorei(GL_UNPACK_ALIGNMENT, 1);
+ gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight,
+ GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData);
+ glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST);
+
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess);
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular);
+}
+
+void
+init_moebius(ModeInfo * mi)
+{
+ int screen = MI_SCREEN(mi);
+ moebiusstruct *mp;
+
+ if (moebius == NULL) {
+ if ((moebius = (moebiusstruct *) calloc(MI_NUM_SCREENS(mi),
+ sizeof (moebiusstruct))) == NULL)
+ return;
+ }
+ mp = &moebius[screen];
+ mp->step = NRAND(90);
+ mp->ant_position = NRAND(90);
+
+ if ((mp->glx_context = init_GL(mi)) != NULL) {
+
+ reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ glDrawBuffer(GL_BACK);
+ if (!glIsList(objects))
+ objects = glGenLists(3);
+ pinit();
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
+}
+
+void
+draw_moebius(ModeInfo * mi)
+{
+ moebiusstruct *mp = &moebius[MI_SCREEN(mi)];
+
+ Display *display = MI_DISPLAY(mi);
+ Window window = MI_WINDOW(mi);
+
+ if (!mp->glx_context)
+ return;
+
+ glXMakeCurrent(display, window, *(mp->glx_context));
+
+ glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
+
+ glPushMatrix();
+
+ glTranslatef(0.0, 0.0, -10.0);
+
+ if (!MI_WIN_IS_ICONIC(mi)) {
+ glScalef(Scale4Window * mp->WindH / mp->WindW, Scale4Window, Scale4Window);
+ } else {
+ glScalef(Scale4Iconic * mp->WindH / mp->WindW, Scale4Iconic, Scale4Iconic);
+ }
+
+ /* moebius */
+ glRotatef(mp->step * 100, 1, 0, 0);
+ glRotatef(mp->step * 95, 0, 1, 0);
+ glRotatef(mp->step * 90, 0, 0, 1);
+ draw_moebius_strip(mi);
+
+ glPopMatrix();
+
+ glFlush();
+
+ glXSwapBuffers(display, window);
+
+ mp->step += 0.025;
+}
+
+void
+change_moebius(ModeInfo * mi)
+{
+ moebiusstruct *mp = &moebius[MI_SCREEN(mi)];
+
+ if (!mp->glx_context)
+ return;
+
+ glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(mp->glx_context));
+ pinit();
+}
+
+void
+release_moebius(ModeInfo * mi)
+{
+ if (moebius != NULL) {
+ (void) free((void *) moebius);
+ moebius = NULL;
+ }
+ if (glIsList(objects)) {
+ glDeleteLists(objects, 3);
+ }
+ FreeAllGL(mi);
+}
+
+#endif
+/* -*- Mode: C; tab-width: 4 -*- */
+/* morph3d --- Shows 3D morphing objects */
+
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)morph3d.c 4.02 97/04/01 xlockmore";
+static const char sccsid[] = "@(#)morph3d.c 4.07 97/11/24 xlockmore";
#endif
#undef DEBUG_CULL_FACE
/*-
- * morph3d.c - Shows 3D morphing objects (XLock Version)
+ * Permission to use, copy, modify, and distribute this software and its
+ * documentation for any purpose and without fee is hereby granted,
+ * provided that the above copyright notice appear in all copies and that
+ * both that copyright notice and this permission notice appear in
+ * supporting documentation.
*
- * See xlock.c for copying information.
+ * This file is provided AS IS with no warranties of any kind. The author
+ * shall have no liability with respect to the infringement of copyrights,
+ * trade secrets or any patents by this file or any part thereof. In no
+ * event will the author be liable for any lost revenue or profits or
+ * other special, indirect and consequential damages.
*
* The original code for this mode was written by Marcelo Fernandes Vianna
* (me...) and was inspired on a WindowsNT(R)'s screen saver. It was written
* If you are interested in the original version of this program (not a xlock
* mode, please refer to the Mesa package (ftp iris.ssec.wisc.edu on /pub/Mesa)
*
- * Since I'm not a native english speaker, my apologies for any gramatical
+ * Since I'm not a native English speaker, my apologies for any grammatical
* mistake.
*
* My e-mail addresses are
* vianna@cat.cbpf.br
* and
- * marcelo@venus.rdc.puc-rio.br
+ * m-vianna@usa.net
*
* Marcelo F. Vianna (Feb-13-1997)
*
ModeSpecOpt morph3d_opts =
{0, NULL, 0, NULL, NULL};
+#ifdef USE_MODULES
+ModStruct morph3d_description =
+{"morph3d", "init_morph3d", "draw_morph3d", "release_morph3d",
+ "draw_morph3d", "change_morph3d", NULL, &morph3d_opts,
+ 1000, 0, 1, 1, 1.0, "",
+ "Shows GL morphing polyhedra", 0, NULL};
+
+#endif
+
#define Scale4Window 0.3
#define Scale4Iconic 1.0
void (*draw_object) (ModeInfo * mi);
float Magnitude;
float *MaterialColor[20];
- GLXContext glx_context;
+ GLXContext *glx_context;
} morph3dstruct;
static float front_shininess[] =
static float MaterialWhite[] =
{0.7, 0.7, 0.7, 1.0};
static float MaterialGray[] =
-{0.2, 0.2, 0.2, 1.0};
+{0.5, 0.5, 0.5, 1.0};
static morph3dstruct *morph3d = NULL;
glDeleteLists(list, 1);
}
-void
-draw_morph3d(ModeInfo * mi)
-{
- morph3dstruct *mp = &morph3d[MI_SCREEN(mi)];
-
- Display *display = MI_DISPLAY(mi);
- Window window = MI_WINDOW(mi);
-
- glDrawBuffer(GL_BACK);
- glXMakeCurrent(display, window, mp->glx_context);
-
- glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
-
- glPushMatrix();
-
- glTranslatef(0.0, 0.0, -10.0);
-
- if (!MI_WIN_IS_ICONIC(mi)) {
- glScalef(Scale4Window * mp->WindH / mp->WindW, Scale4Window, Scale4Window);
- glTranslatef(2.5 * mp->WindW / mp->WindH * sin(mp->step * 1.11), 2.5 * cos(mp->step * 1.25 * 1.11), 0);
- } else {
- glScalef(Scale4Iconic * mp->WindH / mp->WindW, Scale4Iconic, Scale4Iconic);
- }
-
- glRotatef(mp->step * 100, 1, 0, 0);
- glRotatef(mp->step * 95, 0, 1, 0);
- glRotatef(mp->step * 90, 0, 0, 1);
-
- mp->seno = (sin(mp->step) + 1.0 / 3.0) * (4.0 / 5.0) * mp->Magnitude;
-
- if (mp->VisibleSpikes) {
-#ifdef DEBUG_CULL_FACE
- int loop;
-
- for (loop = 0; loop < 20; loop++)
- mp->MaterialColor[loop] = MaterialGray;
-#endif
- glDisable(GL_CULL_FACE);
- } else {
-#ifdef DEBUG_CULL_FACE
- int loop;
-
- for (loop = 0; loop < 20; loop++)
- mp->MaterialColor[loop] = MaterialWhite;
-#endif
- glEnable(GL_CULL_FACE);
- }
-
- mp->draw_object(mi);
-
- glPopMatrix();
-
- glFlush();
-
- glXSwapBuffers(display, window);
-
- mp->step += 0.05;
-}
-
static void
reshape(ModeInfo * mi, int width, int height)
{
mp->step = NRAND(90);
mp->VisibleSpikes = 1;
- mp->glx_context = init_GL(mi);
+ if ((mp->glx_context = init_GL(mi)) != NULL) {
- reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
- mp->object = MI_BATCHCOUNT(mi);
- if (mp->object <= 0 || mp->object > 5)
- mp->object = NRAND(5) + 1;
- pinit(mi);
+ reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ mp->object = MI_BATCHCOUNT(mi);
+ if (mp->object <= 0 || mp->object > 5)
+ mp->object = NRAND(5) + 1;
+ pinit(mi);
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
+}
+
+void
+draw_morph3d(ModeInfo * mi)
+{
+ morph3dstruct *mp = &morph3d[MI_SCREEN(mi)];
+
+ Display *display = MI_DISPLAY(mi);
+ Window window = MI_WINDOW(mi);
+
+ if (!mp->glx_context)
+ return;
+
+ glDrawBuffer(GL_BACK);
+ glXMakeCurrent(display, window, *(mp->glx_context));
+
+ glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
+
+ glPushMatrix();
+
+ glTranslatef(0.0, 0.0, -10.0);
+
+ if (!MI_WIN_IS_ICONIC(mi)) {
+ glScalef(Scale4Window * mp->WindH / mp->WindW, Scale4Window, Scale4Window);
+ glTranslatef(2.5 * mp->WindW / mp->WindH * sin(mp->step * 1.11), 2.5 * cos(mp->step * 1.25 * 1.11), 0);
+ } else {
+ glScalef(Scale4Iconic * mp->WindH / mp->WindW, Scale4Iconic, Scale4Iconic);
+ }
+
+ glRotatef(mp->step * 100, 1, 0, 0);
+ glRotatef(mp->step * 95, 0, 1, 0);
+ glRotatef(mp->step * 90, 0, 0, 1);
+
+ mp->seno = (sin(mp->step) + 1.0 / 3.0) * (4.0 / 5.0) * mp->Magnitude;
+
+ if (mp->VisibleSpikes) {
+#ifdef DEBUG_CULL_FACE
+ int loop;
+
+ for (loop = 0; loop < 20; loop++)
+ mp->MaterialColor[loop] = MaterialGray;
+#endif
+ glDisable(GL_CULL_FACE);
+ } else {
+#ifdef DEBUG_CULL_FACE
+ int loop;
+
+ for (loop = 0; loop < 20; loop++)
+ mp->MaterialColor[loop] = MaterialWhite;
+#endif
+ glEnable(GL_CULL_FACE);
+ }
+
+ mp->draw_object(mi);
+
+ glPopMatrix();
+
+ glFlush();
+
+ glXSwapBuffers(display, window);
+
+ mp->step += 0.05;
}
void
{
morph3dstruct *mp = &morph3d[MI_SCREEN(mi)];
+ if (!mp->glx_context)
+ return;
+
mp->object = (mp->object) % 5 + 1;
pinit(mi);
}
(void) free((void *) morph3d);
morph3d = NULL;
}
+ FreeAllGL(mi);
}
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)pipeobjs.c 4.2 97/04/27 xlockmore";
+static const char sccsid[] = "@(#)pipeobjs.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
-/* -*- Mode: C; tab-width: 4 -*-
- * pipes.c - Shows 3D selfbuiding pipe system (xlock Version)
- */
+/* -*- Mode: C; tab-width: 4 -*- */
+/* pipes --- 3D selfbuiding pipe system */
+
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)pipes.c 4.04 97/07/28 xlockmore";
+static const char sccsid[] = "@(#)pipes.c 4.07 97/11/24 xlockmore";
+
#endif
-/* Permission to use, copy, modify, and distribute this software and its
+
+/*-
+ * Permission to use, copy, modify, and distribute this software and its
* documentation for any purpose and without fee is hereby granted,
* provided that the above copyright notice appear in all copies and that
* both that copyright notice and this permission notice appear in
* Thanks goes to Brian Paul for making it possible and inexpensive to use
* OpenGL at home.
*
- * Since I'm not a native english speaker, my apologies for any gramatical
+ * Since I'm not a native English speaker, my apologies for any grammatical
* mistake.
*
* My e-mail addresses are
*
* vianna@cat.cbpf.br
* and
- * marcelo@venus.rdc.puc-rio.br
- *
+ * m-vianna@usa.net
* Marcelo F. Vianna (Apr-09-1997)
*
* Revision History:
# define HACK_INIT init_pipes
# define HACK_DRAW draw_pipes
# define pipes_opts xlockmore_opts
-# define DEFAULTS "*count: 2 \n" \
+# define DEFAULTS "*delay: 100 \n" \
+ "*count: 2 \n" \
"*cycles: 5 \n" \
"*size: 500 \n" \
- "*delay: 100 \n" \
"*fisheye: True \n" \
"*tightturns: False \n" \
"*rotatepipes: True \n" \
ModeSpecOpt pipes_opts =
{7, opts, 4, vars, desc};
+#ifdef USE_MODULES
+ModStruct pipes_description =
+{"pipes", "init_pipes", "draw_pipes", "release_pipes",
+#if defined( MESA ) && defined( SLOW )
+ "draw_pipes",
+#else
+ "change_pipes",
+#endif
+ "change_pipes", NULL, &pipes_opts,
+ 1000, 2, 5, 500, 1.0, "",
+ "Shows a selfbuilding pipe system", 0, NULL};
+
+#endif
+
#define Scale4Window 0.1
#define Scale4Iconic 0.07
int system_type;
int system_length;
int turncounter;
+ Window window;
float *system_color;
GLfloat initial_rotation;
GLuint valve, bolts, betweenbolts, elbowbolts, elbowcoins;
GLuint guagehead, guageface, guagedial, guageconnector;
- GLXContext glx_context;
+ GLXContext *glx_context;
} pipesstruct;
extern struct lwo LWO_BigValve, LWO_PipeBetweenBolts, LWO_Bolts3D;
/*dirNEAR = 00000100 */
/*dirFAR = 00000101 */
- glRotatef(90.0, (direction & 6) ? 0.0 : 1.0, (direction & 2) ? 1.0 : 0.0, 0.0);
-
+ if (!(direction & 4)) {
+ glRotatef(90.0, (direction & 2) ? 0.0 : 1.0,
+ (direction & 2) ? 1.0 : 0.0, 0.0);
+ }
glBegin(GL_QUAD_STRIP);
for (an = 0.0; an <= 2.0 * M_PI; an += M_PI / 12.0) {
glNormal3f((COSan_3 = cos(an) / 3.0), (SINan_3 = sin(an) / 3.0), 0.0);
}
}
-static void pinit(ModeInfo * mi, int zera);
+static void
+reshape(ModeInfo * mi, int width, int height)
+{
+ pipesstruct *pp = &pipes[MI_SCREEN(mi)];
+
+ glViewport(0, 0, pp->WindW = (GLint) width, pp->WindH = (GLint) height);
+ glMatrixMode(GL_PROJECTION);
+ glLoadIdentity();
+ /*glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); */
+ gluPerspective(65.0, (GLfloat) width / (GLfloat) height, 0.1, 20.0);
+ glMatrixMode(GL_MODELVIEW);
+}
+
+static void
+pinit(ModeInfo * mi, int zera)
+{
+ pipesstruct *pp = &pipes[MI_SCREEN(mi)];
+ int X, Y, Z;
+
+ glClearDepth(1.0);
+ glClearColor(0.0, 0.0, 0.0, 1.0);
+ glColor3f(1.0, 1.0, 1.0);
+
+ glLightfv(GL_LIGHT0, GL_AMBIENT, ambient0);
+ glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse0);
+ glLightfv(GL_LIGHT0, GL_POSITION, position0);
+ glLightfv(GL_LIGHT1, GL_AMBIENT, ambient1);
+ glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse1);
+ glLightfv(GL_LIGHT1, GL_POSITION, position1);
+ glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient);
+ glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside);
+ glEnable(GL_LIGHTING);
+ glEnable(GL_LIGHT0);
+ glEnable(GL_LIGHT1);
+ glEnable(GL_DEPTH_TEST);
+ glEnable(GL_NORMALIZE);
+ glEnable(GL_CULL_FACE);
+
+ glShadeModel(GL_SMOOTH);
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess);
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular);
+
+ if (zera) {
+ pp->system_number = 1;
+ glDrawBuffer(GL_FRONT_AND_BACK);
+ glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
+ (void) memset(pp->Cells, 0, sizeof (pp->Cells));
+ for (X = 0; X < HCELLS; X++) {
+ for (Y = 0; Y < VCELLS; Y++) {
+ pp->Cells[X][Y][0] = 1;
+ pp->Cells[X][Y][HCELLS - 1] = 1;
+ pp->Cells[0][Y][X] = 1;
+ pp->Cells[HCELLS - 1][Y][X] = 1;
+ }
+ }
+ for (X = 0; X < HCELLS; X++) {
+ for (Z = 0; Z < HCELLS; Z++) {
+ pp->Cells[X][0][Z] = 1;
+ pp->Cells[X][VCELLS - 1][Z] = 1;
+ }
+ }
+ (void) memset(pp->usedcolors, 0, sizeof (pp->usedcolors));
+ if ((pp->initial_rotation += 10.0) > 45.0) {
+ pp->initial_rotation -= 90.0;
+ }
+ }
+ pp->counter = 0;
+ pp->turncounter = 0;
+
+ if (!MI_WIN_IS_MONO(mi)) {
+ int collist[DEFINEDCOLORS];
+ int i, j, lower = 1000;
+
+ /* Avoid repeating colors on the same screen unless necessary */
+ for (i = 0; i < DEFINEDCOLORS; i++) {
+ if (lower > pp->usedcolors[i])
+ lower = pp->usedcolors[i];
+ }
+ for (i = 0, j = 0; i < DEFINEDCOLORS; i++) {
+ if (pp->usedcolors[i] == lower) {
+ collist[j] = i;
+ j++;
+ }
+ }
+ i = collist[NRAND(j)];
+ pp->usedcolors[i]++;
+ switch (i) {
+ case 0:
+ pp->system_color = MaterialRed;
+ break;
+ case 1:
+ pp->system_color = MaterialGreen;
+ break;
+ case 2:
+ pp->system_color = MaterialBlue;
+ break;
+ case 3:
+ pp->system_color = MaterialCyan;
+ break;
+ case 4:
+ pp->system_color = MaterialYellow;
+ break;
+ case 5:
+ pp->system_color = MaterialMagenta;
+ break;
+ case 6:
+ pp->system_color = MaterialWhite;
+ break;
+ }
+ } else {
+ pp->system_color = MaterialGray;
+ }
+
+ do {
+ pp->PX = NRAND((HCELLS - 1)) + 1;
+ pp->PY = NRAND((VCELLS - 1)) + 1;
+ pp->PZ = NRAND((HCELLS - 1)) + 1;
+ } while (pp->Cells[pp->PX][pp->PY][pp->PZ] ||
+ (pp->Cells[pp->PX + 1][pp->PY][pp->PZ] && pp->Cells[pp->PX - 1][pp->PY][pp->PZ] &&
+ pp->Cells[pp->PX][pp->PY + 1][pp->PZ] && pp->Cells[pp->PX][pp->PY - 1][pp->PZ] &&
+ pp->Cells[pp->PX][pp->PY][pp->PZ + 1] && pp->Cells[pp->PX][pp->PY][pp->PZ - 1]));
+ pp->Cells[pp->PX][pp->PY][pp->PZ] = 1;
+ pp->olddir = dirNone;
+
+ FindNeighbors(mi);
+
+ pp->nowdir = SelectNeighbor(mi);
+}
+
+void
+init_pipes(ModeInfo * mi)
+{
+ int screen = MI_SCREEN(mi);
+ pipesstruct *pp;
+
+ if (pipes == NULL) {
+ if ((pipes = (pipesstruct *) calloc(MI_NUM_SCREENS(mi),
+ sizeof (pipesstruct))) == NULL)
+ return;
+ }
+ pp = &pipes[screen];
+
+ pp->window = MI_WINDOW(mi);
+ if ((pp->glx_context = init_GL(mi)) != NULL) {
+
+ reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ pp->initial_rotation = -10.0;
+ pinit(mi, 1);
+
+ if (factory > 0) {
+ pp->valve = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_BigValve);
+ pp->bolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_Bolts3D);
+ pp->betweenbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_PipeBetweenBolts);
+
+ pp->elbowbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowBolts);
+ pp->elbowcoins = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowCoins);
+
+ pp->guagehead = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageHead);
+ pp->guageface = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageFace);
+ pp->guagedial = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageDial);
+ pp->guageconnector = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageConnector);
+ }
+ /* else they are all 0, thanks to calloc(). */
+
+ if (MI_BATCHCOUNT(mi) < 1 || MI_BATCHCOUNT(mi) > NofSysTypes + 1) {
+ pp->system_type = NRAND(NofSysTypes) + 1;
+ } else {
+ pp->system_type = MI_BATCHCOUNT(mi);
+ }
+
+ if (MI_CYCLES(mi) > 0 && MI_CYCLES(mi) < 11) {
+ pp->number_of_systems = MI_CYCLES(mi);
+ } else {
+ pp->number_of_systems = 5;
+ }
+
+ if (MI_SIZE(mi) < 10) {
+ pp->system_length = 10;
+ } else if (MI_SIZE(mi) > 1000) {
+ pp->system_length = 1000;
+ } else {
+ pp->system_length = MI_SIZE(mi);
+ }
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
+}
void
draw_pipes(ModeInfo * mi)
int newdir;
int OPX, OPY, OPZ;
- glXMakeCurrent(display, window, pp->glx_context);
+ if (!pp->glx_context)
+ return;
+
+ glXMakeCurrent(display, window, *(pp->glx_context));
#if defined( MESA ) && defined( SLOW )
glDrawBuffer(GL_BACK);
#endif
}
-static void
-reshape(ModeInfo * mi, int width, int height)
-{
- pipesstruct *pp = &pipes[MI_SCREEN(mi)];
-
- glViewport(0, 0, pp->WindW = (GLint) width, pp->WindH = (GLint) height);
- glMatrixMode(GL_PROJECTION);
- glLoadIdentity();
- /*glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); */
- gluPerspective(65.0, (GLfloat) width / (GLfloat) height, 0.1, 20.0);
- glMatrixMode(GL_MODELVIEW);
-}
-
-static void
-pinit(ModeInfo * mi, int zera)
-{
- pipesstruct *pp = &pipes[MI_SCREEN(mi)];
- int X, Y, Z;
-
- glClearDepth(1.0);
- glClearColor(0.0, 0.0, 0.0, 1.0);
- glColor3f(1.0, 1.0, 1.0);
-
- glLightfv(GL_LIGHT0, GL_AMBIENT, ambient0);
- glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse0);
- glLightfv(GL_LIGHT0, GL_POSITION, position0);
- glLightfv(GL_LIGHT1, GL_AMBIENT, ambient1);
- glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse1);
- glLightfv(GL_LIGHT1, GL_POSITION, position1);
- glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient);
- glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside);
- glEnable(GL_LIGHTING);
- glEnable(GL_LIGHT0);
- glEnable(GL_LIGHT1);
- glEnable(GL_DEPTH_TEST);
- glEnable(GL_NORMALIZE);
- glEnable(GL_CULL_FACE);
-
- glShadeModel(GL_SMOOTH);
- glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess);
- glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular);
-
- if (zera) {
- pp->system_number = 1;
- glDrawBuffer(GL_FRONT_AND_BACK);
- glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
- (void) memset(pp->Cells, 0, sizeof (pp->Cells));
- for (X = 0; X < HCELLS; X++) {
- for (Y = 0; Y < VCELLS; Y++) {
- pp->Cells[X][Y][0] = 1;
- pp->Cells[X][Y][HCELLS - 1] = 1;
- pp->Cells[0][Y][X] = 1;
- pp->Cells[HCELLS - 1][Y][X] = 1;
- }
- }
- for (X = 0; X < HCELLS; X++) {
- for (Z = 0; Z < HCELLS; Z++) {
- pp->Cells[X][0][Z] = 1;
- pp->Cells[X][VCELLS - 1][Z] = 1;
- }
- }
- (void) memset(pp->usedcolors, 0, sizeof (pp->usedcolors));
- if ((pp->initial_rotation += 10.0) > 45.0) {
- pp->initial_rotation -= 90.0;
- }
- }
- pp->counter = 0;
- pp->turncounter = 0;
-
- if (!MI_WIN_IS_MONO(mi)) {
- int collist[DEFINEDCOLORS];
- int i, j, lower = 1000;
-
- /* Avoid repeating colors on the same screen unless necessary */
- for (i = 0; i < DEFINEDCOLORS; i++) {
- if (lower > pp->usedcolors[i])
- lower = pp->usedcolors[i];
- }
- for (i = 0, j = 0; i < DEFINEDCOLORS; i++) {
- if (pp->usedcolors[i] == lower) {
- collist[j] = i;
- j++;
- }
- }
- i = collist[NRAND(j)];
- pp->usedcolors[i]++;
- switch (i) {
- case 0:
- pp->system_color = MaterialRed;
- break;
- case 1:
- pp->system_color = MaterialGreen;
- break;
- case 2:
- pp->system_color = MaterialBlue;
- break;
- case 3:
- pp->system_color = MaterialCyan;
- break;
- case 4:
- pp->system_color = MaterialYellow;
- break;
- case 5:
- pp->system_color = MaterialMagenta;
- break;
- case 6:
- pp->system_color = MaterialWhite;
- break;
- }
- } else {
- pp->system_color = MaterialGray;
- }
-
- do {
- pp->PX = NRAND((HCELLS - 1)) + 1;
- pp->PY = NRAND((VCELLS - 1)) + 1;
- pp->PZ = NRAND((HCELLS - 1)) + 1;
- } while (pp->Cells[pp->PX][pp->PY][pp->PZ] ||
- (pp->Cells[pp->PX + 1][pp->PY][pp->PZ] && pp->Cells[pp->PX - 1][pp->PY][pp->PZ] &&
- pp->Cells[pp->PX][pp->PY + 1][pp->PZ] && pp->Cells[pp->PX][pp->PY - 1][pp->PZ] &&
- pp->Cells[pp->PX][pp->PY][pp->PZ + 1] && pp->Cells[pp->PX][pp->PY][pp->PZ - 1]));
- pp->Cells[pp->PX][pp->PY][pp->PZ] = 1;
- pp->olddir = dirNone;
-
- FindNeighbors(mi);
-
- pp->nowdir = SelectNeighbor(mi);
-}
-
-void
-init_pipes(ModeInfo * mi)
-{
- int screen = MI_SCREEN(mi);
- pipesstruct *pp;
-
- if (pipes == NULL) {
- if ((pipes = (pipesstruct *) calloc(MI_NUM_SCREENS(mi),
- sizeof (pipesstruct))) == NULL)
- return;
- }
- pp = &pipes[screen];
-
- pp->glx_context = init_GL(mi);
-
- reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
- pp->initial_rotation = -10.0;
- pinit(mi, 1);
-
- if (factory > 0) {
- pp->valve = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_BigValve);
- pp->bolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_Bolts3D);
- pp->betweenbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_PipeBetweenBolts);
-
- pp->elbowbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowBolts);
- pp->elbowcoins = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowCoins);
-
- pp->guagehead = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageHead);
- pp->guageface = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageFace);
- pp->guagedial = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageDial);
- pp->guageconnector = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageConnector);
- }
- /* else they are all 0, thanks to calloc(). */
-
- if (MI_BATCHCOUNT(mi) < 1 || MI_BATCHCOUNT(mi) > NofSysTypes + 1) {
- pp->system_type = NRAND(NofSysTypes) + 1;
- } else {
- pp->system_type = MI_BATCHCOUNT(mi);
- }
-
- if (MI_CYCLES(mi) > 0 && MI_CYCLES(mi) < 11) {
- pp->number_of_systems = MI_CYCLES(mi);
- } else {
- pp->number_of_systems = 5;
- }
-
- if (MI_SIZE(mi) < 10) {
- pp->system_length = 10;
- } else if (MI_SIZE(mi) > 1000) {
- pp->system_length = 1000;
- } else {
- pp->system_length = MI_SIZE(mi);
- }
-
-}
-
void
change_pipes(ModeInfo * mi)
{
pipesstruct *pp = &pipes[MI_SCREEN(mi)];
- glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), pp->glx_context);
+ if (!pp->glx_context)
+ return;
+
+ glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(pp->glx_context));
pinit(mi, 1);
}
for (screen = 0; screen < MI_NUM_SCREENS(mi); screen++) {
pipesstruct *pp = &pipes[screen];
- /* Display lists MUST be freed while their glXContext is current. */
- glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), pp->glx_context);
-
- if (pp->valve)
- glDeleteLists(pp->valve, 1);
- if (pp->bolts)
- glDeleteLists(pp->bolts, 1);
- if (pp->betweenbolts)
- glDeleteLists(pp->betweenbolts, 1);
-
- if (pp->elbowbolts)
- glDeleteLists(pp->elbowbolts, 1);
- if (pp->elbowcoins)
- glDeleteLists(pp->elbowcoins, 1);
-
- if (pp->guagehead)
- glDeleteLists(pp->guagehead, 1);
- if (pp->guageface)
- glDeleteLists(pp->guageface, 1);
- if (pp->guagedial)
- glDeleteLists(pp->guagedial, 1);
- if (pp->guageconnector)
- glDeleteLists(pp->guageconnector, 1);
+ if (pp->glx_context) {
+
+ /* Display lists MUST be freed while their glXContext is current. */
+ glXMakeCurrent(MI_DISPLAY(mi), pp->window, *(pp->glx_context));
+
+ if (pp->valve)
+ glDeleteLists(pp->valve, 1);
+ if (pp->bolts)
+ glDeleteLists(pp->bolts, 1);
+ if (pp->betweenbolts)
+ glDeleteLists(pp->betweenbolts, 1);
+
+ if (pp->elbowbolts)
+ glDeleteLists(pp->elbowbolts, 1);
+ if (pp->elbowcoins)
+ glDeleteLists(pp->elbowcoins, 1);
+
+ if (pp->guagehead)
+ glDeleteLists(pp->guagehead, 1);
+ if (pp->guageface)
+ glDeleteLists(pp->guageface, 1);
+ if (pp->guagedial)
+ glDeleteLists(pp->guagedial, 1);
+ if (pp->guageconnector)
+ glDeleteLists(pp->guageconnector, 1);
+ }
}
- /* Don't destroy the glXContext. init_GL does that. */
-
(void) free((void *) pipes);
pipes = NULL;
}
+ FreeAllGL(mi);
}
#endif
/* rubik --- Shows a auto-solving Rubik's cube */
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)rubik.c 4.04 97/07/28 xlockmore";
+static const char sccsid[] = "@(#)rubik.c 4.07 97/11/24 xlockmore";
#endif
ModeSpecOpt rubik_opts =
{2, opts, 1, vars, desc};
+#ifdef USE_MODULES
+ModStruct rubik_description =
+{"rubik", "init_rubik", "draw_rubik", "release_rubik",
+ "draw_rubik", "change_rubik", NULL, &rubik_opts,
+ 1000, -30, 5, -6, 1.0, "",
+ "Shows an auto-solving Rubik's Cube", 0, NULL};
+
+#endif
+
#define VectMul(X1,Y1,Z1,X2,Y2,Z2) (Y1)*(Z2)-(Z1)*(Y2),(Z1)*(X2)-(X1)*(Z2),(X1)*(Y2)-(Y1)*(X2)
#define sqr(A) ((A)*(A))
RubikLoc *rowLoc[MAXORIENT];
RubikMove movement;
GLfloat rotatestep;
- GLXContext glx_context;
+ GLXContext *glx_context;
int AreObjectsDefined[1];
} rubikstruct;
glVertex3f(-0.35, 0.51, -0.40);
glEnd();
}
- glEnd();
}
reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
objects = glGenLists(1);
pinit(mi);
+ } else {
+ MI_CLEARWINDOW(mi);
}
}
return;
glDrawBuffer(GL_BACK);
- glXMakeCurrent(display, window, rp->glx_context);
+ glXMakeCurrent(display, window, *(rp->glx_context));
glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
(void) free((void *) rubik);
rubik = NULL;
}
- FreeAllGL(MI_DISPLAY(mi));
+ FreeAllGL(mi);
}
#endif
-
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_1.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_1.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_2.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_2.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_3.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_3.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_4.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_4.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_5.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_5.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_6.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_6.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)s1_b.c 4.2 97/04/20 xlockmore";
+static const char sccsid[] = "@(#)s1_b.c 4.04 97/07/28 xlockmore";
#endif
#ifndef STANDALONE
#include "xlock.h"
#endif
-
+
#ifdef USE_GL
-
+
#ifdef STANDALONE
#include <GL/glx.h>
#endif
-/* -*- Mode: C; tab-width: 4 -*-
- * sproingies.c --- 3D sproingies
- */
+/* -*- Mode: C; tab-width: 4 -*- */
+/* sproingies.c - 3D sproingies */
+
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)sproingies.c 4.04 97/07/26 xlockmore";
+static const char sccsid[] = "@(#)sproingies.c 4.04 97/07/28 xlockmore";
+
#endif
-/* Copyright 1996 by Ed Mackey, 12/7/96 freely distributable.
+
+/*-
+ * sproingies.c - Copyright 1996 by Ed Mackey, freely distributable.
+ *
* Permission to use, copy, modify, and distribute this software and its
* documentation for any purpose and without fee is hereby granted,
* provided that the above copyright notice appear in all copies and that
* trade secrets or any patents by this file or any part thereof. In no
* event will the author be liable for any lost revenue or profits or
* other special, indirect and consequential damages.
+ *
+ * Revision History:
+ * 07-Dec-96: Written.
*/
#ifdef STANDALONE
-# include "xlockmoreI.h" /* from the xscreensaver distribution */
-#else /* !STANDALONE */
-# include "xlock.h" /* from the xlockmore distribution */
+# include "xlockmoreI.h" /* from the xscreensaver distribution */
+#else /* !STANDALONE */
+# include "xlock.h" /* from the xlockmore distribution */
#endif /* !STANDALONE */
#ifdef USE_GL
-/* -*- Mode: C; tab-width: 4 -*-
- * sproingies.c --- 3D sproingies
- */
+/* -*- Mode: C; tab-width: 4 -*- */
+/* sproingiewrap.c - sproingies wrapper */
+
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)sproingiewrap.c 4.04 97/07/28 xlockmore";
+static const char sccsid[] = "@(#)sproingiewrap.c 4.07 97/11/24 xlockmore";
+
#endif
-/*
+
+/*-
* sproingiewrap.c - Copyright 1996 Sproingie Technologies Incorporated.
- * Source and binary freely distributable under the
- * terms in xlock.c
*
* Permission to use, copy, modify, and distribute this software and its
* documentation for any purpose and without fee is hereby granted,
* event will the author be liable for any lost revenue or profits or
* other special, indirect and consequential damages.
*
- ***************************************************************************
- * Programming: Ed Mackey, http://www.early.com/~emackey/
+ * Programming: Ed Mackey, http://www.netaxs.com/~emackey/
* Sproingie 3D objects modeled by: Al Mackey, al@iam.com
* (using MetaNURBS in NewTek's Lightwave 3D v5).
*
* xlockmore's built-in Mesa/OpenGL support instead of
* my own. Submitted for inclusion in xlockmore.
* 09-Dec-96: Written.
- *
- * Ed Mackey
*/
/*-
# define HACK_INIT init_sproingies
# define HACK_DRAW draw_sproingies
# define sproingies_opts xlockmore_opts
-# define DEFAULTS "*count: 5 \n" \
+# define DEFAULTS "*delay: 100 \n" \
+ "*count: 5 \n" \
"*cycles: 0 \n" \
- "*delay: 100 \n" \
"*size: 0 \n" \
"*wireframe: False \n"
# include "xlockmore.h" /* from the xscreensaver distribution */
ModeSpecOpt sproingies_opts = {
0, NULL, 0, NULL, NULL };
+#ifdef USE_MODULES
+ModStruct sproingies_description =
+{"sproingies", "init_sproingies", "draw_sproingies", "release_sproingies",
+ "refresh_sproingies", "init_sproingies", NULL, &sproingies_opts,
+ 1000, 5, 0, 400, 1.0, "",
+ "Shows Sproingies! Nontoxic. Safe for pets and small children", 0, NULL};
+
+#endif
+
#define MINSIZE 32
#include <GL/glu.h>
void NextSproingie(int screen);
void NextSproingieDisplay(int screen);
void DisplaySproingies(int screen);
+
#if 0
void ReshapeSproingies(int w, int h);
+
#endif
void CleanupSproingies(int screen);
void InitSproingies(int wfmode, int grnd, int mspr, int screen, int numscreens, int mono);
GLfloat angle;
GLuint limit;
GLuint count;
- GLXContext glx_context;
+ GLXContext *glx_context;
int mono;
+ Window window;
} sproingiesstruct;
static sproingiesstruct *sproingies = NULL;
}
+void
+init_sproingies(ModeInfo * mi)
+{
+ Display *display = MI_DISPLAY(mi);
+ Window window = MI_WINDOW(mi);
+ int screen = MI_SCREEN(mi);
+
+ int cycles = MI_CYCLES(mi);
+ int batchcount = MI_BATCHCOUNT(mi);
+ int size = MI_SIZE(mi);
+
+ sproingiesstruct *sp;
+ int wfmode = 0, grnd, mspr, w, h;
+
+ if (sproingies == NULL) {
+ if ((sproingies = (sproingiesstruct *) calloc(MI_NUM_SCREENS(mi),
+ sizeof (sproingiesstruct))) == NULL)
+ return;
+ }
+ sp = &sproingies[screen];
+
+ sp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0);
+ sp->window = window;
+ if ((sp->glx_context = init_GL(mi)) != NULL) {
+
+ if ((cycles & 1) || MI_WIN_IS_WIREFRAME(mi))
+ wfmode = 1;
+ grnd = (cycles >> 1);
+ if (grnd > 2)
+ grnd = 2;
+
+ mspr = batchcount;
+ if (mspr > 100)
+ mspr = 100;
+
+ /* wireframe, ground, maxsproingies */
+ InitSproingies(wfmode, grnd, mspr, MI_SCREEN(mi), MI_NUM_SCREENS(mi), sp->mono);
+
+ /* Viewport is specified size if size >= MINSIZE && size < screensize */
+ if (size == 0) {
+ w = MI_WIN_WIDTH(mi);
+ h = MI_WIN_HEIGHT(mi);
+ } else if (size < MINSIZE) {
+ w = MINSIZE;
+ h = MINSIZE;
+ } else {
+ w = (size > MI_WIN_WIDTH(mi)) ? MI_WIN_WIDTH(mi) : size;
+ h = (size > MI_WIN_HEIGHT(mi)) ? MI_WIN_HEIGHT(mi) : size;
+ }
+
+ glViewport((MI_WIN_WIDTH(mi) - w) / 2, (MI_WIN_HEIGHT(mi) - h) / 2, w, h);
+ glMatrixMode(GL_PROJECTION);
+ glLoadIdentity();
+ gluPerspective(65.0, (GLfloat) w / (GLfloat) h, 0.1, 2000.0); /* was 200000.0 */
+ glMatrixMode(GL_MODELVIEW);
+ glLoadIdentity();
+
+ swap_display = display;
+ swap_window = window;
+ DisplaySproingies(MI_SCREEN(mi));
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
+}
+
/* ARGSUSED */
void
draw_sproingies(ModeInfo * mi)
Display *display = MI_DISPLAY(mi);
Window window = MI_WINDOW(mi);
+ if (!sp->glx_context)
+ return;
+
glDrawBuffer(GL_BACK);
- glXMakeCurrent(display, window, sp->glx_context);
+ glXMakeCurrent(display, window, *(sp->glx_context));
swap_display = display;
swap_window = window;
for (screen = 0; screen < MI_NUM_SCREENS(mi); screen++) {
sproingiesstruct *sp = &sproingies[screen];
- glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), sp->glx_context);
- CleanupSproingies(MI_SCREEN(mi));
- }
+ if (sp->glx_context) {
- /* Don't destroy the glXContext. init_GL does that. */
+ glXMakeCurrent(MI_DISPLAY(mi), sp->window, *(sp->glx_context));
+ CleanupSproingies(MI_SCREEN(mi));
+ }
+ }
(void) free((void *) sproingies);
sproingies = NULL;
}
-}
-
-void
-init_sproingies(ModeInfo * mi)
-{
- Display *display = MI_DISPLAY(mi);
- Window window = MI_WINDOW(mi);
- int screen = MI_SCREEN(mi);
-
- int cycles = MI_CYCLES(mi);
- int batchcount = MI_BATCHCOUNT(mi);
- int size = MI_SIZE(mi);
-
- sproingiesstruct *sp;
- int wfmode = 0, grnd, mspr, w, h;
-
- if (sproingies == NULL) {
- if ((sproingies = (sproingiesstruct *) calloc(MI_NUM_SCREENS(mi),
- sizeof (sproingiesstruct))) == NULL)
- return;
- }
- sp = &sproingies[screen];
-
- sp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0);
-
- sp->glx_context = init_GL(mi);
-
- if ((cycles & 1) || MI_WIN_IS_WIREFRAME(mi) || sp->mono)
- wfmode = 1;
- grnd = (cycles >> 1);
- if (grnd > 2)
- grnd = 2;
-
- mspr = batchcount;
- if (mspr > 100)
- mspr = 100;
-
- /* wireframe, ground, maxsproingies */
- InitSproingies(wfmode, grnd, mspr, MI_SCREEN(mi), MI_NUM_SCREENS(mi), sp->mono);
-
- /* Viewport is specified size if size >= MINSIZE && size < screensize */
- if (size == 0) {
- w = MI_WIN_WIDTH(mi);
- h = MI_WIN_HEIGHT(mi);
- } else if (size < MINSIZE) {
- w = MINSIZE;
- h = MINSIZE;
- } else {
- w = (size > MI_WIN_WIDTH(mi)) ? MI_WIN_WIDTH(mi) : size;
- h = (size > MI_WIN_HEIGHT(mi)) ? MI_WIN_HEIGHT(mi) : size;
- }
-
- glViewport((MI_WIN_WIDTH(mi) - w) / 2, (MI_WIN_HEIGHT(mi) - h) / 2, w, h);
- glMatrixMode(GL_PROJECTION);
- glLoadIdentity();
- gluPerspective(65.0, (GLfloat) w / (GLfloat) h, 0.1, 2000.0); /* was 200000.0 */
- glMatrixMode(GL_MODELVIEW);
- glLoadIdentity();
-
- swap_display = display;
- swap_window = window;
- DisplaySproingies(MI_SCREEN(mi));
+ FreeAllGL(mi);
}
#endif
--- /dev/null
+/* -*- Mode: C; tab-width: 4 -*- */
+/* stairs --- Infinite Stairs, and Escher-like scene. */
+
+#if !defined( lint ) && !defined( SABER )
+static const char sccsid[] = "@(#)stairs.c 4.07 97/11/24 xlockmore";
+
+#endif
+
+#undef DEBUG_LISTS
+
+/*-
+ * Permission to use, copy, modify, and distribute this software and its
+ * documentation for any purpose and without fee is hereby granted,
+ * provided that the above copyright notice appear in all copies and that
+ * both that copyright notice and this permission notice appear in
+ * supporting documentation.
+ *
+ * This file is provided AS IS with no warranties of any kind. The author
+ * shall have no liability with respect to the infringement of copyrights,
+ * trade secrets or any patents by this file or any part thereof. In no
+ * event will the author be liable for any lost revenue or profits or
+ * other special, indirect and consequential damages.
+ *
+ * This mode shows some interesting scenes that are impossible OR very
+ * weird to build in the real universe. Much of the scenes are inspirated
+ * on Mauritz Cornelis stairs's works which derivated the mode's name.
+ * M.C. Escher (1898-1972) was a dutch artist and many people prefer to
+ * say he was a mathematician.
+ *
+ * Thanks goes to Brian Paul for making it possible and inexpensive to use
+ * OpenGL at home.
+ *
+ * Since I'm not a native English speaker, my apologies for any grammatical
+ * mistake.
+ *
+ * My e-mail addresses are
+ * vianna@cat.cbpf.br
+ * and
+ * m-vianna@usa.net
+ *
+ * Marcelo F. Vianna (Jun-01-1997)
+ *
+ * Revision History:
+ * 07-Jan-98: This would be a scene for the escher mode, but now escher mode
+ * was splitted in different modes for each scene. This is the
+ * initial release and is not working yet.
+ * Marcelo F. Vianna.
+ *
+ */
+
+/*-
+ * Texture mapping is only available on RGBA contexts, Mono and color index
+ * visuals DO NOT support texture mapping in OpenGL.
+ *
+ * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture
+ * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono
+ * is not officially supported for both OpenGL and Mesa, but seems to not crash
+ * Mesa.
+z *
+ * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know).
+ */
+
+#include <X11/Intrinsic.h>
+
+#ifdef STANDALONE
+# define PROGCLASS "Stairs"
+# define HACK_INIT init_stairs
+# define HACK_DRAW draw_stairs
+# define stairs_opts xlockmore_opts
+# define DEFAULTS "*cycles: 1 \n" \
+ "*delay: 200000 \n" \
+ "*wireframe: False \n"
+# include "xlockmore.h" /* from the xscreensaver distribution */
+#else /* !STANDALONE */
+# include "xlock.h" /* from the xlockmore distribution */
+
+#endif /* !STANDALONE */
+
+#ifdef USE_GL
+
+#include <GL/glu.h>
+#include "e_textures.h"
+
+ModeSpecOpt stairs_opts =
+{0, NULL, 0, NULL, NULL};
+
+#ifdef USE_MODULES
+ModStruct stairs_description =
+{"stairs", "init_stairs", "draw_stairs", "release_stairs",
+ "draw_stairs", "change_stairs", NULL, &stairs_opts,
+ 1000, 1, 1, 1, 1.0, "",
+ "Shows Infinite Stairs, an Escher-like scene", 0, NULL};
+
+#endif
+
+#define Scale4Window 0.3
+#define Scale4Iconic 0.4
+
+#define sqr(A) ((A)*(A))
+
+#ifndef Pi
+#define Pi M_PI
+#endif
+
+/*************************************************************************/
+
+typedef struct {
+ GLint WindH, WindW;
+ GLfloat step;
+ Bool direction;
+ int AreObjectsDefined[1];
+ int sphere_position;
+ GLXContext *glx_context;
+} stairsstruct;
+
+static float front_shininess[] =
+{60.0};
+static float front_specular[] =
+{0.7, 0.7, 0.7, 1.0};
+static float ambient[] =
+{0.0, 0.0, 0.0, 1.0};
+static float diffuse[] =
+{1.0, 1.0, 1.0, 1.0};
+static float position0[] =
+{1.0, 1.0, 1.0, 0.0};
+static float position1[] =
+{-1.0, -1.0, 1.0, 0.0};
+static float lmodel_ambient[] =
+{0.5, 0.5, 0.5, 1.0};
+static float lmodel_twoside[] =
+{GL_TRUE};
+
+#if 0
+static float MaterialRed[] =
+{0.7, 0.0, 0.0, 1.0};
+static float MaterialGreen[] =
+{0.1, 0.5, 0.2, 1.0};
+static float MaterialBlue[] =
+{0.0, 0.0, 0.7, 1.0};
+static float MaterialCyan[] =
+{0.2, 0.5, 0.7, 1.0};
+static float MaterialMagenta[] =
+{0.6, 0.2, 0.5, 1.0};
+static float MaterialGray[] =
+{0.2, 0.2, 0.2, 1.0};
+static float MaterialGray5[] =
+{0.5, 0.5, 0.5, 1.0};
+static float MaterialGray6[] =
+{0.6, 0.6, 0.6, 1.0};
+static float MaterialGray8[] =
+{0.8, 0.8, 0.8, 1.0};
+#endif
+static float MaterialYellow[] =
+{0.7, 0.7, 0.0, 1.0};
+static float MaterialWhite[] =
+{0.7, 0.7, 0.7, 1.0};
+
+static float positions[] =
+{
+ -2.5, 4.0, 0.0, /* First one is FUDGED :) */
+ -3.0, 3.25, 1.0,
+ -3.0, 4.4, 1.5,
+ -3.0, 3.05, 2.0,
+ -3.0, 4.2, 2.5,
+
+ -3.0, 2.85, 3.0,
+ -2.5, 4.0, 3.0,
+ -2.0, 2.75, 3.0,
+ -1.5, 3.9, 3.0,
+ -1.0, 2.65, 3.0,
+ -0.5, 3.8, 3.0,
+ 0.0, 2.55, 3.0,
+ 0.5, 3.7, 3.0,
+ 1.0, 2.45, 3.0,
+ 1.5, 3.6, 3.0,
+ 2.0, 2.35, 3.0,
+
+ 2.0, 3.5, 2.5,
+ 2.0, 2.25, 2.0,
+ 2.0, 3.4, 1.5,
+ 2.0, 2.15, 1.0,
+ 2.0, 3.3, 0.5,
+ 2.0, 2.05, 0.0,
+ 2.0, 3.2, -0.5,
+ 2.0, 1.95, -1.0,
+ 2.0, 3.1, -1.5,
+ 2.0, 1.85, -2.0,
+
+ 1.5, 2.9, -2.0,
+ 1.0, 1.65, -2.0,
+ 0.5, 2.7, -2.0,
+ 0.0, 1.55, -2.0,
+ -0.5, 2.5, -2.0,
+ -1.0, 1.45, -2.0,
+};
+#define NPOSITIONS ((sizeof positions) / (sizeof positions[0]))
+
+static stairsstruct *stairs = NULL;
+static GLuint objects;
+
+#define ObjSphere 0
+
+#define PlankWidth 3.0
+#define PlankHeight 0.35
+#define PlankThickness 0.15
+
+static void
+mySphere(float radius)
+{
+ GLUquadricObj *quadObj;
+
+ quadObj = gluNewQuadric();
+ gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL);
+ gluSphere(quadObj, radius, 16, 16);
+ gluDeleteQuadric(quadObj);
+}
+
+static void
+draw_block(stairsstruct * sp, GLfloat width, GLfloat height, GLfloat thickness)
+{
+ glBegin(GL_QUADS);
+ glNormal3f(0, 0, 1);
+ glTexCoord2f(0, 0);
+ glVertex3f(-width, -height, thickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(width, -height, thickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(width, height, thickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-width, height, thickness);
+ glNormal3f(0, 0, -1);
+ glTexCoord2f(0, 0);
+ glVertex3f(-width, height, -thickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(width, height, -thickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(width, -height, -thickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-width, -height, -thickness);
+ glNormal3f(0, 1, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(-width, height, thickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(width, height, thickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(width, height, -thickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-width, height, -thickness);
+ glNormal3f(0, -1, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(-width, -height, -thickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(width, -height, -thickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(width, -height, thickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-width, -height, thickness);
+ glNormal3f(1, 0, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(width, -height, thickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(width, -height, -thickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(width, height, -thickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(width, height, thickness);
+ glNormal3f(-1, 0, 0);
+ glTexCoord2f(0, 0);
+ glVertex3f(-width, height, thickness);
+ glTexCoord2f(1, 0);
+ glVertex3f(-width, height, -thickness);
+ glTexCoord2f(1, 1);
+ glVertex3f(-width, -height, -thickness);
+ glTexCoord2f(0, 1);
+ glVertex3f(-width, -height, thickness);
+ glEnd();
+}
+
+static void
+draw_degree(stairsstruct * sp, GLfloat w, GLfloat h , GLfloat t)
+{
+ draw_block(sp, w, h, t);
+}
+
+static void
+draw_stairs_internal(ModeInfo *mi)
+{
+ stairsstruct *sp = &stairs[MI_SCREEN(mi)];
+ GLfloat X;
+
+ glPushMatrix();
+ glPushMatrix();
+ glTranslatef(-3.0, 0.1, 2.0);
+ for (X=0; X< 2; X++) {
+ draw_degree(sp, 0.5, 2.7+0.1*X, 0.5);
+ glTranslatef( 0.0, 0.1,-1.0);
+ }
+ glPopMatrix();
+ glTranslatef(-3.0, 0.0, 3.0);
+ glPushMatrix();
+
+ for (X=0; X< 6; X++) {
+ draw_degree(sp, 0.5, 2.6-0.1*X, 0.5);
+ glTranslatef( 1.0,-0.1, 0.0);
+ }
+ glTranslatef(-1.0,-0.9,-1.0);
+ for (X=0; X< 5; X++) {
+ draw_degree(sp, 0.5, 3.0-0.1*X, 0.5);
+ glTranslatef( 0.0, 0.0,-1.0);
+ }
+ glTranslatef(-1.0,-1.1, 1.0);
+ for (X=0; X< 3; X++) {
+ draw_degree(sp, 0.5, 3.5-0.1*X, 0.5);
+ glTranslatef(-1.0,-0.1, 0.0);
+ }
+ glPopMatrix();
+ glPopMatrix();
+
+ glPushMatrix();
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialYellow);
+
+ glTranslatef((GLfloat) positions[sp->sphere_position],
+ (GLfloat) positions[sp->sphere_position + 1],
+ (GLfloat) positions[sp->sphere_position + 2]);
+ if (sp->sphere_position == 0) /* FUDGE soo its not so obvious */
+ mySphere(0.48);
+ else
+ mySphere(0.5);
+ glPopMatrix();
+ sp->sphere_position += 3;
+ if (sp->sphere_position >= NPOSITIONS)
+ sp->sphere_position = 0;
+}
+
+static void
+reshape(ModeInfo * mi, int width, int height)
+{
+ stairsstruct *sp = &stairs[MI_SCREEN(mi)];
+
+ glViewport(0, 0, sp->WindW = (GLint) width, sp->WindH = (GLint) height);
+ glMatrixMode(GL_PROJECTION);
+ glLoadIdentity();
+ glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0);
+ glMatrixMode(GL_MODELVIEW);
+ if (width >= 1024) {
+ glLineWidth(3);
+ glPointSize(3);
+ } else if (width >= 512) {
+ glLineWidth(2);
+ glPointSize(2);
+ } else {
+ glLineWidth(1);
+ glPointSize(1);
+ }
+}
+
+static void
+pinit(ModeInfo * mi)
+{
+/* stairsstruct *sp = &stairs[MI_SCREEN(mi)];*/
+
+ glClearDepth(1.0);
+ glClearColor(0.0, 0.0, 0.0, 1.0);
+
+ glLightfv(GL_LIGHT0, GL_AMBIENT, ambient);
+ glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse);
+ glLightfv(GL_LIGHT0, GL_POSITION, position0);
+ glLightfv(GL_LIGHT1, GL_AMBIENT, ambient);
+ glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse);
+ glLightfv(GL_LIGHT1, GL_POSITION, position1);
+ glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient);
+ glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside);
+ glEnable(GL_LIGHTING);
+ glEnable(GL_LIGHT0);
+ glEnable(GL_LIGHT1);
+ glEnable(GL_NORMALIZE);
+ glFrontFace(GL_CCW);
+ glCullFace(GL_BACK);
+
+ glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite);
+ glShadeModel(GL_FLAT);
+ glEnable(GL_DEPTH_TEST);
+ glEnable(GL_TEXTURE_2D);
+ glEnable(GL_CULL_FACE);
+
+ glPixelStorei(GL_UNPACK_ALIGNMENT, 1);
+ gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight,
+ GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData);
+ glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST);
+ glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST);
+
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess);
+ glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular);
+}
+
+void
+init_stairs(ModeInfo * mi)
+{
+ int screen = MI_SCREEN(mi);
+ stairsstruct *sp;
+
+ if (stairs == NULL) {
+ if ((stairs = (stairsstruct *) calloc(MI_NUM_SCREENS(mi),
+ sizeof (stairsstruct))) == NULL)
+ return;
+ }
+ sp = &stairs[screen];
+ sp->step = 0.0;
+ sp->direction = LRAND() & 1;
+ sp->sphere_position = NRAND(NPOSITIONS / 3) * 3;
+
+ if ((sp->glx_context = init_GL(mi)) != NULL) {
+
+ reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ glDrawBuffer(GL_BACK);
+ if (!glIsList(objects))
+ objects = glGenLists(1);
+ pinit(mi);
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
+}
+
+void
+draw_stairs(ModeInfo * mi)
+{
+ stairsstruct *sp = &stairs[MI_SCREEN(mi)];
+
+ Display *display = MI_DISPLAY(mi);
+ Window window = MI_WINDOW(mi);
+
+ if (!sp->glx_context)
+ return;
+
+ glXMakeCurrent(display, window, *(sp->glx_context));
+
+ glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT);
+
+ glPushMatrix();
+
+ glTranslatef(0.0, 0.0, -10.0);
+
+ if (!MI_WIN_IS_ICONIC(mi)) {
+ glScalef(Scale4Window * sp->WindH / sp->WindW, Scale4Window, Scale4Window);
+ } else {
+ glScalef(Scale4Iconic * sp->WindH / sp->WindW, Scale4Iconic, Scale4Iconic);
+ }
+
+ glRotatef(44.5, 1, 0, 0);
+ glRotatef(50 + ((sp->direction) ? 1 : -1 ) *
+ ((sp->step * 100 > 120) ? sp->step * 100 - 120 : 0), 0, 1, 0);
+ if (sp->step * 100 >= 360 + 120) { /* stop showing secrets */
+ sp->step = 0;
+ sp->direction = LRAND() & 1;
+ }
+ draw_stairs_internal(mi);
+
+ glPopMatrix();
+
+ glFlush();
+
+ glXSwapBuffers(display, window);
+
+ sp->step += 0.025;
+}
+
+void
+change_stairs(ModeInfo * mi)
+{
+ stairsstruct *sp = &stairs[MI_SCREEN(mi)];
+
+ if (!sp->glx_context)
+ return;
+
+ glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(sp->glx_context));
+ pinit(mi);
+}
+
+void
+release_stairs(ModeInfo * mi)
+{
+ if (stairs != NULL) {
+ (void) free((void *) stairs);
+ stairs = NULL;
+ }
+ if (glIsList(objects)) {
+ glDeleteLists(objects, 1);
+ }
+ FreeAllGL(mi);
+}
+
+#endif
-/* -*- Mode: C; tab-width: 4 -*-
- * superquadrics.c --- 3D mathematical shapes
- */
+/* -*- Mode: C; tab-width: 4 -*- */
+/* superquadrics --- 3D mathematical shapes */
+
#if !defined( lint ) && !defined( SABER )
-static const char sccsid[] = "@(#)superquadrics.c 4.04 97/07/28 xlockmore";
+static const char sccsid[] = "@(#)superquadrics.c 4.07 97/11/24 xlockmore";
+
#endif
-/* Permission to use, copy, modify, and distribute this software and its
+
+/*-
+ * Permission to use, copy, modify, and distribute this software and its
* documentation for any purpose and without fee is hereby granted,
* provided that the above copyright notice appear in all copies and that
* both that copyright notice and this permission notice appear in
# define HACK_INIT init_superquadrics
# define HACK_DRAW draw_superquadrics
# define superquadrics_opts xlockmore_opts
-# define DEFAULTS "*count: 25 \n" \
+# define DEFAULTS "*delay: 100 \n" \
+ "*count: 25 \n" \
"*cycles: 40 \n" \
- "*delay: 100 \n" \
"*wireframe: False \n"
# include "xlockmore.h" /* from the xscreensaver distribution */
#else /* !STANDALONE */
ModeSpecOpt superquadrics_opts =
{1, opts, 1, vars, desc};
+#ifdef USE_MODULES
+ModStruct superquadrics_description =
+{"superquadrics", "init_superquadrics", "draw_superquadrics", "release_superquadrics",
+ "refresh_superquadrics", "init_superquadrics", NULL, &superquadrics_opts,
+ 1000, 25, 40, 1, 1.0, "",
+ "Shows 3D mathematical shapes", 0, NULL};
+
+#endif
+
#include <GL/glu.h>
#define MaxRes 50
} state;
typedef struct {
- GLXContext glx_context;
+ GLXContext *glx_context;
int dist, wireframe, flatshade, shownorms, maxcount, maxwait;
int counter, viewcount, viewwait, mono;
GLfloat curmat[4][4], rotx, roty, rotz, spinspeed;
}
if (dostuff & 4) {
if (sp->mono) {
- b = g = r = (GLfloat) (140 + myrand(100)) / 255.0;
- b2 = g2 = r2 = ((r > 0.69) ? (1.0 - r) : r);
+ if (sp->wireframe) {
+ b = g = r = 1.0;
+ b2 = g2 = r2 = 1.0;
+ } else {
+ b = g = r = (GLfloat) (140 + myrand(100)) / 255.0;
+ b2 = g2 = r2 = ((r > 0.69) ? (1.0 - r) : r);
+ }
} else {
r = (GLfloat) (40 + myrand(200)) / 255.0;
g = (GLfloat) (40 + myrand(200)) / 255.0;
sp = &superquadrics[screen];
sp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0);
- sp->glx_context = init_GL(mi);
-
- InitSuperquadrics(MI_WIN_IS_WIREFRAME(mi) || sp->mono, 0,
- MI_BATCHCOUNT(mi), MI_CYCLES(mi), spinspeed, sp);
- ReshapeSuperquadrics(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
+ if ((sp->glx_context = init_GL(mi)) != NULL) {
- DisplaySuperquadrics(sp);
- glFinish();
- glXSwapBuffers(display, window);
-}
+ InitSuperquadrics(MI_WIN_IS_WIREFRAME(mi), 0,
+ MI_BATCHCOUNT(mi), MI_CYCLES(mi), spinspeed, sp);
+ ReshapeSuperquadrics(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi));
-void
-refresh_superquadrics(ModeInfo * mi)
-{
- /* Nothing happens here */
+ DisplaySuperquadrics(sp);
+ glFinish();
+ glXSwapBuffers(display, window);
+ } else {
+ MI_CLEARWINDOW(mi);
+ }
}
void
Display *display = MI_DISPLAY(mi);
Window window = MI_WINDOW(mi);
- glXMakeCurrent(display, window, sp->glx_context);
+ if (!sp->glx_context)
+ return;
+
+ glXMakeCurrent(display, window, *(sp->glx_context));
NextSuperquadricDisplay(sp);
glXSwapBuffers(display, window);
}
+void
+refresh_superquadrics(ModeInfo * mi)
+{
+ /* Nothing happens here */
+}
+
void
release_superquadrics(ModeInfo * mi)
{
if (superquadrics != NULL) {
-
- /* Don't destroy the glXContext. init_GL does that. */
-
(void) free((void *) superquadrics);
superquadrics = NULL;
}
+ FreeAllGL(mi);
}
/* xlock-gc.c --- xscreensaver compatibility layer for xlockmore GL modules.
- * xscreensaver, Copyright (c) 1997 Jamie Zawinski <jwz@netscape.com>
+ * xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
}
-GLXContext
+GLXContext *
init_GL(ModeInfo * mi)
{
Display *dpy = mi->dpy;
}
}
- return (glx_context);
+ /* GLXContext is already a pointer type.
+ Why this function returns a pointer to a pointer, I have no idea...
+ */
+ {
+ GLXContext *ptr = (GLXContext *) malloc(sizeof(GLXContext));
+ *ptr = glx_context;
+ return ptr;
+ }
}
char *defaults [] = {
"Helix.background: black", /* to placate SGI */
"*delay: 5",
- "*eraseSpeed: 400",
- "*eraseMode: -1",
0
};
XrmOptionDescRec options [] = {
{ "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-erase-speed", ".eraseSpeed", XrmoptionSepArg, 0 },
- { "-erase-mode", ".eraseMode", XrmoptionSepArg, 0 },
{ 0 },
};
int options_size = (sizeof (options) / sizeof (options[0]));
# define DEFAULTS "*count: 1000 \n" \
"*cycles: 2500 \n" \
"*delay: 10000 \n" \
- "*ncolors: 200 \n" \
- "*eraseSpeed: 400 \n" \
- "*eraseMode: -1 \n"
+ "*ncolors: 200 \n"
# define SMOOTH_COLORS
# include "xlockmore.h" /* from the xscreensaver distribution */
# include "erase.h"
--- /dev/null
+#define bob_width 61
+#define bob_height 75
+static unsigned char bob_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x07,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xfb,
+ 0x00,0x00,0x00,0xc0,0xff,0xcf,0x9f,0xd1,0x03,0x00,0x00,0xf0,0x7f,0x8c,0x33,
+ 0x91,0x07,0x00,0x00,0xf8,0xa7,0x18,0x27,0xb1,0x06,0x00,0x00,0xfc,0x47,0x31,
+ 0x4e,0xa6,0x0e,0x00,0x00,0xfe,0x4f,0x21,0x4c,0xae,0x3d,0x00,0x00,0xff,0xdf,
+ 0x23,0x8d,0xbe,0x7d,0x00,0x80,0xff,0xff,0x67,0xbd,0xfe,0xff,0x01,0x80,0xff,
+ 0xff,0x7f,0xbf,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,0xbf,0xff,0xf8,0x07,0xc0,
+ 0xff,0xff,0xff,0xbf,0x3f,0xf8,0x07,0xc0,0xff,0xff,0xff,0xff,0x07,0xf8,0x0f,
+ 0xc0,0xff,0xff,0xff,0x3f,0x00,0xf8,0x0f,0xe0,0x7f,0x00,0xf8,0x07,0x00,0xf0,
+ 0x0f,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,
+ 0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf4,0x07,0xe0,0x3f,0x00,0x00,0x00,
+ 0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00,
+ 0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe7,0x07,0xe0,0x3f,0x00,
+ 0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f,
+ 0x00,0x00,0x00,0x00,0xe6,0x07,0xc0,0x3f,0x00,0x00,0x00,0x78,0xf6,0x07,0xa0,
+ 0xbf,0xff,0x00,0x00,0xff,0xf7,0x07,0x70,0x9f,0xff,0x01,0x80,0xff,0xef,0x07,
+ 0xf0,0x1c,0x80,0x03,0xe0,0x01,0xef,0x07,0xf0,0x1f,0xbe,0x07,0xf0,0x3f,0xee,
+ 0x07,0xe0,0x9d,0x83,0x1f,0xf8,0xe1,0xdc,0x07,0xe0,0xc1,0x7f,0x1f,0xfc,0xff,
+ 0xc8,0x07,0xe0,0xc1,0x69,0x1e,0x7e,0xca,0xc0,0x03,0xe0,0x81,0xb8,0x1f,0xc0,
+ 0x0e,0xc0,0x03,0xe0,0x01,0xc0,0x1b,0xc0,0xcf,0xc1,0x03,0xc0,0x03,0xf7,0x11,
+ 0x00,0x7f,0xc0,0x03,0xc0,0x03,0x7c,0x18,0x00,0x1c,0xc0,0x02,0xc0,0x02,0x30,
+ 0x08,0x00,0x00,0x40,0x03,0x40,0x03,0x00,0x08,0x00,0x00,0x40,0x02,0x40,0x13,
+ 0x00,0x0c,0x00,0x00,0x60,0x02,0x40,0x12,0x00,0x0e,0x00,0x00,0xc0,0x03,0x80,
+ 0x33,0x80,0x0e,0x00,0x00,0xa8,0x01,0x00,0x33,0x40,0x0f,0xa0,0x03,0x2c,0x00,
+ 0x00,0x74,0x30,0x0f,0x38,0x07,0x2e,0x00,0x00,0x74,0x98,0x1f,0x1e,0x1e,0x2f,
+ 0x00,0x00,0xfc,0x8f,0xff,0x0f,0xfc,0x2f,0x00,0x00,0xf8,0xe3,0xff,0x03,0xf8,
+ 0x2f,0x00,0x00,0xf8,0xfd,0xff,0x81,0xff,0x3f,0x00,0x00,0xb8,0xf9,0x1f,0xf8,
+ 0x0f,0x1e,0x00,0x00,0x30,0xf1,0xf0,0x0f,0x03,0x0e,0x00,0x00,0x30,0xf1,0x01,
+ 0x80,0x01,0x0f,0x00,0x00,0x20,0xf1,0xf7,0xff,0x00,0x07,0x00,0x00,0x60,0xe3,
+ 0x01,0x60,0x80,0x07,0x00,0x00,0x60,0xc3,0xef,0x3f,0x80,0x03,0x00,0x00,0x40,
+ 0xc2,0xff,0x0f,0xc0,0x03,0x00,0x00,0xc0,0xe6,0x1f,0x00,0xc0,0x01,0x00,0x00,
+ 0x80,0xf4,0xfe,0x3f,0xe0,0x00,0x00,0x00,0x80,0x79,0xfe,0x1f,0xe0,0x00,0x00,
+ 0xc0,0x01,0x3d,0x3e,0x00,0x70,0x00,0x00,0x30,0x06,0x3e,0x0f,0x00,0x38,0x00,
+ 0x00,0xc8,0x8c,0x1f,0x07,0x00,0x38,0x00,0x00,0xf4,0xcc,0x8f,0x07,0x00,0x1c,
+ 0x00,0x00,0x72,0xee,0xf7,0x07,0x00,0x0e,0x00,0x00,0x02,0xff,0xe3,0x07,0x00,
+ 0x07,0x00,0x00,0x32,0xfe,0xc1,0xff,0x8f,0x03,0x00,0x00,0x3e,0xfe,0x80,0xff,
+ 0xff,0x01,0x00,0x00,0x7e,0x7c,0x00,0x00,0x7e,0x00,0x00,0x00,0x7c,0x3c,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfc,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x1c,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00};
--- /dev/null
+#include "colors.inc"
+#include "shapes.inc"
+#include "textures.inc"
+
+/* The following make the field of view as wide as it is high
+ * Thus, you should have the -W and -H command line options
+ * equal to each other. */
+camera {
+ location <5.8, 0, 0>
+ up <0, 1, 0>
+ right <1, 0, 0>
+ look_at <0, 0, 0>
+}
+
+sphere {
+ <0,0,0>, 2.5
+ texture { Blood_Marble
+ scale <2, 2, 2>
+ rotate <0, 20, 0> }
+ finish { Dull }
+}
+
+light_source {<6, 1, 0> color White}
+/* light_source {<6.1, 1, 0> color White} */
--- /dev/null
+/* XPM */
+static char *blood1[] = {
+/* width height ncolors chars_per_pixel */
+"10 10 57 2",
+/* colors */
+"`` c None",
+"`a c #250000",
+"`b c #415050",
+"`c c #013232",
+"`d c #000606",
+"`e c #0E2E2E",
+"`f c #60C0C0",
+"`g c #002020",
+"`h c #102222",
+"`i c #4D5454",
+"`j c #043737",
+"`k c #000505",
+"`l c #65A0A0",
+"`m c #7ED6D6",
+"`n c #196969",
+"`o c #0C4545",
+"`p c #642525",
+"`q c #385C5C",
+"`r c #002525",
+"`s c #6D8686",
+"`t c #354F4F",
+"`u c #5A7D7D",
+"`v c #030A0A",
+"`w c #001E1E",
+"`x c #71B1B1",
+"`y c #274E4E",
+"`z c #287373",
+"a` c #0D1A1A",
+"aa c #053333",
+"ab c #001717",
+"ac c #374343",
+"ad c #000303",
+"ae c #070000",
+"af c #537272",
+"ag c #520B0B",
+"ah c #0C3636",
+"ai c #297D7D",
+"aj c #AF5C5C",
+"ak c #003737",
+"al c #010000",
+"am c #042727",
+"an c #0C3C3C",
+"ao c #000202",
+"ap c #042020",
+"aq c #419A9A",
+"ar c #420707",
+"as c #064949",
+"at c #071212",
+"au c #1D4F4F",
+"av c #154747",
+"aw c #000101",
+"ax c #264747",
+"ay c #002828",
+"az c #000707",
+"b` c #364949",
+"ba c #001414",
+"bb c #002121",
+/* pixels */
+"```````k`aamaeal````",
+"````arahauai`nag`c``",
+"``aw`o`zaqafajaxam`r",
+"``akav`q`f`m`lb`anay",
+"```dahac`u`x`s`t`hab",
+"```aat`y`b`iaqai`ebb",
+"```gaaah`p`yava``jba",
+"````ad`c`vasaaap````",
+"``````aeaz`waoae````",
+"````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood10[] = {
+/* width height ncolors chars_per_pixel */
+"60 60 190 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #010404",
+"`j c #013232",
+"`k c #3C9090",
+"`l c #251A1A",
+"`m c #095454",
+"`n c #190101",
+"`o c #70D0D0",
+"`p c #000606",
+"`q c #003434",
+"`r c #0E2E2E",
+"`s c #001313",
+"`t c #115555",
+"`u c #213030",
+"`v c #60C0C0",
+"`w c #0F0404",
+"`x c #002020",
+"`y c #165D5D",
+"`z c #636A6A",
+"a` c #072A2A",
+"aa c #445C5C",
+"ab c #6C7676",
+"ac c #000C0C",
+"ad c #549393",
+"ae c #001919",
+"af c #102222",
+"ag c #4D5454",
+"ah c #002626",
+"ai c #163535",
+"aj c #043737",
+"ak c #4F6363",
+"al c #000505",
+"am c #65A0A0",
+"an c #052E2E",
+"ao c #041616",
+"ap c #044444",
+"aq c #76C1C1",
+"ar c #7ED6D6",
+"as c #001212",
+"at c #196969",
+"au c #385656",
+"av c #0C4545",
+"aw c #767F7F",
+"ax c #642525",
+"ay c #360505",
+"az c gray28",
+"b` c #5FB4B4",
+"ba c #002C2C",
+"bb c #0E2626",
+"bc c #8C9B9B",
+"bd c #000B0B",
+"be c #030404",
+"bf c #001818",
+"bg c #944040",
+"bh c #280404",
+"bi c #0A0E0E",
+"bj c #385C5C",
+"bk c #002525",
+"bl c #6D8686",
+"bm c #407E7E",
+"bn c #000404",
+"bo c #354F4F",
+"bp c #739999",
+"bq c #001111",
+"br c #5A7D7D",
+"bs c #347272",
+"bt c #030A0A",
+"bu c #5AABAB",
+"bv c #010808",
+"bw c #001E1E",
+"bx c #6E3B3B",
+"by c #71B1B1",
+"bz c #183C3C",
+"c` c #274E4E",
+"ca c #266464",
+"cb c #000A0A",
+"cc c #287373",
+"cd c #0D1A1A",
+"ce c #2B3E3E",
+"cf c #053333",
+"cg c #121515",
+"ch c #270C0C",
+"ci c #001717",
+"cj c #253838",
+"ck c #418888",
+"cl c #374343",
+"cm c #013C3C",
+"cn c #040707",
+"co c #031D1D",
+"cp c #192C2C",
+"cq c #000303",
+"cr c #070000",
+"cs c #164040",
+"ct c #537272",
+"cu c #5B8787",
+"cv c #120E0E",
+"cw c #032A2A",
+"cx c #520B0B",
+"cy c #001010",
+"cz c #062323",
+"d` c #435555",
+"da c #0C3636",
+"db c #8EAFAF",
+"dc c #282A2A",
+"dd c #001D1D",
+"de c #0C1515",
+"df c #515C5C",
+"dg c #1B5555",
+"dh c #297D7D",
+"di c #002A2A",
+"dj c #2B3030",
+"dk c #4F3939",
+"dl c #AF5C5C",
+"dm c #000909",
+"dn c #003737",
+"do c #010000",
+"dp c #001616",
+"dq c #042727",
+"dr c #0C3C3C",
+"ds c #030F0F",
+"dt c #010D0D",
+"du c #002323",
+"dv c #074E4E",
+"dw c #0C4949",
+"dx c #295555",
+"dy c #5E7272",
+"dz c #011A1A",
+"e` c #000202",
+"ea c #55A1A1",
+"eb c #000F0F",
+"ec c #176464",
+"ed c #042020",
+"ee c #0F0000",
+"ef c #001C1C",
+"eg c #8A5B5B",
+"eh c #419A9A",
+"ei c #000808",
+"ej c #205C5C",
+"ek c #420707",
+"el c #064949",
+"em c #041919",
+"en c #0C5C5C",
+"eo c #001515",
+"ep c #071212",
+"eq c #1D4F4F",
+"er c #171B1B",
+"es c #154747",
+"et c #2D8686",
+"eu c #031B1B",
+"ev c #000101",
+"ew c #3C1B1B",
+"ex c #286A6A",
+"ey c #044040",
+"ez c #000E0E",
+"f` c #264747",
+"fa c #0F4E4E",
+"fb c #0D1E1E",
+"fc c #396A6A",
+"fd c #001B1B",
+"fe c gray14",
+"ff c #0C4141",
+"fg c #031414",
+"fh c #011212",
+"fi c #172121",
+"fj c #002828",
+"fk c #060D0D",
+"fl c #063B3B",
+"fm c #2B5C5C",
+"fn c #645C5C",
+"fo c #000707",
+"fp c #343A3A",
+"fq c #396363",
+"fr c #182525",
+"fs c #364949",
+"ft c #001414",
+"fu c #467373",
+"fv c #AA7979",
+"fw c #506969",
+"fx c #022323",
+"fy c #002121",
+"fz c #1C7171",
+"g` c #213E3E",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````ebac`eefahahdi`jahdpe`aleb``````````````````````````````````````````````",
+"``````````````````````````````````````````fodmftev`eacebeobw`x`sfodmfj`qan`jdudi````````````````````````````````````````",
+"````````````````````````````````````du`p``cqdzdufydiebezeobq`ibvevdpbkek`ncr`dchdiefbw``````````````````````````````````",
+"`````````````````````````````````xe`ebalft`qcmapcpeydnfjbfdsdsbtcofxfjcmcmdrek`ndocr`b`eci``````````````````````````````",
+"``````````````````````````````bqebcbalftdicmff`n`davdvapeyajdqbtedajbh`wcr`hcmcmcmaydo`d`bdi````````````````````````````",
+"````````````````````````````e``e`palaediapaicmfleldv`m`melcfa`btanenaydvdvel`jbwfx`q`bdn`ncrbheo````````````````````````",
+"````````````````````````bd`e`easftae`jelapananflel`men`mfffbbidaencxdrcdepfkcnbtbedsfyfd`x`bfjbwei``````````````````````",
+"``````````````````````bneofj`bac`pfg`japcfdqa`da`men`tffffaf`rfsecffcvfbdadwffcfczfgcnbteveo`xeb`ecq````````````````````",
+"````````````````````cbdidn`q`qdudtfgcza`a`dadadrdwfa`aerfrcpecax`ybzercsavfaen`manczemfkbtbqftbqale`cq``````````````````",
+"``````````````````ebbh`nchdnapeycofkbibicd`raififraiaiaiesejfcfzeqfrcseq`t`yatcxenavajeddsfg`bdidpebcyeo````````````````",
+"````````````````cyan`nfrekeebhewcfa`dadacg`aficpeqdgcaeqejcadhdhdxfeg`ecatatcaewecdkcx`mcffgbtdp`jdmfybbcr``````````````",
+"``````````````ciee`b`bfrapcwcfek`mfp`f`taifrbzejdxcaexdxdxccbmdhc`djc`exejatbj`fbo`tecek`medemfhcwdnbqchchdd````````````",
+"``````````````eecycydncmcodsanekeqch`fatececcaexexccbsbsbsetdketbofpfmfmexcaccew`fececchendra`dscfcmdibdchef````````````",
+"`````````````dbqe`dm`bcofgepflchcxdkfzaxagdhexcabsbsbmckehbxeg`kfqclaubsetetdhetbxaxew`faxavdqfkcwelapdpbwbwcb``````````",
+"``````````bqdpbdfdaldsdsaoa`ffecbofz`ydhewfwdhbjfcbmckadazehckfuaaazfcckfnbx`kbmetazfzatatffdecncwapap`qaleecifo````````",
+"``````````cdcbbqbwfhcncnczff`m`ycafzfzetfwbxetbmfuckehdlbuadbrctfwagbmehcubgbr`kfudhca`y`y`adeepczflewcmdiebchbw````````",
+"````````ftduevbf`iedfgczav`fc`bobjfzccdhetbxeh`kehehbpegbucuctctdffwaddldlehbgehetexf`g`csfrcgfbdqflbheeeyddbk`d`e``````",
+"````````cy`xale`fy`jajcxcvekew`laxccdhbs`kegazadadbufvbuamcu`zdycucub`dlfvbxbgehbsbof`fe`hercgbbdaeyel`wcmdi``crbw``````",
+"````````cvdieobkdn`wbhesenecatdkaxbxetetehadbgbubudl`vam`cbl`zblam`v`vbydlbgbl`kbjfpdjdc`hfrerbbffeldc`n`l`b`sbacg``````",
+"``````eodo`qahch`delbzce`t`tdgccewdcbxfpazbxegam`vdlb`byambpblabby`oaq`v`vawbuckclbjfmcecjcper`affdvekfebheydudpfycr````",
+"``````cd`d`adnekekbzdjcv`f`ydgfzbsfudy`zbgdldlbcdbdl`oaqambpblabbpby`v`v`vdldlckazfqfqfmf`g`frfrdw`mewel`wcrdievdp`n````",
+"``````bwee`dcmee`dbhekcxdk`ydgejfmexbs`keheab``v`vdlfv`oaqaqbybpawbpbpbybub``vadaa`gfcfmdxf`cp`aavdvdvel`hayahe`ezdu````",
+"````bqfday`ddnfebhek`mfaescsg`g`cjclbjfuckadbu`v`vdbfvfvararar`obyawaw`camameacuak`gfsbof`g`fierdrfadrelap`qfjalcbddeb``",
+"`````eae`ddnayapekeldabbfberfrcjcefsauaackeaeab`byaq`odbfvfvdbaraqbpabawblcudyakdfaaaufpdjfecper`adadrcfajbadn`eacefem``",
+"````fofy`bbaaycpelancdbiaffr`hg`djfpbod`bmeabuamambybyaqararfvdb`obybpaw`z`zfndfakfcfqcldj`ubzfrcgcddrcfdq`bcmdu```xcv``",
+"````bnbfbwefdncrdranbiafaifrficjdjfsboazfuadeaam`c`cbpbpbyaqarawarbybpbpab`zdyfwfwfubjboce`h`ufrafdefbedfxdq`bfyev`xdz``",
+"````ebfoaccbbwapapdqbidreserfifef`bjauazfucuadam`cblblbpbpbyarfvfv`oaqambl`z`zfwfufuaufpcj`ucjcperafbifkco`bdueocbdpdp``",
+"````cibnbde`dteyela`dedwesfierg`dxaucl`gfubrcucublabblblbpbpaqarfv`o`oby`c`zfwfwaaazfpfpceg`bzaiafbbcdcnfx`bfd`se`dmbf``",
+"````ftfofdfy`papapdqep`rdaaifi`hcececl`gaaakctdybr`zabawabbpbyarfvfv`obybl`zakagd`aabofpcj`u`ucpafcdepbtdscwcidp``cqfy``",
+"````bfasfyefev`japembibbbbfificjdcfpfsaud`agagdffn`zababblbpby`ofvbcbyambr`zakdfaafcaufscj`uerfrafdeepepemdnbabw`s`ebf``",
+"````bfcyefftcbey`jdsdecdafercpg`f`ceclcl`gaaakctfn`zdy`zbl`cbyaqeg`obuamcubrbrfubmbsbjdxcjg`fierfbcdepepan`qdn`bfjfyfo``",
+"````bw`sac`eahayfhfkepdedecgaig`c`dxfsfpauaaakfwfwdydydy`z`zblam`veg`vbyeaadckckehetexf`cj`hercgcdbicncodqcmdnereecrfo``",
+"````cibfe`ei`b`qbeemepbidecgcseqeqexdxfpaud``gdfctbrctcudy`zdybr`cb`fndleg`cblabbg`ketfmg`cpercgdeepcndsed`q`b`dbkdu`s``",
+"````fo`n`edzdn`bbvaoeubifbcdaidgdgcadxdjboboclaaakfwfwctctdfdffwbradawegawbgdkbxdkbxaxfzeqfrcgdebbczaobtedciduee`x`x`n``",
+"````dmee`p`x`dbadtdsedemep`raicsesdgc`dcfsbofsd``gd`agagagdfagdffwctbmckehegegbxbxewdhatcsficgfb`rczcobebtacfyeefycieb``",
+"``````eealfj`n`beodtcoedbi`affescscsg`fecefsfpfp`g`gd`d`d`agagagaaaaaafqbmbmetetaxax`gejcserbbdrfla`cobtdmbqbkdq`sbq````",
+"``````asas`ser`qbfbvdsemfkfbdrfaesbzcp`h`udjdjclbjbjfqfqaa`gazazazclclaubjfcexcacafzaxdg`rcddrdweleydq`i`ifo`bahacdz````",
+"``````acez`eahee`jacbtfgcocfffdwesesbzfrfefedccedxbofqfcfcfcauclclfpfpclfsfmdxc`eqfzecbzcv`rdvdcfecpfxftdmcy`bahbfac````",
+"````````bdcifd`bchdufgaocfeleldwdwesaifrcpfe`hf`cafmexbsfcbsfqfscefsf`djcef`dxeqdgercscdcddrewbhfedrcwfte`ezdi`ddo``````",
+"````````evacfyafan`j`xdqcfdrdv`mavdrdaaicscpbzdgcaccccexcaexexf`cjc`cedccjf`dgecdk`t`acvbbffayekapbabwfoe`e`fyfyfo``````",
+"`````````pei`xdi`j`j`b`jcfajelapda`rdadacs`tatataxewazexc`c`c`cjfecj`u`hes`y`ydxcgfacdbicfdvbhewajcwftdmei``ft`edt``````",
+"````````````ezdd`b`bbb`layeyeyapcfa`drfffa`f`fecbodx`fcaeqg`g`g`frfifrbz`y`ydkcxcedwcdcdfl`w`najfjaecbdmeifoevcq````````",
+"````````````e`eodzchee`ncfeeekapana`a`ffavch`tesc`ax`lecesaibzaicpfifiesc``fceeq`mdabia`flfedadqaeezeicbefdzezei````````",
+"````````````al``e`ef`bba`d`n`dcmdqdqanajelcvdwavencx`f`fescsaibzaibb`ravfpcxcjcxelanfkczcwfl`jcidmbdcy`xcv`dbi``````````",
+"``````````````ev``eveobf`jcrbhfrajananapayela`bbdrfafacxfp`t`tfaavdrff`tewaycvcxflfkaocodq`jduftezbdftcgftee````````````",
+"``````````````evcqbnalcyeo`b`qayaybhfebhapaja`deczffffg`g`dvchdvdvdwdwcvbzcncnekancncofjfxdufycieibf`xeedpal````````````",
+"````````````````bnevevbdcqbq`xbafr`j`jflancoemfkbtdqczana`flelekcxchekflcfelcneydqbeedbk`xdzez`p``asbwefcq``````````````",
+"``````````````````e`bn````cq`e`eftdzdpddfgbtbecncnbefgaoepedcfajflflcwcoedajflcfdpcyfydzacdmbneidmbweffo````````````````",
+"````````````````````cbfoacezbnale`e`acfobde``p`pbebebtbecnfgemdseuaocodqdqdqahdp`pcidpcbevcq``fobdasdo``````````````````",
+"```````````````````````ebqaecifdaccq`pcqaleodubwdddpfgbvdzcwbkfgbt`pfgco`xfdcicbdmddci````al`pdmevcb````````````````````",
+"`````````````````````````e`n`naecieb`e`ecbebbfaedzbwbqdm`sbw`bbkcy`idmcibfeoebeicift`pezeodz`sfgev``````````````````````",
+"``````````````````````````btbqepbwbfdpdpcbcqfodmac`sfobdaseo`xahae`sfo`pacfoevbdbne``eaecv`wee``````````````````````````",
+"````````````````````````````````bneocr`nddbqcycyfocbevbnebdzbwduahbwbf`ee`cqe`dm`sbwcrdpciez````````````````````````````",
+"````````````````````````````````evcqfobqefcvdzcieb```p``alfoeoftdddpdm``dmeicybfeecyezdsfo``````````````````````````````",
+"````````````````````````````````````aleve`alacdzeecveo`sbdcbbqbqal``bneveibqciaebqdo`p``````````````````````````````````",
+"``````````````````````````````````````````cqevcbasbiepcvdpebdmcbal`eei`pcqevcbal````````````````````````````````````````",
+"````````````````````````````````````````````````eb`pbneidmbdcyeeeecycncrcr``````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood11[] = {
+/* width height ncolors chars_per_pixel */
+"72 72 190 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #010404",
+"`j c #013232",
+"`k c #3C9090",
+"`l c #251A1A",
+"`m c #095454",
+"`n c #190101",
+"`o c #70D0D0",
+"`p c #000606",
+"`q c #003434",
+"`r c #0E2E2E",
+"`s c #001313",
+"`t c #115555",
+"`u c #213030",
+"`v c #60C0C0",
+"`w c #0F0404",
+"`x c #002020",
+"`y c #165D5D",
+"`z c #636A6A",
+"a` c #072A2A",
+"aa c #445C5C",
+"ab c #6C7676",
+"ac c #000C0C",
+"ad c #549393",
+"ae c #001919",
+"af c #102222",
+"ag c #4D5454",
+"ah c #002626",
+"ai c #163535",
+"aj c #043737",
+"ak c #4F6363",
+"al c #000505",
+"am c #65A0A0",
+"an c #052E2E",
+"ao c #041616",
+"ap c #044444",
+"aq c #76C1C1",
+"ar c #7ED6D6",
+"as c #001212",
+"at c #196969",
+"au c #385656",
+"av c #0C4545",
+"aw c #767F7F",
+"ax c #642525",
+"ay c #360505",
+"az c gray28",
+"b` c #5FB4B4",
+"ba c #002C2C",
+"bb c #0E2626",
+"bc c #8C9B9B",
+"bd c #000B0B",
+"be c #030404",
+"bf c #001818",
+"bg c #944040",
+"bh c #280404",
+"bi c #0A0E0E",
+"bj c #385C5C",
+"bk c #002525",
+"bl c #6D8686",
+"bm c #407E7E",
+"bn c #000404",
+"bo c #354F4F",
+"bp c #739999",
+"bq c #001111",
+"br c #5A7D7D",
+"bs c #347272",
+"bt c #030A0A",
+"bu c #5AABAB",
+"bv c #010808",
+"bw c #001E1E",
+"bx c #6E3B3B",
+"by c #71B1B1",
+"bz c #183C3C",
+"c` c #274E4E",
+"ca c #266464",
+"cb c #000A0A",
+"cc c #287373",
+"cd c #0D1A1A",
+"ce c #2B3E3E",
+"cf c #053333",
+"cg c #121515",
+"ch c #270C0C",
+"ci c #001717",
+"cj c #253838",
+"ck c #418888",
+"cl c #374343",
+"cm c #013C3C",
+"cn c #040707",
+"co c #031D1D",
+"cp c #192C2C",
+"cq c #000303",
+"cr c #070000",
+"cs c #164040",
+"ct c #537272",
+"cu c #5B8787",
+"cv c #120E0E",
+"cw c #032A2A",
+"cx c #520B0B",
+"cy c #001010",
+"cz c #062323",
+"d` c #435555",
+"da c #0C3636",
+"db c #8EAFAF",
+"dc c #282A2A",
+"dd c #001D1D",
+"de c #0C1515",
+"df c #515C5C",
+"dg c #1B5555",
+"dh c #297D7D",
+"di c #002A2A",
+"dj c #2B3030",
+"dk c #4F3939",
+"dl c #AF5C5C",
+"dm c #000909",
+"dn c #003737",
+"do c #010000",
+"dp c #001616",
+"dq c #042727",
+"dr c #0C3C3C",
+"ds c #030F0F",
+"dt c #010D0D",
+"du c #002323",
+"dv c #074E4E",
+"dw c #0C4949",
+"dx c #295555",
+"dy c #5E7272",
+"dz c #011A1A",
+"e` c #000202",
+"ea c #55A1A1",
+"eb c #000F0F",
+"ec c #176464",
+"ed c #042020",
+"ee c #0F0000",
+"ef c #001C1C",
+"eg c #8A5B5B",
+"eh c #419A9A",
+"ei c #000808",
+"ej c #205C5C",
+"ek c #420707",
+"el c #064949",
+"em c #041919",
+"en c #0C5C5C",
+"eo c #001515",
+"ep c #071212",
+"eq c #1D4F4F",
+"er c #171B1B",
+"es c #154747",
+"et c #2D8686",
+"eu c #031B1B",
+"ev c #000101",
+"ew c #3C1B1B",
+"ex c #286A6A",
+"ey c #044040",
+"ez c #000E0E",
+"f` c #264747",
+"fa c #0F4E4E",
+"fb c #0D1E1E",
+"fc c #396A6A",
+"fd c #001B1B",
+"fe c gray14",
+"ff c #0C4141",
+"fg c #031414",
+"fh c #011212",
+"fi c #172121",
+"fj c #002828",
+"fk c #060D0D",
+"fl c #063B3B",
+"fm c #2B5C5C",
+"fn c #645C5C",
+"fo c #000707",
+"fp c #343A3A",
+"fq c #396363",
+"fr c #182525",
+"fs c #364949",
+"ft c #001414",
+"fu c #467373",
+"fv c #AA7979",
+"fw c #506969",
+"fx c #022323",
+"fy c #002121",
+"fz c #1C7171",
+"g` c #213E3E",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````ftcb`p`eacftasasace`cq````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````cqcqe`foeb`s`x`b`b`bahdpebcqezezasfdcv````````````````````````````````````````````````````",
+"````````````````````````````````````````````````cqevbdal`pdpfycifdbfcyezas`sezevdp`qdodo`nafdibkah``````````````````````````````````````````````",
+"````````````````````````````````````````````ei``ei`pbwdi`xfjbadz`sfhacacbddtbdbddufjapcrayee`day`jfydd``````````````````````````````````````````",
+"````````````````````````````````````````cyeoeibnft`jdncmaiffeydnbacofgdsdsdsfgfyahdicmcmeyfeay`ndo`d`laedz``````````````````````````````````````",
+"````````````````````````````````````ddbdebalcqbfdidnelaycrbhdcelapeyajanfxcnaoaneyayay`d`delapey`h`ddocr`qbkah``````````````````````````````````",
+"``````````````````````````````````cqeoebcqe`aedidn`u`ueyapcj`mdv`mdveyfldqbtedajesekdcewdvap`jbkfjdn`qdndodnbh`n````````````````````````````````",
+"``````````````````````````````foalcbbde`ebci`bey`hapancfcfey`mewen`mdafbdebidrenekdvcfczdqanembtbtfxduahdicmcm`qfydp````````````````````````````",
+"````````````````````````````cbeidzdzfoasdpdq`qdveldqczajeydven`mdwavdrfbcdffceewdwbbbideczcoeufgbtbedzdzcbebbkfjbwbfei``````````````````````````",
+"````````````````````````````cyah`bahcybdbtdqajeycfa`an`ravenen`tffda`rcgdrfsatfa`acdbbdadwdvffajdqemdscnbtcq`sftaee`dme`````````````````````````",
+"````````````````````````cbdu`rdndndndufhbtcodqana`cfdrdaavfafaaificgfraiecewecfa`aafcsesdwenen`manededcndtdtbqci`sfo`pe`cq``````````````````````",
+"``````````````````````ez`b`n`ddndncmajcocnfkembicd`rda`raffifrcpcpcpesdgfzfz`ycserbzeq`t`tendk`f`mdra`cocndsaoah`bbwcqcyebas````````````````````",
+"````````````````````cy`baychayapekekdvajczfbbbbbcvafaieraieqeqeqeqdgcacafcdhejg``hf`ejececat`fch`fchfp`mapaocnfgeddifdfofyfyed``````````````````",
+"``````````````````eo`bbh`jchayayapey`welffenenaverfieraieqeqejexdxc`fmexetfwfmg``uc`exatatfzax`lateneccvenflcofgdseu`qfdezer`nfy````````````````",
+"```````````````````ndifd`jcpcmahedancxenf`chc``tesbzg`dgcacaccccfmdxfmdhbgetfmcjdjdxexcacafzbx`fdk`t`tekew`manaocnbw`qcmfdduaydi````````````````",
+"````````````````cgciebdpdncmfxdsemflcvcechchdkfzfzatexexcaccccbsbsbsbm`kdk`kfcfpclfmcaexcaexdhewewfzat`f`fendrcfbefxcmey`jbn`bfdci``````````````",
+"``````````````fyefeidmas`bedfgaoemavchch`ffzfzewagdhcccaexbsbsbmbm`kehdkeg`kbsbofsbjbsetetdhdhfqbxax`f`l`ffpava`aoedaj`hapbwe`anacfo````````````",
+"``````````````dieifofdacfhbtdscoandwfpdkcaececagfebxdhfcfqbsbmckehbgbxehckfufc`g`gfcbm`kegbxetetdhaafqfzatejavcdepeucfelap`jbq`xdieb````````````",
+"````````````efezfofyaedtbtcnfka`fffa`tatfmecfzdfdfbxetbmfcfcckeh`cazeaadckfufwaaaabmehbxbgbg`ketbmdhfzecec`y`rdebiemcfap`hcm`be``qdias``````````",
+"````````````czcbeibw`ibfbtfkcfelenecfsdkfzfzccetckdk`kbmckck`keadldleacuctbrctagfwadbuegehbxckbretdhcaeqdgdg`adebifba`flbhekfefybq`n`d``````````",
+"```````````efy`pasaceffxcoa`elcxchecboaxfzccccdhetbgbxehehadeadlfvb`adbrdy`zdfctbrbuegbgblbxab`ketexc`cj`ucpficdfba`aneydc`new`jaebk`nbf````````",
+"``````````effy`edmefdqajeyaycncxayewew`fccdhdhdh`kbrbgeaadadb`dlbuam`ccu`zdycucuea`vdldlbxbgcu`kbsbocedj`ucpficgfb`rfleldv`dap`bah`peecd````````",
+"````````eieedifdcydnapaybh`mf`enecatdkaxbxdhet`kehehazaweab`dlbyamam`cab`zblamb``v`vbydldldleackbjfpfpdc`h`hfrerfbdadrdvdcbeekcmdieibafb`n``````",
+"````````aeee`jah`b`dek`ucsg`en`t`t`yd`fedcaxbxbxbxazbgdlb`bpdl`vambyam`cblabam`vdbaq`vbybpbpeafuclaubjcecj`ucpfi`adaav`mekekekaydndzdzbwfx``````",
+"````````cgcr`q`q`lcrfedvg`cv`fec`tdgfzbxaxaxbgegbgbgagdl`vbcdl`vbybybpbpblabbpby`v`o`vb`fvdlbubmazbjfcfmf`g`cjfrfrdafa`mewelbhcrdaddcqcied``````",
+"```````nbk`dcrcm`leebhewcxekay`yeqeqatccccdh`kcuawbub`by`vbcegfv`oaqbybybpawabbpbyby`vb``vdlbpckd`d`fcfqdxdxf`cpfi`rav`m`melek`day`xevfoducv````",
+"``````ci`xayeednay`d`nbhcxg`en`tdgdgeqc`dxfqbsckadadea`v`v`ofvabdbar`o`obybybpawbl`camamamb`bucuaaazbjfqdxdxf``ufiaifa`meldv`hapeybwcqdmfyco````",
+"``````aebwayay`q`dcp`ncj`mfaffbzaig`cjcjcebobjfuckadeab`b``v`ofvfvarararararaqbpawawbl`camamadctakd`clbofsf`cjfier`affavflapapaj`jdudmebeffd````",
+"```````sahaydncmdaewfeapdabbafcger`hcjcjceauauaackeaeabub`byaq`oarbcfvfvdbar`obyblabawblblbrctakdfaabjclfpdjfecpfifibbdadrajajan`j`q`eacbffd````",
+"````bd`efja``bdafeewelanfbdecvfrfi`ug`cjdjfs`gaabmeabuamamambybyaq`oarfvawdbaraqbpblab`z`zfndfdfakfwfqaudjdc`ucjfrercgbbffajedcw`jdn`xcqefbwez``",
+"````foacciahdu`j`n`hapanepde`a`aerfecjdjfpfpcl`gfuadbubuam`cbpbpbpaqaqararfvaraqbpbpbpab`z`zakakakfufqbjcldj`u`uaificdde`randqcw`b`qbk`pftefeo``",
+"````acbdebas`sahdnekapczbi`adaaierfe`hcjboaud`azfucuadamam`c`cbpbpbpbybyarfvdbarbybybpbl`zdydyctfufubjaucedj`h`uaifrcgcdbiaoeddq`bdudzcqacbfft``",
+"````aeeve`fo`pfd`b`dapczdedrfaaifi`h`hc`fmau`g`gfucuad`c`cblblblbpbpbpbyardbawaraqaqby`cdy`zakfwfwfcbjclfpcjcjcjbzfrfb`abifkemcw`jfddpcqe``sci``",
+"````eebnbdez`pdmcwbhapdqdeavdwbzerfig`dxdxfscld`fubrcucucuababawblblbpbyaqardbfv`o`oby`c`z`zfwfwagazclfpcececjcjbz`afbbbfbcnaoan`beoase`ev`seo``",
+"`````ncbbqeffyevahayeyczep`rdaaicpfi`hcecefpbo`gaaakfwdydybr`zabababawbpby`odbfvaq`obybldyakakagd`aaaucldjcj`u`ucp`afbfbepfkcnedbaftdpcqe`ac`s``",
+"````crbddpfybwfofxaycfeubibb`rbbfifr`udcdjclaud`aadfagak`z`z`zababblblbpby`ofvfv`obyambrdydfagagaafcaubocedj`herfiafdebibifkdsdq`qdibw`sbqe`dp``",
+"````eeeidpfd`scqfybhcwepepfbafafercpg`g`cefpfsclazagakfwfwfn`zababab`camby`ofvfv`vbuamcubrctctfufubsfqfmf`cjg`cperaffbdedefkedcf`qdndifydudmbf``",
+"````eeeiezftftebdndnfkbtaocddeaferaig`c`f`cefsfp`gaaakctfwdfdydy`z`zabbl`cby`veg`vb`b`eaadcubmbmckbmfcdxcecj`uficgcgfbbifkemfxdn`qcm`q`bdobfbd``",
+"````fkftftfo`pfyeeahbefgepepbicgercsesf`fmfmfsfpauaad`dfakctdydybrdy`z`zbl`cbu`vfnfvdlb`eaad`k`kck`kdhcaf`cjfrerercvdebifkfgco`jcm`qayaydi`xfo``",
+"````acfdeoeidmahfifxbtemepcncdcvafesdgeqcacac`fpboau`gd`akctbrctbrbrdyfn`zbrcuea`vfndlfnbgadbgbgbxfnetccc`g`cpercgcvdedecncnfg`b`bdi`nahducrdm``",
+"``````cveocydzbacmcobtemeucncdfbafcsdgdgcaejc`djbobocl`gaafwfwfwctctfwdfdfakbrcueadlegegabbxbxbxdkbxaxaxejesfrcgcgfbbbczaofgaodzbwaheefybwdz````",
+"``````fdbwcbbwficmdpe`aoedembi`a`aaicsesdgeqf`djfsbofs`gaad`aaagdfdfdfdfagdffwctbmckehehabbgegbgbgdcdhfcejcsficgdebbanczcodsdsebebah`nfyfyeo````",
+"``````ez`xevahdo`qbwdtcncoczepfbdaffcsbzesf`g`dccefsfsclfpazazaz`gagagagagagakakakakfuck`k`kckfuaxaxagfzejbzercd`rdacfczcodtbvbv`sahafcidzbf````",
+"``````cb`n`pfyaydnbkebbtaoedepep`rfffaescsai`ufecjcefpfpfsbjbjfqaaaad`d``g`g`g`g`g`gaufqbsbsbsccdhdhewateqcpcg`adreleycfedbtbvbvdp`bbacy`s`w````",
+"````````ddbdcb`b`d`bft`ibtembtem`rdadwesesbzcp`h`hdcdcfpbobjbjfqfcfcbjd`azclfsclfpclbobofmcafmfmejateweccsafbbffdvelelflfxbtalaleobhdudm`n``````",
+"````````ei`p`ebw`lerdidtbvdsdsandaffdwdwesesaififefefedjc`dxbobjfcbsfcfcaufsclfpfpfpfpcldxfmdxc`eqatdkes`rcdda`mcxbzelaibkbfdte`bfcvfjdpae``````",
+"````````cb`eciefah`ndnfdfgaocwapeldvdwdwdwaiaifrcpfefecjdxcafmexbsbsfcbsfqbodjfsfscedjcecedxeqeqdg`f`t`rcgfbdrg``newaieycwcievalascg`d`ne```````",
+"``````````e``ebw`bdoaydiddfxcwap`udvdvdwdrdaaiaibzcp`ug`ejcaccccccexexexexc`djc`c`cjdccjg`eqdgecfsecbzcdcdbbdrekbhekfl`bddezdmevcqdu`dfd````````",
+"``````````al`pfybk`n`b`qdi`b`jflapeleldada`rdaaicseseq`yatexaxagcccafmdxfmf`dccjf``u`hg`dgej`yecew`y`acdcd`rav`nekapanahaealalevfofdase`````````",
+"````````````aldpbwdi`bba`q`qdncmajapeyajcfa`dadres`ydkew`lewewaxfzejg`g`g`g``hfe`uer`ues`y`ycl`l`f`t`abicdeybhdcayey`bahebfodmfoeveial``````````",
+"````````````fobdeffy`d`j`lee`n`nayapapcfananffavfa`fcx`tecdxecew`f`yesbzcsbzcpfrercpbz`y`yf`ewf`eqdwbbepa`ey`n`wajfjfycydmbdeiac`e`pfo``````````",
+"``````````````evcbftbwcz`d`ddnbhbhayapana`ana`ffavew`tdwfaf`dk`lfsdgbzaibzaicpfierfres`y`fchenf``mdrcdcocfflaicp`bfdbqbddmcbbfbkdzac````````````",
+"``````````````cqbneial`x`bdifiaydobhcmcwczananajelch`mavfa`tcx`fcg`tcsbzaibzai`rbbaiav`tcvfpdcewelcfepemdqcwfl`qfyac`p`ecybw`n`naeee````````````",
+"```````````````````pe`alaebwdieedobhcmajcwcwcfapewewdaa`daavfafadjek`tfafafaavdrdrff`mdjchchcxeweyemdsemeddq`jfyfdcyac`e`sfjbwbwee``````````````",
+"````````````````````ale`fo`sft`j`q`deeficmey`lcnekeyajedfbdadwav`mchdjchekfafaavavdwewcvcvek`wekcfdsemeddqfxdifyfdciacciddcoaeas````````````````",
+"``````````````````e`evevfoezdmbqfyah`q`day`rbhayeyancwepfkedcfdaffeldrffewchdvdvg`djdceyelcnbhaicwbeaocwfxfy`xbfacfoalaebweebf``````````````````",
+"````````````````````bne```foe`bnebbwdu`jbaah`b`bfxemdsbedscnemeuedczdqajapfeay`wbzapana`flewfeeyfx`idpah`xciezcbevcqfoas`naobn``````````````````",
+"``````````````````````cqfo``e`ev`paceiacdpbfcydzfhbtbebebebebedsfgdsfkemdqananajanczededcfcmcmcwfhezfydzcifofoe``pev`sbwepei````````````````````",
+"````````````````````````cbeicbacaccqalbnevdmacfobde``pbv`pbebebtcnbebtaoembtememaocodqdqahcwfyfh`peodzezalevcqe`eialcbeodo``````````````````````",
+"``````````````````````````accyeoftbfdzac``eibdbn`pfhddbwdddzfgdsbvdsbwbadqfgbv`idtdzedfxbwdzeodmcbfdfdacale`e```aleibnac````````````````````````",
+"`````````````````````````````eci`n`xciftbdei`pdmbdbddzbkfdef`x`sbdebciducwdudpac`pbddpfddzbfbdalebdzcycqdmcyaeasftacbn``````````````````````````",
+"``````````````````````````````btcrcrddefaecibqbqe`eiasfteb`sdpeb`idmeoefahfyeodt`i`iebci`eace``sac`pe`bddpbffddo`w``````````````````````````````",
+"``````````````````````````````````cbeb`nbwddddbfezdm`pacfodmbdbnevcb`sdpdzahduefascbfoe`bnbnale`bn`pasdz`nef`nas````````````````````````````````",
+"````````````````````````````````````alevcbaeeedobwdpcyftcydmeie```ei`sdd`xbkahfjfdeodme`bn`pcbezdpefdoaeezdocb``````````````````````````````````",
+"````````````````````````````````````````cq``bdbqefcrdzci`s`e``focqcqbncbeoftfdefcyei``eidmbdftefeeasasbqcb``````````````````````````````````````",
+"````````````````````````````````````````````e```al`pbdddee`xddasebacbdbdasebfoe`evbnev`pebbfemciebcyez``````````````````````````````````````````",
+"````````````````````````````````````````````````evevevalbqdzeeeebwdpezezcbcydmaldmeibncqevdmasfkbn``````````````````````````````````````````````",
+"``````````````````````````````````````````````````````accqbdebcyeoeedpbqbqasezdmbdbdezacale`````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````cncbev``evbndmaccrdocb````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood2[] = {
+/* width height ncolors chars_per_pixel */
+"12 12 81 2",
+/* colors */
+"`` c None",
+"`a c #002E2E",
+"`b c #250000",
+"`c c #000D0D",
+"`d c #212A2A",
+"`e c #000606",
+"`f c #213030",
+"`g c #636A6A",
+"`h c #072A2A",
+"`i c #445C5C",
+"`j c #4D5454",
+"`k c #163535",
+"`l c #000505",
+"`m c #052E2E",
+"`n c #041616",
+"`o c #044444",
+"`p c #76C1C1",
+"`q c #0C4545",
+"`r c #767F7F",
+"`s c #002C2C",
+"`t c #000B0B",
+"`u c #030404",
+"`v c #280404",
+"`w c #385C5C",
+"`x c #354F4F",
+"`y c #001111",
+"`z c #347272",
+"a` c #6E3B3B",
+"aa c #71B1B1",
+"ab c #000A0A",
+"ac c #270C0C",
+"ad c #001717",
+"ae c #253838",
+"af c #418888",
+"ag c #013C3C",
+"ah c #192C2C",
+"ai c #000303",
+"aj c #164040",
+"ak c #032A2A",
+"al c #520B0B",
+"am c #001010",
+"an c #435555",
+"ao c #0C3636",
+"ap c #8EAFAF",
+"aq c #282A2A",
+"ar c #515C5C",
+"as c #1B5555",
+"at c #002A2A",
+"au c #2B3030",
+"av c #4F3939",
+"aw c #AF5C5C",
+"ax c #003737",
+"ay c #010000",
+"az c #001616",
+"b` c #042727",
+"ba c #0C3C3C",
+"bb c #030F0F",
+"bc c #002323",
+"bd c #0C4949",
+"be c #011A1A",
+"bf c #176464",
+"bg c #0F0000",
+"bh c #001C1C",
+"bi c #8A5B5B",
+"bj c #419A9A",
+"bk c #064949",
+"bl c #041919",
+"bm c #001515",
+"bn c #071212",
+"bo c #031B1B",
+"bp c #044040",
+"bq c #0F4E4E",
+"br c gray14",
+"bs c #031414",
+"bt c #063B3B",
+"bu c #2B5C5C",
+"bv c #396363",
+"bw c #182525",
+"bx c #001414",
+"by c #506969",
+"bz c #002121",
+/* pixels */
+"````````bxbpbbagay``````",
+"````abbc`hbqbfaj`m`yai``",
+"`````aac`j`zbi`za``q`o``",
+"``at`vavbjaw`gaa`wbwaq`s",
+"``axaoaeaf`pap`rarbrba`c",
+"``bzbn`d`i`gaaaaan`fbnaz",
+"``beboas`xbyarbiavbw`nbg",
+"``adbsbdahbubvauasbaak`b",
+"`````aagbkal`k`qbkbtam``",
+"````ab`l`t`ublb``eaiay``",
+"````````bh``bm``bg``````",
+"````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood3[] = {
+/* width height ncolors chars_per_pixel */
+"14 14 101 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #250000",
+"`c c #5D1616",
+"`d c #415050",
+"`e c #010404",
+"`f c #3C9090",
+"`g c #251A1A",
+"`h c #095454",
+"`i c #190101",
+"`j c #70D0D0",
+"`k c #000606",
+"`l c #60C0C0",
+"`m c #165D5D",
+"`n c #636A6A",
+"`o c #072A2A",
+"`p c #6C7676",
+"`q c #000C0C",
+"`r c #102222",
+"`s c #4D5454",
+"`t c #163535",
+"`u c #043737",
+"`v c #4F6363",
+"`w c #044444",
+"`x c #76C1C1",
+"`y c #001212",
+"`z c #0C4545",
+"a` c #767F7F",
+"aa c #642525",
+"ab c #360505",
+"ac c #000B0B",
+"ad c #385C5C",
+"ae c #6D8686",
+"af c #000404",
+"ag c #001111",
+"ah c #030A0A",
+"ai c #5AABAB",
+"aj c #001E1E",
+"ak c #6E3B3B",
+"al c #71B1B1",
+"am c #274E4E",
+"an c #0D1A1A",
+"ao c #2B3E3E",
+"ap c #053333",
+"aq c #121515",
+"ar c #270C0C",
+"as c #418888",
+"at c #374343",
+"au c #013C3C",
+"av c #040707",
+"aw c #031D1D",
+"ax c #192C2C",
+"ay c #000303",
+"az c #070000",
+"b` c #164040",
+"ba c #537272",
+"bb c #120E0E",
+"bc c #001010",
+"bd c #062323",
+"be c #282A2A",
+"bf c #0C1515",
+"bg c #515C5C",
+"bh c #1B5555",
+"bi c #002A2A",
+"bj c #2B3030",
+"bk c #4F3939",
+"bl c #000909",
+"bm c #003737",
+"bn c #010000",
+"bo c #001616",
+"bp c #042727",
+"bq c #030F0F",
+"br c #074E4E",
+"bs c #0C4949",
+"bt c #011A1A",
+"bu c #55A1A1",
+"bv c #000F0F",
+"bw c #042020",
+"bx c #419A9A",
+"by c #064949",
+"bz c #1D4F4F",
+"c` c #2D8686",
+"ca c #000101",
+"cb c #286A6A",
+"cc c #044040",
+"cd c #001B1B",
+"ce c #0C4141",
+"cf c #031414",
+"cg c #011212",
+"ch c #172121",
+"ci c #002828",
+"cj c #2B5C5C",
+"ck c #000707",
+"cl c #343A3A",
+"cm c #182525",
+"cn c #364949",
+"co c #AA7979",
+"cp c #506969",
+"cq c #002121",
+"cr c #1C7171",
+"cs c #213E3E",
+/* pixels */
+"``````````cqcqagbiab````````",
+"``````ajawbd`h`ranbdcfbc````",
+"`````bbmaochcbc`cjaaarcf`b``",
+"`````e`zcr`fbxbaas`fbhbfcc``",
+"``bnby`mbjak`lae`jbuam`abebt",
+"``ar`wcmataialcoa`bgatchbw`k",
+"``bt`u`tclcp`pal`x`vclaxavck",
+"``blahbbcb`dba`n`sbkcbaqbqci",
+"``afcgbdb`beadcnatcjbzbrck`q",
+"`````occ`o`c`gcsaxarbfaubl``",
+"````caciazapcebbbsabci`yaw``",
+"``````btafcdbobpbvbl``ag````",
+"``````````acbv`yay`i````````",
+"````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood4[] = {
+/* width height ncolors chars_per_pixel */
+"20 20 144 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #013232",
+"`j c #095454",
+"`k c #70D0D0",
+"`l c #000606",
+"`m c #0E2E2E",
+"`n c #001313",
+"`o c #115555",
+"`p c #213030",
+"`q c #60C0C0",
+"`r c #002020",
+"`s c #445C5C",
+"`t c #6C7676",
+"`u c #000C0C",
+"`v c #549393",
+"`w c #102222",
+"`x c #4D5454",
+"`y c #002626",
+"`z c #163535",
+"a` c #043737",
+"aa c #4F6363",
+"ab c #000505",
+"ac c #65A0A0",
+"ad c #052E2E",
+"ae c #044444",
+"af c #7ED6D6",
+"ag c #001212",
+"ah c #196969",
+"ai c #385656",
+"aj c #0C4545",
+"ak c #767F7F",
+"al c #642525",
+"am c #002C2C",
+"an c #0E2626",
+"ao c #030404",
+"ap c #001818",
+"aq c #0A0E0E",
+"ar c #385C5C",
+"as c #002525",
+"at c #6D8686",
+"au c #000404",
+"av c #354F4F",
+"aw c #739999",
+"ax c #001111",
+"ay c #5A7D7D",
+"az c #347272",
+"b` c #030A0A",
+"ba c #010808",
+"bb c #001E1E",
+"bc c #6E3B3B",
+"bd c #71B1B1",
+"be c #183C3C",
+"bf c #274E4E",
+"bg c #000A0A",
+"bh c #287373",
+"bi c #0D1A1A",
+"bj c #053333",
+"bk c #270C0C",
+"bl c #001717",
+"bm c #253838",
+"bn c #418888",
+"bo c #374343",
+"bp c #013C3C",
+"bq c #040707",
+"br c #031D1D",
+"bs c #192C2C",
+"bt c #000303",
+"bu c #070000",
+"bv c #164040",
+"bw c #537272",
+"bx c #5B8787",
+"by c #120E0E",
+"bz c #032A2A",
+"c` c #520B0B",
+"ca c #0C3636",
+"cb c #001D1D",
+"cc c #0C1515",
+"cd c #297D7D",
+"ce c #002A2A",
+"cf c #AF5C5C",
+"cg c #000909",
+"ch c #003737",
+"ci c #010000",
+"cj c #001616",
+"ck c #042727",
+"cl c #0C3C3C",
+"cm c #030F0F",
+"cn c #002323",
+"co c #074E4E",
+"cp c #0C4949",
+"cq c #295555",
+"cr c #5E7272",
+"cs c #011A1A",
+"ct c #000202",
+"cu c #55A1A1",
+"cv c #000F0F",
+"cw c #176464",
+"cx c #042020",
+"cy c #0F0000",
+"cz c #001C1C",
+"d` c #8A5B5B",
+"da c #419A9A",
+"db c #420707",
+"dc c #064949",
+"dd c #0C5C5C",
+"de c #001515",
+"df c #071212",
+"dg c #1D4F4F",
+"dh c #154747",
+"di c #2D8686",
+"dj c #000101",
+"dk c #3C1B1B",
+"dl c #286A6A",
+"dm c #044040",
+"dn c #000E0E",
+"do c #264747",
+"dp c #396A6A",
+"dq c #001B1B",
+"dr c gray14",
+"ds c #0C4141",
+"dt c #031414",
+"du c #172121",
+"dv c #002828",
+"dw c #060D0D",
+"dx c #063B3B",
+"dy c #2B5C5C",
+"dz c #000707",
+"e` c #343A3A",
+"ea c #182525",
+"eb c #364949",
+"ec c #001414",
+"ed c #AA7979",
+"ee c #506969",
+"ef c #002121",
+"eg c #1C7171",
+"eh c #213E3E",
+/* pixels */
+"``````````````dzdjcv`rcgadce````````````",
+"``````````axabbp`daecka`bubpcice````````",
+"````````de`u`ick`jds`mdscabjbqde`e``````",
+"``````addbdkca`adgdgcddrahdkc`dt`ian````",
+"`````dcgdtbkegcdazbnd`bodididkajbzcjbg``",
+"````djcxajavbhbcdad`bweecfdadoeackcyas``",
+"``de`ydc`obhbcbc`qbdat`k`qbndybsdsdrcnbu",
+"``dqchdbdhehar`v`qedafakacbxebehcldcdvcb",
+"``apchad`zbmav`v`cawafbd`teear`h`wcx`b`r",
+"``dz`lckca`hboaaayakbdedat`xav`p`wb`blbt",
+"```n`ydwcceheb`seecratd`cubndl`hbibrchbu",
+"``cy`dcmdfbvbfav`g`x`xbwdabccddu`maoefbl",
+"```u`y`ubrcpbedrcqdpaie`ebbfcw`mdrec`b`u",
+"`````r`ibjaeca`oaldlbfbmdhcqbicoa`cgec``",
+"````abcz`dbpadbydd`f`zane`c`dwdxcg`raq``",
+"``````djbtam`ibrb`addcbkbjdmcxcs``cz````",
+"````````axdq`ldecbbaas`l`rbgblabdj``````",
+"````````````buaxdzaubbbbctcgbudn````````",
+"``````````````btagbycg`ebtab````````````",
+"````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood5[] = {
+/* width height ncolors chars_per_pixel */
+"24 24 170 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #013232",
+"`j c #3C9090",
+"`k c #251A1A",
+"`l c #095454",
+"`m c #190101",
+"`n c #000606",
+"`o c #003434",
+"`p c #0E2E2E",
+"`q c #001313",
+"`r c #115555",
+"`s c #213030",
+"`t c #60C0C0",
+"`u c #0F0404",
+"`v c #002020",
+"`w c #165D5D",
+"`x c #636A6A",
+"`y c #072A2A",
+"`z c #445C5C",
+"a` c #6C7676",
+"aa c #000C0C",
+"ab c #001919",
+"ac c #102222",
+"ad c #4D5454",
+"ae c #002626",
+"af c #163535",
+"ag c #4F6363",
+"ah c #000505",
+"ai c #65A0A0",
+"aj c #052E2E",
+"ak c #041616",
+"al c #044444",
+"am c #76C1C1",
+"an c #7ED6D6",
+"ao c #196969",
+"ap c #385656",
+"aq c #0C4545",
+"ar c #767F7F",
+"as c #642525",
+"at c #360505",
+"au c #5FB4B4",
+"av c #002C2C",
+"aw c #8C9B9B",
+"ax c #000B0B",
+"ay c #030404",
+"az c #001818",
+"b` c #280404",
+"ba c #0A0E0E",
+"bb c #385C5C",
+"bc c #002525",
+"bd c #407E7E",
+"be c #354F4F",
+"bf c #739999",
+"bg c #001111",
+"bh c #5A7D7D",
+"bi c #347272",
+"bj c #030A0A",
+"bk c #5AABAB",
+"bl c #010808",
+"bm c #001E1E",
+"bn c #6E3B3B",
+"bo c #71B1B1",
+"bp c #274E4E",
+"bq c #266464",
+"br c #000A0A",
+"bs c #2B3E3E",
+"bt c #053333",
+"bu c #121515",
+"bv c #270C0C",
+"bw c #001717",
+"bx c #253838",
+"by c #418888",
+"bz c #374343",
+"c` c #013C3C",
+"ca c #040707",
+"cb c #031D1D",
+"cc c #192C2C",
+"cd c #000303",
+"ce c #070000",
+"cf c #164040",
+"cg c #537272",
+"ch c #5B8787",
+"ci c #120E0E",
+"cj c #032A2A",
+"ck c #520B0B",
+"cl c #001010",
+"cm c #062323",
+"cn c #435555",
+"co c #0C3636",
+"cp c #8EAFAF",
+"cq c #282A2A",
+"cr c #001D1D",
+"cs c #0C1515",
+"ct c #515C5C",
+"cu c #1B5555",
+"cv c #297D7D",
+"cw c #002A2A",
+"cx c #2B3030",
+"cy c #4F3939",
+"cz c #AF5C5C",
+"d` c #000909",
+"da c #003737",
+"db c #010000",
+"dc c #001616",
+"dd c #042727",
+"de c #0C3C3C",
+"df c #030F0F",
+"dg c #010D0D",
+"dh c #002323",
+"di c #074E4E",
+"dj c #0C4949",
+"dk c #295555",
+"dl c #5E7272",
+"dm c #011A1A",
+"dn c #000202",
+"do c #000F0F",
+"dp c #176464",
+"dq c #042020",
+"dr c #0F0000",
+"ds c #001C1C",
+"dt c #8A5B5B",
+"du c #419A9A",
+"dv c #000808",
+"dw c #205C5C",
+"dx c #420707",
+"dy c #064949",
+"dz c #041919",
+"e` c #0C5C5C",
+"ea c #001515",
+"eb c #071212",
+"ec c #1D4F4F",
+"ed c #171B1B",
+"ee c #154747",
+"ef c #2D8686",
+"eg c #031B1B",
+"eh c #000101",
+"ei c #3C1B1B",
+"ej c #286A6A",
+"ek c #044040",
+"el c #000E0E",
+"em c #264747",
+"en c #0F4E4E",
+"eo c #0D1E1E",
+"ep c #001B1B",
+"eq c gray14",
+"er c #031414",
+"es c #172121",
+"et c #060D0D",
+"eu c #063B3B",
+"ev c #2B5C5C",
+"ew c #000707",
+"ex c #343A3A",
+"ey c #396363",
+"ez c #182525",
+"f` c #364949",
+"fa c #001414",
+"fb c #467373",
+"fc c #AA7979",
+"fd c #506969",
+"fe c #002121",
+"ff c #1C7171",
+"fg c #213E3E",
+/* pixels */
+"``````````````````cdew`v`bdoelci````````````````",
+"``````````````eafac`ekcbdffec`eqdbab````````````",
+"``````````ewaxbw`hbt`l`lcse`btajbjaec`dc````````",
+"````````brdadhcb`ycoenbudpencfe`ajcabgewcd``````",
+"``````ea`iat`ue`edafdwbpeffgejffaocicbegelfe````",
+"``````dv`bakbvffadbqbi`jdtbebicvbn`kaqdqalaj````",
+"````cmbmbjdyf`ffbybd`jczcgadbkbnefec`aeob`fe`d``",
+"````cwdab`e`cycvduarczai`xauboczbbcqezcocqc`av``",
+"```mcedrck`waocvarbodtambfbf`tczcneyem`p`l`dehci",
+"```qdaeicobubxapbybkamawcpboarbhctbzeqesdeaj`eep",
+"``ax`qdxbaaf`hapfbai`cbfananbfdlfbap`hezbadddmaz",
+"``brfeatebaf`hex`zdl`xa`bofcboagcnbz`s`aebdqdcaa",
+"``dvfadaakacfgbs`gcgdl`x`cdtauchbydk`sbuetda`oaz",
+"``cidmcbegeocudwbe`gfdcgctchdtbncyasezeoakdmdrdm",
+"``brfebcakebenafbxexbb`z`g`gapbicvaobudydqblav`u",
+"````bw`meraldjafccbxevbieyf`cxdkcu`pdeeicjah`d``",
+"````ahcw`oc`ek`yeeeieidwfgeq`s`w`fbab`ekdoewah``",
+"``````dv`batc`ajdyaqck`raf`paqexdydzeuaacl`m````",
+"``````dnewbg`o`pekebbtdyeidicqcacjcj`vewbm``````",
+"````````braaahd`axblayaydzdzddcj`nelcdahdb``````",
+"``````````bjcrbwdnfadcd`aedgdoaaaaaxep``````````",
+"````````````````dsbw``cdeads``axdrbg````````````",
+"``````````````````aadodrbgd`eldn````````````````",
+"````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood6[] = {
+/* width height ncolors chars_per_pixel */
+"30 30 183 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #010404",
+"`j c #013232",
+"`k c #3C9090",
+"`l c #251A1A",
+"`m c #095454",
+"`n c #190101",
+"`o c #70D0D0",
+"`p c #000606",
+"`q c #003434",
+"`r c #0E2E2E",
+"`s c #001313",
+"`t c #115555",
+"`u c #213030",
+"`v c #60C0C0",
+"`w c #0F0404",
+"`x c #002020",
+"`y c #165D5D",
+"`z c #636A6A",
+"a` c #072A2A",
+"aa c #445C5C",
+"ab c #6C7676",
+"ac c #000C0C",
+"ad c #549393",
+"ae c #001919",
+"af c #102222",
+"ag c #4D5454",
+"ah c #002626",
+"ai c #163535",
+"aj c #043737",
+"ak c #4F6363",
+"al c #000505",
+"am c #65A0A0",
+"an c #052E2E",
+"ao c #041616",
+"ap c #044444",
+"aq c #76C1C1",
+"ar c #7ED6D6",
+"as c #001212",
+"at c #196969",
+"au c #385656",
+"av c #0C4545",
+"aw c #767F7F",
+"ax c #642525",
+"ay c #360505",
+"az c gray28",
+"b` c #000B0B",
+"ba c #030404",
+"bb c #001818",
+"bc c #944040",
+"bd c #280404",
+"be c #0A0E0E",
+"bf c #385C5C",
+"bg c #002525",
+"bh c #6D8686",
+"bi c #407E7E",
+"bj c #000404",
+"bk c #354F4F",
+"bl c #739999",
+"bm c #001111",
+"bn c #5A7D7D",
+"bo c #347272",
+"bp c #030A0A",
+"bq c #5AABAB",
+"br c #001E1E",
+"bs c #6E3B3B",
+"bt c #71B1B1",
+"bu c #183C3C",
+"bv c #274E4E",
+"bw c #266464",
+"bx c #000A0A",
+"by c #287373",
+"bz c #0D1A1A",
+"c` c #2B3E3E",
+"ca c #053333",
+"cb c #121515",
+"cc c #270C0C",
+"cd c #001717",
+"ce c #253838",
+"cf c #418888",
+"cg c #374343",
+"ch c #013C3C",
+"ci c #040707",
+"cj c #031D1D",
+"ck c #192C2C",
+"cl c #000303",
+"cm c #070000",
+"cn c #164040",
+"co c #537272",
+"cp c #5B8787",
+"cq c #120E0E",
+"cr c #032A2A",
+"cs c #520B0B",
+"ct c #001010",
+"cu c #062323",
+"cv c #435555",
+"cw c #0C3636",
+"cx c #8EAFAF",
+"cy c #282A2A",
+"cz c #001D1D",
+"d` c #0C1515",
+"da c #515C5C",
+"db c #1B5555",
+"dc c #297D7D",
+"dd c #002A2A",
+"de c #2B3030",
+"df c #4F3939",
+"dg c #AF5C5C",
+"dh c #000909",
+"di c #003737",
+"dj c #010000",
+"dk c #001616",
+"dl c #042727",
+"dm c #0C3C3C",
+"dn c #030F0F",
+"do c #010D0D",
+"dp c #002323",
+"dq c #074E4E",
+"dr c #0C4949",
+"ds c #295555",
+"dt c #5E7272",
+"du c #011A1A",
+"dv c #000202",
+"dw c #55A1A1",
+"dx c #000F0F",
+"dy c #176464",
+"dz c #042020",
+"e` c #0F0000",
+"ea c #001C1C",
+"eb c #8A5B5B",
+"ec c #419A9A",
+"ed c #000808",
+"ee c #205C5C",
+"ef c #420707",
+"eg c #064949",
+"eh c #041919",
+"ei c #0C5C5C",
+"ej c #001515",
+"ek c #071212",
+"el c #1D4F4F",
+"em c #171B1B",
+"en c #154747",
+"eo c #2D8686",
+"ep c #031B1B",
+"eq c #000101",
+"er c #3C1B1B",
+"es c #286A6A",
+"et c #044040",
+"eu c #000E0E",
+"ev c #264747",
+"ew c #0F4E4E",
+"ex c #0D1E1E",
+"ey c #396A6A",
+"ez c #001B1B",
+"f` c gray14",
+"fa c #0C4141",
+"fb c #031414",
+"fc c #172121",
+"fd c #002828",
+"fe c #060D0D",
+"ff c #063B3B",
+"fg c #2B5C5C",
+"fh c #645C5C",
+"fi c #000707",
+"fj c #343A3A",
+"fk c #396363",
+"fl c #182525",
+"fm c #364949",
+"fn c #001414",
+"fo c #467373",
+"fp c #AA7979",
+"fq c #506969",
+"fr c #002121",
+"fs c #1C7171",
+"ft c #213E3E",
+/* pixels */
+"````````````````````````dx`eahddahdvdx``````````````````````",
+"``````````````````dp``dufrdxej`ieqbg`n`dddbr````````````````",
+"````````````````dxalddfa`ddqetdldzbdcmchchdj`b``````````````",
+"````````````b``efn`japanegeifabeeidmekcibafr`xfded``````````",
+"``````````bxdi`qdocua`cwdr`afldy`yemaveianehbpfnalcl````````",
+"````````ct`nefbdcacwcbfcelbweedcdsftatbwdycscabp`jfrcm``````",
+"````````ctdicjanel`fdybwesbobodfbkfgesby`fdyeia`caddcc``````",
+"``````dkezdnaofabk`yerdceycfazcfaaeyfh`keofsatd`crapalcd````",
+"````fneq`ifbavbvbfbyeoececblbqcodaaddgbceoevcncbdlbdetbg`e``",
+"````cqejdibdeiataxeoecbcbq`v`c`zam`vdgbhbfde`hemfacy`l`scb``",
+"`````ddiefde`fdbbodtbcdgcx`oambhbl`v`vdgazfkevfldrer`wdddk``",
+"``bmaydibd`menftcebfcfbq`vfpararbtawamdwakfmevfcdmdmapfdbxdx",
+"``fi`bayegbzaf`hdebkbibqambtarfp`obl`zfhakfkdebucbdmdlch``cq",
+"``dxacbrapbeenfcevaufoad`cbhblarfpaqbh`zfoauceceembecjdpbxdk",
+"``fnez`papekcwfcc`cgaacobnababbtfp`obhakcvbkce`uafekdncd``fr",
+"``bbeabx`jd`afckevcg`gakfhdtbhbtebbqcpbnbibfcefcexekandifdfi",
+"``cddv`bbaekd`cneldsau`gcocodtdt`cfhebbhbceoftemd`cidz`bbg`s",
+"``dh`p`ddodzekaienbvfmfm`gagagagfqbiecebbsdccncb`rcjbpfrfrdx",
+"````asembbdnfedmenck`udebffkaaazazcgbfesbwax`rdmegdl`i`bac``",
+"````b`ezccfbcaegdraick`hbweseyfkc`evc`dsdbcnbzerf`crdvdddj``",
+"`````p`x`j`bcaegcwcwcnataxazbvbvf``uen`ycbbzcabdajfnedfndo``",
+"``````dvdue`caefana`av`tbv`lenbuckfcbvc``mbeffcwaeedeaeu````",
+"``````````ej`jbdajanaya`dmewfj`tavfaercqffaodldpeufnfn``````",
+"````````bjeqcl`xfl`janehbpcua`egcsefcacidldz`xeu``brcl``````",
+"``````````bxacbjdvacb``pbabpciehepcjdlah`pdkeq``b`dj````````",
+"`````````````e`ncd`ebxbbdubm`s`bctdhbbdxcd`pej`seq``````````",
+"````````````````bjcmczctfieqdxbrahbbdvdv`scmcd``````````````",
+"``````````````````aldvace`ejb`bmalbjedcdbm`p````````````````",
+"````````````````````````dxbjdhcte`cicm``````````````````````",
+"````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood7[] = {
+/* width height ncolors chars_per_pixel */
+"36 36 185 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #013232",
+"`j c #3C9090",
+"`k c #251A1A",
+"`l c #095454",
+"`m c #190101",
+"`n c #70D0D0",
+"`o c #000606",
+"`p c #003434",
+"`q c #0E2E2E",
+"`r c #001313",
+"`s c #115555",
+"`t c #213030",
+"`u c #60C0C0",
+"`v c #0F0404",
+"`w c #002020",
+"`x c #165D5D",
+"`y c #636A6A",
+"`z c #072A2A",
+"a` c #445C5C",
+"aa c #6C7676",
+"ab c #000C0C",
+"ac c #549393",
+"ad c #001919",
+"ae c #102222",
+"af c #4D5454",
+"ag c #002626",
+"ah c #163535",
+"ai c #043737",
+"aj c #4F6363",
+"ak c #000505",
+"al c #65A0A0",
+"am c #052E2E",
+"an c #041616",
+"ao c #044444",
+"ap c #76C1C1",
+"aq c #7ED6D6",
+"ar c #001212",
+"as c #196969",
+"at c #385656",
+"au c #0C4545",
+"av c #767F7F",
+"aw c #642525",
+"ax c #360505",
+"ay c gray28",
+"az c #5FB4B4",
+"b` c #002C2C",
+"ba c #0E2626",
+"bb c #000B0B",
+"bc c #030404",
+"bd c #001818",
+"be c #944040",
+"bf c #280404",
+"bg c #0A0E0E",
+"bh c #385C5C",
+"bi c #002525",
+"bj c #6D8686",
+"bk c #407E7E",
+"bl c #000404",
+"bm c #354F4F",
+"bn c #739999",
+"bo c #001111",
+"bp c #5A7D7D",
+"bq c #347272",
+"br c #030A0A",
+"bs c #5AABAB",
+"bt c #010808",
+"bu c #001E1E",
+"bv c #6E3B3B",
+"bw c #71B1B1",
+"bx c #183C3C",
+"by c #274E4E",
+"bz c #266464",
+"c` c #000A0A",
+"ca c #287373",
+"cb c #0D1A1A",
+"cc c #2B3E3E",
+"cd c #053333",
+"ce c #121515",
+"cf c #270C0C",
+"cg c #001717",
+"ch c #253838",
+"ci c #418888",
+"cj c #374343",
+"ck c #013C3C",
+"cl c #040707",
+"cm c #031D1D",
+"cn c #192C2C",
+"co c #000303",
+"cp c #164040",
+"cq c #537272",
+"cr c #120E0E",
+"cs c #032A2A",
+"ct c #520B0B",
+"cu c #001010",
+"cv c #062323",
+"cw c #435555",
+"cx c #0C3636",
+"cy c #8EAFAF",
+"cz c #282A2A",
+"d` c #001D1D",
+"da c #0C1515",
+"db c #515C5C",
+"dc c #1B5555",
+"dd c #297D7D",
+"de c #002A2A",
+"df c #2B3030",
+"dg c #4F3939",
+"dh c #AF5C5C",
+"di c #000909",
+"dj c #003737",
+"dk c #010000",
+"dl c #001616",
+"dm c #042727",
+"dn c #0C3C3C",
+"do c #030F0F",
+"dp c #010D0D",
+"dq c #002323",
+"dr c #074E4E",
+"ds c #0C4949",
+"dt c #295555",
+"du c #5E7272",
+"dv c #011A1A",
+"dw c #000202",
+"dx c #55A1A1",
+"dy c #000F0F",
+"dz c #176464",
+"e` c #042020",
+"ea c #0F0000",
+"eb c #001C1C",
+"ec c #8A5B5B",
+"ed c #419A9A",
+"ee c #000808",
+"ef c #205C5C",
+"eg c #420707",
+"eh c #064949",
+"ei c #041919",
+"ej c #0C5C5C",
+"ek c #001515",
+"el c #071212",
+"em c #1D4F4F",
+"en c #171B1B",
+"eo c #154747",
+"ep c #2D8686",
+"eq c #031B1B",
+"er c #000101",
+"es c #3C1B1B",
+"et c #286A6A",
+"eu c #044040",
+"ev c #000E0E",
+"ew c #264747",
+"ex c #0F4E4E",
+"ey c #0D1E1E",
+"ez c #396A6A",
+"f` c #001B1B",
+"fa c gray14",
+"fb c #0C4141",
+"fc c #031414",
+"fd c #172121",
+"fe c #002828",
+"ff c #060D0D",
+"fg c #063B3B",
+"fh c #2B5C5C",
+"fi c #645C5C",
+"fj c #000707",
+"fk c #343A3A",
+"fl c #396363",
+"fm c #182525",
+"fn c #364949",
+"fo c #001414",
+"fp c #467373",
+"fq c #AA7979",
+"fr c #506969",
+"fs c #022323",
+"ft c #002121",
+"fu c #1C7171",
+"fv c #213E3E",
+/* pixels */
+"````````````````````````````````c``efoardw``````````````````````````````",
+"````````````````````````cobb`oftf`cuarevdldk`mdeag``````````````````````",
+"````````````````````cueefodjaheub`fcdofcagckeuaxdk`kdv``````````````````",
+"``````````````````ekcoaddj`tao`l`leudme`eoczdr`ife`pdkbf````````````````",
+"``````````````c`dvfjdl`pehcveuejdsdncbccdsbgcveqbrdvc`bibuee````````````",
+"````````````c``qdjdqbrdm`zdnauexfdfmdzdz`acpdsejame`dpbo`r`oco``````````",
+"``````````cuaxaxegdrcvbacrahahemembzezef`hefdz`f`ffkaocle`f`fte`````````",
+"``````````de`icke`ctewbyeofvbzcafhfhbefhdfetbzbvdg`sesamcl`pf`ax````````",
+"````````ebdi`bfceicf`ffuafcaetbqbkedecbqfnbqepddbv`f`fauanaiaodwab``````",
+"``````ebfjadbrfffb`sfhfudbepezci`cdxcifra`edbe`jbkfudz`qbgcd`h`b`par````",
+"``````ftarebcmehcfbmfucaepbveddxfqacdudbbpecbjaaepby`tfdeyamczesad`m````",
+"````eedecuaobfewdzdgbvepedaydxdhal`c`yal`ubwdhdxbhfk`hfmeydnczegdeb``m``",
+"````ce`p`kfafv`f`sfuawbebeaf`udhbwbnbjbn`u`ufqbsayezewchfmexesbfcxcoe```",
+"`````weaax`mctejdcemdtbqacdx`ufqcy`nbwbnbjalalbsa`bhdtewfdexeh`heucoft``",
+"````agdjcxfacxaeenchccatcidxazapaqfqcy`nbjavbjcqdbbhfkfafdbadnai`i`ebd``",
+"``fjcgdq`maoel`aenchfkcjfpbsalbnbnapaqaqbnbn`yajajflcj`tahcb`qdm`bbifoek",
+"``addw`o`baodaexfd`hfh`gfpac`cbjbnbnaqavapbwduajfrbhfkchbxeybgei`idldwcg",
+"```mboftageuelcxcn`hccbma`frdu`yaaavbwcyapbwduajcwatdf`tcneyelclb`dldw`r",
+"``eadl`rftcselaeenfvccfnayajfr`yaa`cbwfq`ualbpcqfpflewfveneydae``pdedqbd",
+"``fffo`oeabcelbgeneofhfnatcwajdubp`ybjbsfidhdx`jciddewfmendaffcmckaxdefj",
+"````ekdvckbreqcbaedcbzbybmcja`frcqfrdbbpdxecaabvdgaweffmcebaananbueabu``",
+"`````wag`pdpcmelcxcpeofvccfnfkay`gafafajajfp`jciawafefen`qcdcmbt`raedv``",
+"````d`c``dfobrbr`qdseocn`hczbmbhezbhayfnfkbmfhfhefescpbadrehfsakekdq`m``",
+"````c`cgagdjfccsehdsdsahcnfadtfhbqezfldffndfccemdc`scedn`mahcserar`ddw``",
+"```````obi`bde`iaoehcxcxcpemasawcafhfhczew`hdc`xes`acbauegamadakfjar````",
+"``````fjeb`d`k`maxaoamfbexctdzdz`feocpcnenbx`xesemba`z`maiftdiee`efj````",
+"````````blak`bfddkckcvameh`lexctcecpahahbaaucrczeheldmfgft`ocu`mad``````",
+"``````````akfjfo`peack`kegaieyds`ldfegexauescr`vcdeidmdef`abd`ad````````",
+"``````````bl``dwdydqb``bfsdodoeie`dmaoaxbxamfgfafsdl`weverfj`mbl````````",
+"````````````c`c`abakerabbb`o`obcclbreieiandmagft`odvakcoeec`dk``````````",
+"```````````````e`mcgbb`obbdvf``wbbcgcsdl`odldvbbdycudiadfobl````````````",
+"``````````````````dybud`ev`ofjbber`rdvdqarfjblakblar`m`m````````````````",
+"````````````````````cobbebdv`r``coblekf`cu``difoeaarc```````````````````",
+"````````````````````````ererboeabuevc`didiblerarbl``````````````````````",
+"````````````````````````````````c```blabdk``````````````````````````````",
+"````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood8[] = {
+/* width height ncolors chars_per_pixel */
+"44 44 190 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #010404",
+"`j c #013232",
+"`k c #3C9090",
+"`l c #251A1A",
+"`m c #095454",
+"`n c #190101",
+"`o c #70D0D0",
+"`p c #000606",
+"`q c #003434",
+"`r c #0E2E2E",
+"`s c #001313",
+"`t c #115555",
+"`u c #213030",
+"`v c #60C0C0",
+"`w c #0F0404",
+"`x c #002020",
+"`y c #165D5D",
+"`z c #636A6A",
+"a` c #072A2A",
+"aa c #445C5C",
+"ab c #6C7676",
+"ac c #000C0C",
+"ad c #549393",
+"ae c #001919",
+"af c #102222",
+"ag c #4D5454",
+"ah c #002626",
+"ai c #163535",
+"aj c #043737",
+"ak c #4F6363",
+"al c #000505",
+"am c #65A0A0",
+"an c #052E2E",
+"ao c #041616",
+"ap c #044444",
+"aq c #76C1C1",
+"ar c #7ED6D6",
+"as c #001212",
+"at c #196969",
+"au c #385656",
+"av c #0C4545",
+"aw c #767F7F",
+"ax c #642525",
+"ay c #360505",
+"az c gray28",
+"b` c #5FB4B4",
+"ba c #002C2C",
+"bb c #0E2626",
+"bc c #8C9B9B",
+"bd c #000B0B",
+"be c #030404",
+"bf c #001818",
+"bg c #944040",
+"bh c #280404",
+"bi c #0A0E0E",
+"bj c #385C5C",
+"bk c #002525",
+"bl c #6D8686",
+"bm c #407E7E",
+"bn c #000404",
+"bo c #354F4F",
+"bp c #739999",
+"bq c #001111",
+"br c #5A7D7D",
+"bs c #347272",
+"bt c #030A0A",
+"bu c #5AABAB",
+"bv c #010808",
+"bw c #001E1E",
+"bx c #6E3B3B",
+"by c #71B1B1",
+"bz c #183C3C",
+"c` c #274E4E",
+"ca c #266464",
+"cb c #000A0A",
+"cc c #287373",
+"cd c #0D1A1A",
+"ce c #2B3E3E",
+"cf c #053333",
+"cg c #121515",
+"ch c #270C0C",
+"ci c #001717",
+"cj c #253838",
+"ck c #418888",
+"cl c #374343",
+"cm c #013C3C",
+"cn c #040707",
+"co c #031D1D",
+"cp c #192C2C",
+"cq c #000303",
+"cr c #070000",
+"cs c #164040",
+"ct c #537272",
+"cu c #5B8787",
+"cv c #120E0E",
+"cw c #032A2A",
+"cx c #520B0B",
+"cy c #001010",
+"cz c #062323",
+"d` c #435555",
+"da c #0C3636",
+"db c #8EAFAF",
+"dc c #282A2A",
+"dd c #001D1D",
+"de c #0C1515",
+"df c #515C5C",
+"dg c #1B5555",
+"dh c #297D7D",
+"di c #002A2A",
+"dj c #2B3030",
+"dk c #4F3939",
+"dl c #AF5C5C",
+"dm c #000909",
+"dn c #003737",
+"do c #010000",
+"dp c #001616",
+"dq c #042727",
+"dr c #0C3C3C",
+"ds c #030F0F",
+"dt c #010D0D",
+"du c #002323",
+"dv c #074E4E",
+"dw c #0C4949",
+"dx c #295555",
+"dy c #5E7272",
+"dz c #011A1A",
+"e` c #000202",
+"ea c #55A1A1",
+"eb c #000F0F",
+"ec c #176464",
+"ed c #042020",
+"ee c #0F0000",
+"ef c #001C1C",
+"eg c #8A5B5B",
+"eh c #419A9A",
+"ei c #000808",
+"ej c #205C5C",
+"ek c #420707",
+"el c #064949",
+"em c #041919",
+"en c #0C5C5C",
+"eo c #001515",
+"ep c #071212",
+"eq c #1D4F4F",
+"er c #171B1B",
+"es c #154747",
+"et c #2D8686",
+"eu c #031B1B",
+"ev c #000101",
+"ew c #3C1B1B",
+"ex c #286A6A",
+"ey c #044040",
+"ez c #000E0E",
+"f` c #264747",
+"fa c #0F4E4E",
+"fb c #0D1E1E",
+"fc c #396A6A",
+"fd c #001B1B",
+"fe c gray14",
+"ff c #0C4141",
+"fg c #031414",
+"fh c #011212",
+"fi c #172121",
+"fj c #002828",
+"fk c #060D0D",
+"fl c #063B3B",
+"fm c #2B5C5C",
+"fn c #645C5C",
+"fo c #000707",
+"fp c #343A3A",
+"fq c #396363",
+"fr c #182525",
+"fs c #364949",
+"ft c #001414",
+"fu c #467373",
+"fv c #AA7979",
+"fw c #506969",
+"fx c #022323",
+"fy c #002121",
+"fz c #1C7171",
+"g` c #213E3E",
+/* pixels */
+"````````````````````````````````````````````ac``````````````````````````````````````````",
+"`````````````````````````````````peie`bnbddidicicqae`xbwcg``````````````````````````````",
+"````````````````````````````cqcqddfydieoezebfoezbqahee`n`n`rbw``````````````````````````",
+"`````````````````````````pcbac`jap`nekapcweuaofhanapffekekdocr`dfd``````````````````````",
+"````````````````````ev`sal`pdieleleyel`m`mfla`emelbhdjelajfydn`jdo`ncd``````````````````",
+"``````````````````eveoezeobaelajdqfldv`mdw`rde`mcx`rfkemepdscncocbdidueo````````````````",
+"````````````````fo`bdndd`idqcfa`drdr`tfa`acgesatesfbdafadvfledfkbvacftbnev``````````````",
+"``````````````fj`dcmcmcmdsfkbibbdaaffrcpaidgccecaics`t`tdxfpffa`cnfg`baebqac````````````",
+"````````````ch`dcp`ddvcxcfdwfferercsejexc`caetex`uf`atfzaz`fenchdvemdsahcy`bcg``````````",
+"``````````dzef`xeycoedewench`yesdgcaexccfmbsbxfcdjdxcacafcew`ydkenajdsdqcmezchef````````",
+"``````````dzalfybwaodqch`ffz`fbscccabsbmckbgegbmclbjetetdhbxax`l`favczdqai`bacft````````",
+"````````crbdbwdtbtcodrenaxejaadcdhfqfu`kbgehckfwd`fucufp`ketaaatatdabiedapcmbwaf`s``````",
+"````````fteoevfgemelfpclfzfzdh`z`k`k`kbudladbrctdfadazehbr`kccc`eq`adeczaj`ncpei`d``````",
+"``````eoftfoahajekekcv`ldhdhdhehbxadeadlea`c`zbrcub`fnbxabbmbocj`uercg`rapcxeydiahdu````",
+"```````dahdiewayes`mecdkaxbxckegazbudl`vam`cab`c`oaqfvdlbufqfsfp`hfrfidrdvcnek`qacbk````",
+"````dd`ndnayewcjcvcl`tfzbxbg`zbgegb`eg`obybpblawby`v`vdlblaafqfqf`g`fidr`mdj`n`lacdp`n``",
+"````fy`day`d`wayewecdgdgdxfcckehbu`vfvab`oaqbybpaw`cambubufu`gfqc`f`frdr`mdvfefeebbdfy``",
+"````ci`ddn`lbhdvdr`acpcjceaufcadeab``odbfvfvdb`obpawbl`ccuakaafpce`ufr`adafleybadzebdd``",
+"````dp`j`j`heldqdeaferg`djbod`adbuambybyaqarawarbyblab`zdfdffcbjdj`uaicgfbfled`jbaevbw``",
+"`````scibwdrelembbaier`uf`auazbradam`cbpbpbyarfvaqbpbl`zdyctfubjce`hbzfrdeemczcwduevbw``",
+"````cq``bddnelepavbzfi`udxboazbrad`cblblbpbpaqbcaraqam`zfwfwaaclfpg`bzfr`acnco`jftalci``",
+"``eefofddp`jeyao`raifi`hf`fp`gakctdyababawblbyaraw`oam`zakagaafsdj`ucp`afbepbt`beoe`al`p",
+"````ezbw`efjajfkbbfberg`cecl`gazdfak`zababbpbydbdlbycudyfwakfcauceg`erafdeepeddn`bfdac``",
+"````cbbqevchdtepcdfbfrg`c`fsfpd`akct`zdy`zab`cb`eg`vbuadckckckfmcjcpcgcgbifkfxdndnafbk``",
+"````fd`p`scmcnepfkcv`rdgejfmfpau`gakbrctcu`zdycueafndlegbgbgfudhf`cpcgdedefkao`j`bah`d``",
+"````eeacahdn`iembibbbbesejdxdjboclaaakakfwdfdffwcueablabbgbxaxdkdgficgbba`cobfftbafyeo``",
+"````fdever`bdscnedepdrcscsg`dcf`clfp`gazd`agagaaakaafuck`kbgaxfzeqer`adadqaobt`s`jeodp``",
+"````ezebbk`deobeemaodafafaai`hdjdjfsbjfqfcaaazazclclaufqfmfmfzatbzafavelflfhalaceedmfk``",
+"``````ezefa``qdscncfffdwesbzfifefef`dxfqbsfcfqfpclfpfpc`dxeqboescgdacx`u`ledalaschef````",
+"````````fdcwer`xbkfldw`mffdaaiaiaiejexccexexexcjc`cj`uf`dgat`yafcdffayfe`baefocqfy`s````",
+"````````cbbk`bdn`jflapapda`rdr`tfsaxewaxcaf`g``u`h`hbz`yeccgfadebbewbhcmfjeidmbn`e``````",
+"``````````dzfjereebhekapcfa`av`tf``tdk`lecbzcscpfrcpeqc``fenfffkcfekcmfyebcqacasfo``````",
+"``````````e`e`ahdiay`ncmfxa`ajdcfadwfp`fdgcsaiai`a`r`tchdjesanfgcwflcwcbacaeeedd````````",
+"````````````bnfobq`jee`ndnajewewanfbavdwekcvewdwffdwcxaycnapdsemah`bbw`sasdueo`e````````",
+"``````````````ev`ecbbw`jchdn`hanczcnczanfldaescxbzayflelcnflbeahfybwacaldp`ncb``````````",
+"``````````````cb``e`bdcbcibffddtbebebeepepaoancffldqeuajeyfyebbwftei`pbnbwee````````````",
+"````````````````ezcy`sace`cb`p`pbqdpdsbebteudqbedteudqbkfde`aebqal``bn``bd``````````````",
+"``````````````````fh`naecybdcb`eaeciddfhdtdzdiddfocbaeci`edmae`pcyfdft`p````````````````",
+"````````````````````btdpbwefcidmalfocy`pbdftefbkbfeialbnale`bnbf`nepdm``````````````````",
+"````````````````````````cqebcvfycibqeibn```ebwbkbkaccqalebeoeebq````````````````````````",
+"``````````````````````````````bnbdcvdeftebbdasbdevbncqcydzasbq``````````````````````````",
+"````````````````````````````````ei`pbqft`nbqbdac`eacdmcqev``````````````````````````````",
+"````````````````````````````````````````````e```````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blood9[] = {
+/* width height ncolors chars_per_pixel */
+"50 50 190 2",
+/* colors */
+"`` c None",
+"`a c #102A2A",
+"`b c #002E2E",
+"`c c #689494",
+"`d c #250000",
+"`e c #000D0D",
+"`f c #5D1616",
+"`g c #415050",
+"`h c #212A2A",
+"`i c #010404",
+"`j c #013232",
+"`k c #3C9090",
+"`l c #251A1A",
+"`m c #095454",
+"`n c #190101",
+"`o c #70D0D0",
+"`p c #000606",
+"`q c #003434",
+"`r c #0E2E2E",
+"`s c #001313",
+"`t c #115555",
+"`u c #213030",
+"`v c #60C0C0",
+"`w c #0F0404",
+"`x c #002020",
+"`y c #165D5D",
+"`z c #636A6A",
+"a` c #072A2A",
+"aa c #445C5C",
+"ab c #6C7676",
+"ac c #000C0C",
+"ad c #549393",
+"ae c #001919",
+"af c #102222",
+"ag c #4D5454",
+"ah c #002626",
+"ai c #163535",
+"aj c #043737",
+"ak c #4F6363",
+"al c #000505",
+"am c #65A0A0",
+"an c #052E2E",
+"ao c #041616",
+"ap c #044444",
+"aq c #76C1C1",
+"ar c #7ED6D6",
+"as c #001212",
+"at c #196969",
+"au c #385656",
+"av c #0C4545",
+"aw c #767F7F",
+"ax c #642525",
+"ay c #360505",
+"az c gray28",
+"b` c #5FB4B4",
+"ba c #002C2C",
+"bb c #0E2626",
+"bc c #8C9B9B",
+"bd c #000B0B",
+"be c #030404",
+"bf c #001818",
+"bg c #944040",
+"bh c #280404",
+"bi c #0A0E0E",
+"bj c #385C5C",
+"bk c #002525",
+"bl c #6D8686",
+"bm c #407E7E",
+"bn c #000404",
+"bo c #354F4F",
+"bp c #739999",
+"bq c #001111",
+"br c #5A7D7D",
+"bs c #347272",
+"bt c #030A0A",
+"bu c #5AABAB",
+"bv c #010808",
+"bw c #001E1E",
+"bx c #6E3B3B",
+"by c #71B1B1",
+"bz c #183C3C",
+"c` c #274E4E",
+"ca c #266464",
+"cb c #000A0A",
+"cc c #287373",
+"cd c #0D1A1A",
+"ce c #2B3E3E",
+"cf c #053333",
+"cg c #121515",
+"ch c #270C0C",
+"ci c #001717",
+"cj c #253838",
+"ck c #418888",
+"cl c #374343",
+"cm c #013C3C",
+"cn c #040707",
+"co c #031D1D",
+"cp c #192C2C",
+"cq c #000303",
+"cr c #070000",
+"cs c #164040",
+"ct c #537272",
+"cu c #5B8787",
+"cv c #120E0E",
+"cw c #032A2A",
+"cx c #520B0B",
+"cy c #001010",
+"cz c #062323",
+"d` c #435555",
+"da c #0C3636",
+"db c #8EAFAF",
+"dc c #282A2A",
+"dd c #001D1D",
+"de c #0C1515",
+"df c #515C5C",
+"dg c #1B5555",
+"dh c #297D7D",
+"di c #002A2A",
+"dj c #2B3030",
+"dk c #4F3939",
+"dl c #AF5C5C",
+"dm c #000909",
+"dn c #003737",
+"do c #010000",
+"dp c #001616",
+"dq c #042727",
+"dr c #0C3C3C",
+"ds c #030F0F",
+"dt c #010D0D",
+"du c #002323",
+"dv c #074E4E",
+"dw c #0C4949",
+"dx c #295555",
+"dy c #5E7272",
+"dz c #011A1A",
+"e` c #000202",
+"ea c #55A1A1",
+"eb c #000F0F",
+"ec c #176464",
+"ed c #042020",
+"ee c #0F0000",
+"ef c #001C1C",
+"eg c #8A5B5B",
+"eh c #419A9A",
+"ei c #000808",
+"ej c #205C5C",
+"ek c #420707",
+"el c #064949",
+"em c #041919",
+"en c #0C5C5C",
+"eo c #001515",
+"ep c #071212",
+"eq c #1D4F4F",
+"er c #171B1B",
+"es c #154747",
+"et c #2D8686",
+"eu c #031B1B",
+"ev c #000101",
+"ew c #3C1B1B",
+"ex c #286A6A",
+"ey c #044040",
+"ez c #000E0E",
+"f` c #264747",
+"fa c #0F4E4E",
+"fb c #0D1E1E",
+"fc c #396A6A",
+"fd c #001B1B",
+"fe c gray14",
+"ff c #0C4141",
+"fg c #031414",
+"fh c #011212",
+"fi c #172121",
+"fj c #002828",
+"fk c #060D0D",
+"fl c #063B3B",
+"fm c #2B5C5C",
+"fn c #645C5C",
+"fo c #000707",
+"fp c #343A3A",
+"fq c #396363",
+"fr c #182525",
+"fs c #364949",
+"ft c #001414",
+"fu c #467373",
+"fv c #AA7979",
+"fw c #506969",
+"fx c #022323",
+"fy c #002121",
+"fz c #1C7171",
+"g` c #213E3E",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````bnbnbddpfjdn`bahfdcq`pebfj````````````````````````````````````",
+"````````````````````````````````bnfocqftbwdddpeobqbddmfofyaydoaydnahbk``````````````````````````````",
+"````````````````````````````fd`seibw`q`qapcmahdzfgfgbtfh`x`qcmflcheecrbwah``````````````````````````",
+"````````````````````````dmdmezalfd`bapek`ddvelapajdqdscwdvaycravcm`j`rdoayahdd``````````````````````",
+"```````````````````````pftevevdzdn`heyajey`m`m`manczaoel`wapeyeyfxfh`bah`qfibhah````````````````````",
+"````````````````````bnfd`xezeo`jdvcfeddadvenavav`rcd`tfpdabicdczcoepbedzez`sahdzbq``````````````````",
+"``````````````````cbdi`qdifhdsancfa`drdafa`tbzafcgesej`tfbdaff`mdvfledfgbtbtcycifo``````````````````",
+"````````````````du`naydncmfxcnaobibbdr`aerfrcpcpeqdhatesfres`t`tdkdgdra`btfhbwdicyezei``````````````",
+"``````````````fbcr`rekeeayapdqda`rcg`afreqejejdxcadhccg``uejatfzaxclc`cx`mcodtfg`jev`bbk````````````",
+"````````````bw`jdzchcmdqeyg`ceekfaaibzdgejcccadxbsfnbsceceexejfzaxew`teccxelaocn`bdnevbh`x``````````",
+"```````````s`xfofjdnfhfgdvewayewdkatexexccbsbsbm`kfpckfsbofqccexdhewdkaz`fenflbtajap`xfdbqcb````````",
+"``````````fyacdpdzdsfgdqen`fatecagaxdhfmfcck`kbleg`kfud`d`bs`kfnetdhbs`gateca`fkcweldnebay`e````````",
+"````````bqdmaeftbtbecofffaecfzatakaxetbmfcckbubxehbrctakfw`kegdk`ketetatecfacdbidqapap`jdmercq``````",
+"`````````nevbfeoeueuavcxec`ffzccdh`k`z`keheadlb`cuctctdfbrbldlcuad`kccf`g`cscgfbdqflayekfybk`n``````",
+"``````alfj`pftfjflbhayekcxewccdhet`kbgehadbpb`am`cfnbrcububpdlbxadbmboce`ucpcgafdaelewapdibncrdz````",
+"``````dzbbddey`dayesenecatewewbmckabbxamb`dlb`am`cab`c`vdbbyfvdleafqclcedc`hfibbff`m`w`dcmaedu`d````",
+"``````bhay`qay`hcscvf``t`ybxaxbxegbgagfv`vfvbybybpblawby`v`v`vdlbuaabjfcf`cjcpfrdw`mewek`dahfoah````",
+"````efczeecm`n`wekcx`f`tdgexexbmeheabu`vaqegdbaqaqbpbpawambyb``vb`fu`gfcfmdx`ufrff`mdveweedievdddz``",
+"````bfer`ddnapbhfa`mesbzg`cjcebjfuckeab``vdbfvarararaqbpawblamamadfw`gfsboc``herdrdwapeldnfje`aeef``",
+"````cy`nfi`dai`uflfbcder`uceceauaaadeabubyaq`oarfvbcarbyblabblbrfwdfaabjfpdc`ufiafdaflanbadnbd`sdz``",
+"`````pbw`beyekeyczbi`afr`ucjfpcld`cubuamambpbyaqardbaraqbp`c`z`zdfdffufqcldc`ucpcdfbcfeddqdnbwbdbw``",
+"````al`e`sah`napep`acsfifecjauauazbradam`cblbpbpbyarawarbybpab`zfwctfubjfpdj`haifbcdepcocwah`saleo``",
+"````e`ei`pfh`leybiffeser`hc`fmfs`gbmadcublabblblbpaqardbaqaq`c`zfwfwd`clfpcecjbzaf`afkemanbwcy``eo``",
+"`````edzdd`pekflep`rdacpfecjcecl`gakfwdybr`zababbpbyarfv`obyblfnakagaabodjcj`ucpaffbepbefjcidpbnas``",
+"````cbdzaee`eyanfkbbafercpcjcjfs`g`gdfdffn`zabblbpby`ofv`vambrfwakaafcauf`cj`ufiafepfkaodn`j`xdz`p``",
+"````cbaseo`sayfkfkcdcdcgbzc`f`fsfpd`akctdfdy`z`zblambyegb`b`adcubmbmbmfqf``ucpcgcdbifkfxdndn`b`dcy``",
+"````aecbe``b`jcnaobicvereseqcadxfpbjd`dfctbrbrbr`zbr`cb`fnegbueaehehbmdhc``ufierdebicnaocm`qcrdudd``",
+"````dzei`s`qdibtaocnfbfbfadgcadxdjbocld`fwfwctctdfakdycub`agegbxbxbxbxaxcabzercgfbedfgfgddfyaybwde``",
+"````asbdbf`ddu`icocoep`rbzcsdgc`djfsfs`g`gagagagagagdfctfuckehegegbgdjdhecaicgcd`redcobtezfybhfyae``",
+"````foaeddeedidsbeedbi`ravesbzcjfececefpaud`aad`d``gd`aad`aabsbmdhfnbxaxdg`afbdreyanfg`pezbkahasfk``",
+"``````dd`p`j`qft`iemepa`dresesaifedcdccebjbjfcfcbjfsclclclfsbofmfmejcaboescgdadvcsflfgal``erfdae````",
+"``````alftdddo`jdscndqapavfaesbzfife`hcjfmdxbsbsfcfqclclcldjcedxdxeqat`tbbbb`mekaicpfxdmaccwfyfd````",
+"``````cb`pfyerayddfxajdcdwdwdraiaiai`uf`caccexexexexcef`c`dccjf`dgatec`rde`rcsbhap`jfddmcqfy`n`p````",
+"````````bn`xcz`b`j`jcfflelfldadadafa`yataxewccejc`c`cj`hcjfees`yeccx`ycddeff`wayajahdmcbcqftbd``````",
+"````````foacdddo`j`d`nfeapajandaav`tch`yejdx`fejg`g``ufrerbz`y`ychf`facdczelbhajfxfheialcbbnac``````",
+"`````````````edzererdnbeaycfa`a`dadwf`av`y`fcxeqaiaiaifiercsc`chf`djdacnanfldafjcyaccbbwfyac````````",
+"``````````evbn``ciduchcrayajdqanapcxdrdadw`tcedjfaavavdrdadwdjchewesczemfxcwcwbffoebbwcodo``````````",
+"``````````````bne``sci`jay`ncpdrbhapajema`avdway`maydwdwavcxekaycneydscofjahfydz`ebfbkefbd``````````",
+"``````````````evevbdcq`sbkdn`q`jajdqcobtbta`a`a`cfelchewcheycfewekajbeedduddasei``eocrbd````````````",
+"````````````````cb``e`bndmdmeoftaedtbebecncnaodsaodqanajanedfxajajcoezfydpalev`pacbwee``````````````",
+"```````````````````e`ecycyeievacal`iebfhfgbvbedscodqbedtfhfxahahbfevbfft``e`e`evev`e````````````````",
+"````````````````````ft`nefbfdmbndmcbfdfyddbwezcyfyfjdzezdm`sefaecb`paeebalebas`scq``````````````````",
+"``````````````````````do`wbwfdftft``eiacezeobnezeodufyftdmfocybd`pcbbndmciembicb````````````````````",
+"````````````````````````dme``scrcvaecyasfocb``bdbfbwdubkaeebe`cqalebfdcrcycrcb``````````````````````",
+"``````````````````````````````cqacdpbwcibqe`cqalfoasbqaseibndmacci`ncyebdm``````````````````````````",
+"````````````````````````````````cqe```ez`n`nciftac`ebqfofoe`evcb`wasal``````````````````````````````",
+"```````````````````````````````````````ecq`ebqeofgeo`sbdbdbqcbbn````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+#include "colors.inc"
+#include "shapes.inc"
+#include "textures.inc"
+
+/* The following make the field of view as wide as it is high
+ * Thus, you should have the -W and -H command line options
+ * equal to each other. */
+camera {
+ location <5.8, 0, 0>
+ up <0, 1, 0>
+ right <1, 0, 0>
+ look_at <0, 0, 0>
+}
+
+sphere {
+ <0,0,0>, 2.5
+ texture { Blue_Agate
+ scale <0.7, 0.7, 0.7> }
+ finish { phong 1 }
+}
+
+light_source {<6, 1, 0> color White}
--- /dev/null
+/* XPM */
+static char *blue1[] = {
+/* width height ncolors chars_per_pixel */
+"10 10 46 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #2E2E4E",
+"`c c #1D1D30",
+"`d c #1B1B2E",
+"`e c #0C0C12",
+"`f c #0A0A10",
+"`g c #17172A",
+"`h c #25253E",
+"`i c #12121E",
+"`j c #20202F",
+"`k c #141423",
+"`l c #2F2F4E",
+"`m c #1A1A2C",
+"`n c #333355",
+"`o c #1D1D2B",
+"`p c #282843",
+"`q c #303051",
+"`r c #111122",
+"`s c #161620",
+"`t c #0A0A14",
+"`u c #25253F",
+"`v c #2B2B48",
+"`w c #2F2F4F",
+"`x c #101020",
+"`y c #18182B",
+"`z c #353558",
+"a` c #15151E",
+"aa c #191925",
+"ab c #13131F",
+"ac c #0D0D19",
+"ad c #151524",
+"ae c #343456",
+"af c #1F1F34",
+"ag c #0C0C14",
+"ah c #0A0A12",
+"ai c #494967",
+"aj c #23233B",
+"ak c #0C0C17",
+"al c #292944",
+"am c #121223",
+"an c #BCBCD7",
+"ao c #1A1A2E",
+"ap c #0B0B15",
+"aq c #262640",
+"ar c #171724",
+/* pixels */
+"```````s`uaj`u`t````",
+"````ac`a`w`l`waqaa``",
+"```m`p`x`nae`n`waj`t",
+"``a``o`w`dan`z`q`yaf",
+"``ap`g`l`naiam`lal`k",
+"``ak`h`v`bao`b`v`h`s",
+"``ab`iaral`r`j`uafab",
+"````ad`c`sab`s`cag``",
+"```````eadahad`f````",
+"````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue10[] = {
+/* width height ncolors chars_per_pixel */
+"60 60 173 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #1B1B2B",
+"`c c #282845",
+"`d c #191929",
+"`e c #323252",
+"`f c #303050",
+"`g c #111121",
+"`h c #2E2E4E",
+"`i c #0F0F1F",
+"`j c #1D1D30",
+"`k c #1B1B2E",
+"`l c #0C0C12",
+"`m c #0A0A10",
+"`n c #17172A",
+"`o c #212137",
+"`p c #767691",
+"`q c #1F1F35",
+"`r c #2F2F48",
+"`s c #101019",
+"`t c #0E0E17",
+"`u c #272740",
+"`v c #181824",
+"`w c #25253E",
+"`x c #12121E",
+"`y c #10101C",
+"`z c #20202F",
+"a` c #0E0E1A",
+"aa c #2B2B47",
+"ab c #0C0C18",
+"ac c #292945",
+"ad c #161625",
+"ae c #141423",
+"af c #242436",
+"ag c #313150",
+"ah c #121221",
+"ai c #2F2F4E",
+"aj c #2D2D4C",
+"ak c #2B2B4A",
+"al c #1A1A2C",
+"am c #5C5C7A",
+"an c #161628",
+"ao c #333355",
+"ap c #07070C",
+"aq c #313153",
+"ar c #05050A",
+"as c #0D0D15",
+"at c #07070F",
+"au c #24243C",
+"av c #202038",
+"aw c #0D0D18",
+"ax c #1D1D2B",
+"ay c #0B0B16",
+"az c #282843",
+"b` c #262641",
+"ba c #232334",
+"bb c #11111F",
+"bc c #0F0F1D",
+"bd c #2C2C4A",
+"be c #3C3C5D",
+"bf c #2A2A48",
+"bg c #1B1B2C",
+"bh c #19192A",
+"bi c #151526",
+"bj c #131324",
+"bk c #303051",
+"bl c #111122",
+"bm c #1F1F33",
+"bn c #19192D",
+"bo c #08080F",
+"bp c #161620",
+"bq c #23233A",
+"br c #212138",
+"bs c #0E0E18",
+"bt c #0A0A14",
+"bu c #272741",
+"bv c #25253F",
+"bw c #23233D",
+"bx c #12121F",
+"by c #10101D",
+"bz c #202030",
+"c` c #0E0E1B",
+"ca c #1E1E2E",
+"cb c #2B2B48",
+"cc c #0C0C19",
+"cd c #292946",
+"ce c #181828",
+"cf c #28283B",
+"cg c #262639",
+"ch c #2F2F4F",
+"ci c #101020",
+"cj c #1C1C2F",
+"ck c #2A2A40",
+"cl c #18182B",
+"cm c #353558",
+"cn c #09090F",
+"co c #333356",
+"cp c #07070D",
+"cq c #15151E",
+"cr c #202036",
+"cs c #1C1C32",
+"ct c #090912",
+"cu c #191925",
+"cv c #26263F",
+"cw c #24243D",
+"cx c #22223B",
+"cy c #13131F",
+"cz c #11111D",
+"d` c #0F0F1B",
+"da c #0D0D19",
+"db c #2A2A46",
+"dc c #262642",
+"dd c #171726",
+"de c #151524",
+"df c #131322",
+"dg c #111120",
+"dh c #2E2E4D",
+"di c #0F0F1E",
+"dj c #1D1D2F",
+"dk c #343456",
+"dl c #08080D",
+"dm c #151527",
+"dn c #06060B",
+"do c #1F1F34",
+"dp c #1B1B30",
+"dq c #0C0C14",
+"dr c #0A0A12",
+"ds c #494967",
+"dt c #23233B",
+"du c white",
+"dv c #14141F",
+"dw c #212139",
+"dx c #1E1E2C",
+"dy c #2B2B46",
+"dz c #0C0C17",
+"e` c #292944",
+"ea c #0A0A15",
+"eb c #262637",
+"ec c #141422",
+"ed c #2D2D4B",
+"ee c #0E0E1C",
+"ef c #1A1A2B",
+"eg c #373758",
+"eh c #181829",
+"ei c #161627",
+"ej c #333354",
+"ek c #141425",
+"el c #313152",
+"em c #121223",
+"en c #222236",
+"eo c #030307",
+"ep c #BCBCD7",
+"eq c #1E1E32",
+"er c #1C1C30",
+"es c #1A1A2E",
+"et c #0B0B12",
+"eu c #18182C",
+"ev c #28283F",
+"ew c #090910",
+"ex c #222239",
+"ey c #202037",
+"ez c #11111B",
+"f` c #1E1E35",
+"fa c #0F0F19",
+"fb c #0D0D17",
+"fc c #0B0B15",
+"fd c #1B1B28",
+"fe c #090913",
+"ff c #262640",
+"fg c #171724",
+"fh c #151522",
+"fi c #212131",
+"fj c #2C2C49",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````dn`tdvahbhdebhbhecehawbs`x``````````````````````````````````````````````",
+"```````````````````````````````````````````yaweffcerbpbpeqbmbmbbaneiahay`kcedqfh````````````````````````````````````````",
+"````````````````````````````````````cpddeffcbbbsbpbpbrexexal`kabdgdfabaway`v`jcjbt`tcz``````````````````````````````````",
+"````````````````````````````````dnddaler`kbpfdexbqaucw`nccdac``wcccucwfdcueqcrcreq`kbsddar``````````````````````````````",
+"``````````````````````````````dqefcjbpdzexcuau`wbvekdt`gciekdtbiaxbubuffbvbcandoexfgbtdvbiez````````````````````````````",
+"``````````````````````````drdzbgeqcldfbcbxdjdxbuazazcibcax`dci`qffb`biazazbuff`wcwbqc`bpeqbgcecz````````````````````````",
+"````````````````````````fcehfedzcrabbyalexbuaze`dbdfdidicbaxdfbuavdffidbdbe`azbuffc``qfhcreq`xbhec``````````````````````",
+"``````````````````````cz`yalahfgbqahdabjazacdbaacbfjbdauede`edciblcbenfjcbaadbac`zexdxcwbqbpanaybhec````````````````````",
+"````````````````````boezayclbidtexeedididbaacbbdededajdhdhdhdhdhdtesajededbdcbfiae`ndxff`wdtaldadrbhas``````````````````",
+"```````````````````tbherc``ndtdteeeeby`zcbfjedajdhdy`abnbvbzebebciavcwebdhajbierahah`qdxcu`wdtal`kdzbhcp````````````````",
+"````````````````bxeh`yawdadtcuclazac`acbbdeddh`hch`n`ncschdcaicsdmdmcif`ch`hdhfjdidiffbyahdx`wczcubmbsczbx``````````````",
+"``````````````asddbxbtcsda`wcsekac`acbbdajdhaich`favcicif`cgaq`jcb`navdm`fchaiekesbjeeesbmazffbcc``oeqbgctcn````````````",
+"``````````````ctez`j`dexfgcvbccw`acbbdbzdhch`fbkelfidpbleycfejcfdc`ndpbnelbkfiesbdbnfiexdt`ubucv`kexcr`jefde````````````",
+"````````````cyehdz`ybrbycsbubqeecbbdajdhch`fbkelaq`eafazakafaobnbheyeucscbelbacsb`badffidf`zdxbu`wdabrcufcctcy``````````",
+"```````````matdv`jcrehczbbazaccsfjeddhai`fbabz`eejejblchbkeuekcjcoaoaoaiej`eclemfifienafbiaaacazekccexcrdfctaddl````````",
+"``````````cydzfcehbrclclcae`dxbueddh`i`qbdbdbjaiaobnesembj`jdkdkdkdkedaoaoejbkcsbjchaidhedcbdbe`exfdaubrawbtfccy````````",
+"````````asezalayaydaahanaz`udganbvcici`gf`dmajbnao`jazekavdkdkdkcgbjbn`naoemancdbj`fchdhedbdaabcdtffcwexcrehbtad`m``````",
+"````````bxbofebbbierdw`kazdbcaemcidtdc`nelbvblaocobfeualcfcmcmazbmcmemebclbidmaibjbkchaidhbd`bbrahbu`wdt`ocjfece`l``````",
+"````````fhbhbtdzbybcclahe``afj`icsazblfiafdhancodkeuazcmcmcmcmcmcfejcfdkdkbj`n`naqel`faidhedaxcie`bucvfdexdodfbhfh``````",
+"``````bobxehayabda`jdaexaxaabdeudpbvf`bv`a`ccfcockbjf`ckbebebebecfalcmdkdkcocdbj`eel`fchdhedahbcdxc`fhcwexcrayalbobo````",
+"```````xddbcay`yfhbidgc`eecifiajfidcdmcidmfiaocoalekf`eq`eagdsdsdsbeegcmdkcoclcw`eelbkch`hajdwee`nc`by`wbqcr`va`ddbo````",
+"``````dfehfeanfheidgekaz`zbldmaj`hcaajeubn`haodkbj`kexcfegamam`pamdsbeegcmdkaocxbjelbkch`hajbv`qclfd`wbcdt`oeqbhdedf````",
+"````etcybhaycqfhbhcsfdazaxcadiaj`hchchdm`gajdmdk`kagbeds`p`pepep`pamdsbecmdkao`neuelbkch`hajblahclca`kbndtbrdocqdrecet``",
+"````bsfcbhd`dobrbrczbmazcacb`qca`hchbkeldmf`andkdkej`ramepduduepep`pambecmdkaoelblciebch`hajandtdibuekcccubrdoerctdebs``",
+"`````sfheifbdzfddfexdxazdbcbeuazfich`felbhblbidkanbmeg`pepdududuep`pambeegdkao`cavavblekdhaj`zclerbcdiciecbrcudvezat`s``",
+"`````yad`d`jaybrczcsby`zdbca`bdp`gef`felelavcgcobnbzam`pepdududuep`pambeegcoclchcddmdpcw`zeddidweedpc`aney`vbsdzez`sbs``",
+"````ezadcq`jdobrdtdfcvby`kahcwemajcwbabkelcsf`aocseq`ram`pepepepep`pdsbebmcbesbnbkci`nazfiedfjaafieec`dfahbr`vfcbhezfb``",
+"````ezadbherdo`odtbqffbb`nahcicicdbwbz`felbvavejcb`kdsds`p`p`pep`pamdsen`nancldpcici`cbafiedcb`aacexdmczdt`obbaebbec`y``",
+"````ez`tbhdzfc`obqcwffah`nciekerehfiai`fcsanek`eaoekef`rdsbedsamamdsbe`nem`eaqelbabaaidhedcaddaxe`axc`cubq`oaecjdzewdn``",
+"`````yct`xfcbtcrexaucvbuekeeesf`crdh`hbibv`ffiaq`eekbh`jcg`e`rdsbeegcmekblbaelbk`fch`hdhedfjaadbazbuda`vexcrabadct`sfa``",
+"`````sfh`sahaydzexdt`wffazdteebcbaeddh`gcibdbkelcxbjevdkaiejeqegcmdkejcgcsekbk`fchaidhedbdcb`aaccabbcwcuexcr`jbsehfhet``",
+"````cneccedrbyczbrbqcwffbu`nazemddbdajebcwci`fbk`qbnafaicbdweiejej`eelelahbjfichaidhajbdfjcadbazax`v`na`brdoahcqceasas``",
+"````arboddctekdgbpexau`wbucrerffbifjedajdfcieb`fahf`ek`f`h`gaaelelelelbk`fey`qaidhajedfjcbdbacazbu`wdadj`obmez`x`sctfb``",
+"````eodqaddffeay`jexdt`wfffdeeexdicbbdedajcs`haibz`q`gemb`bjbkbkchdb`f`fchaicx`iajedbdcb`aac`zbuffcyei`ncreqa`dzdzasdq``",
+"````arcnfhdrdzalbp`oexau`w`qdm`qax`acbfjedcsafdh`hdp`hcieubdes`fchchchai`hdhdhdififjcb`aace`axfd`wdgbiabay`jbpfccpezap``",
+"``````dqecctawaydzcrexdtbcccahfde`db`acbahdieiajdhdhdh`heiemf`aiai`hdhdhdhajeddmciee`adbe`azbucvcwbhaybbancjef`ydr`m````",
+"``````arbxadehaydzcj`ofhcreiee`zaze`ac`aercidibdedajajdhdhdmcbdhdhdhajajexbgcsdwciahace`azbucv`wdtcrayawfccqbhctbsas````",
+"``````arezfhddaefcaycr`obbekbndfbuazfdacaccsdpciazfi`uededey`ifiededbdbdfjdfdicxaxeebububuax`wauex`oayaycjalddboezcp````",
+"````````fadqadbofcbteqcrdf`ndf`wcvbuazbididibjf`ahcafjfjfjfidbeifjfjfjcbcbaa`ddbacazdpdaexbxaucsbrcrbhdebg`dadetfa``````",
+"````````ctasfhdqd`fc`vdoekay`vau`wcvbuc`eebc`z`zdb`a`acbcb`beeahcbcb`a`adb`zace`azbu`wdtccdaabbccrcqa`deefddfhfbap``````",
+"````````eofacyadawctbgeq`xeifdbqaucyfgeedabuazaze`acacdbfiddblbleedbacac`zb``zbudfffbvczdg`neqc`docja`ezceadcydnap``````",
+"``````````dqdqecctctczcjeqeafgbrexexc`ccciffbubuazazazdddf`qesercsazazazfdcx`gbbaubccwdt`vcualaleqcjfcezeiecezdq````````",
+"``````````eobs`xctdrctbgeraeeacrbrexabbicz`wcvffffbubudf`zaneecebqbububudxfddx`wcwaudtexbrcrah`jerbgctecfhcpbsar````````",
+"````````````bofaezdeecbhdvfeaw`vcr`ocjaya`cucw`w`wcvcvccerdfei`w`jffcvcv`w`wcwaudtexex`ocrdoeafcbgcqdzdrasareo``````````",
+"``````````````dq`ycpbs`sbhanbs`kef`qcrayd`exdtdtaucwcwer`ndfccbc`w`wcwcwaudtdtexex`ocr`qahekczdqbh`ybocpdnar````````````",
+"``````````````apasezcydeddfhcta`eaeqdoawaebbfgcuexbqababf`ek`kaudtdtdtbqexexexdafgcrdofcdfeialdzddcycp`tapap````````````",
+"````````````````bo`tbobodeezfedfa`cj`jeqayeiaybnbpbrbydzeifhcydjexexexbrbp`ocrdzdoeq`jdd`yfcfafcdqcyezdldl``````````````",
+"``````````````````cn`tezcyatctddbhal`kcj`jbsayal`qddbba``y`o`o`ocrcrcrcr`qdoaybt`jcj`kalfebofbcpctez`teo````````````````",
+"````````````````````ewfbdqdqcpfhddehefalcqdrehefeq`ya``vdododododobmeqeqeqcqfabpcqalef`sdebxbxbocpfbew``````````````````",
+"``````````````````````dndq`s`xdffhaddd`tctecczbpcjdzdzdv`jdveh`j`j`j`jbpalfcbgalcyeh`satdrfcbsdnascn````````````````````",
+"````````````````````````ardlfafbcpfbbtbo`yctbhbhasa``sbg`k`k`k`k`kbgbgalefbhbhceetdfbodfdr`metdrcp``````````````````````",
+"``````````````````````````dndrewfadnboecfhadeidddrdzfcbhbhbhezbhbhbh`dehceddeiboctctdndqdndneoap````````````````````````",
+"``````````````````````````````boewdq`lez`xcyecfhdeadfcbsecctdrdd`sdqadaddefheccybo`y`mareoar````````````````````````````",
+"````````````````````````````````apaparfbfa`ycz`xcyetcpcpcpatdqec`sececcycy`xdnasfadrdleoar``````````````````````````````",
+"````````````````````````````````````eoarbocnfbfafaasdrarfcbobsczczczez`yfafafbdqdreoar``````````````````````````````````",
+"``````````````````````````````````````````apbodretcncndqarar`mbsasfbasdqcndreoap````````````````````````````````````````",
+"````````````````````````````````````````````````apdneoeoeoarbocncnboapdnap``````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue11[] = {
+/* width height ncolors chars_per_pixel */
+"72 72 175 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #1B1B2B",
+"`c c #282845",
+"`d c #191929",
+"`e c #323252",
+"`f c #303050",
+"`g c #111121",
+"`h c #2E2E4E",
+"`i c #0F0F1F",
+"`j c #1D1D30",
+"`k c #1B1B2E",
+"`l c #0C0C12",
+"`m c #0A0A10",
+"`n c #17172A",
+"`o c #212137",
+"`p c #767691",
+"`q c #1F1F35",
+"`r c #2F2F48",
+"`s c #101019",
+"`t c #0E0E17",
+"`u c #272740",
+"`v c #181824",
+"`w c #25253E",
+"`x c #21213A",
+"`y c #12121E",
+"`z c #10101C",
+"a` c #20202F",
+"aa c #0E0E1A",
+"ab c #2B2B47",
+"ac c #0C0C18",
+"ad c #292945",
+"ae c #161625",
+"af c #141423",
+"ag c #242436",
+"ah c #313150",
+"ai c #121221",
+"aj c #2F2F4E",
+"ak c #2D2D4C",
+"al c #2B2B4A",
+"am c #1A1A2C",
+"an c #5C5C7A",
+"ao c #161628",
+"ap c #333355",
+"aq c #07070C",
+"ar c #313153",
+"as c #05050A",
+"at c #0D0D15",
+"au c #07070F",
+"av c #24243C",
+"aw c #202038",
+"ax c #0D0D18",
+"ay c #1D1D2B",
+"az c #0B0B16",
+"b` c #282843",
+"ba c #262641",
+"bb c #232334",
+"bc c #11111F",
+"bd c #0F0F1D",
+"be c #2C2C4A",
+"bf c #3C3C5D",
+"bg c #2A2A48",
+"bh c #1B1B2C",
+"bi c #19192A",
+"bj c #151526",
+"bk c #131324",
+"bl c #303051",
+"bm c #111122",
+"bn c #1F1F33",
+"bo c #19192D",
+"bp c #08080F",
+"bq c #161620",
+"br c #23233A",
+"bs c #212138",
+"bt c #0E0E18",
+"bu c #0A0A14",
+"bv c #272741",
+"bw c #25253F",
+"bx c #23233D",
+"by c #12121F",
+"bz c #10101D",
+"c` c #202030",
+"ca c #0E0E1B",
+"cb c #1E1E2E",
+"cc c #2B2B48",
+"cd c #0C0C19",
+"ce c #292946",
+"cf c #181828",
+"cg c #28283B",
+"ch c #262639",
+"ci c #2F2F4F",
+"cj c #101020",
+"ck c #1C1C2F",
+"cl c #2A2A40",
+"cm c #18182B",
+"cn c #353558",
+"co c #09090F",
+"cp c #333356",
+"cq c #07070D",
+"cr c #15151E",
+"cs c #202036",
+"ct c #1C1C32",
+"cu c #090912",
+"cv c #191925",
+"cw c #26263F",
+"cx c #24243D",
+"cy c #22223B",
+"cz c #13131F",
+"d` c #11111D",
+"da c #0F0F1B",
+"db c #0D0D19",
+"dc c #2A2A46",
+"dd c #262642",
+"de c #171726",
+"df c #151524",
+"dg c #131322",
+"dh c #111120",
+"di c #2E2E4D",
+"dj c #0F0F1E",
+"dk c #1D1D2F",
+"dl c #343456",
+"dm c #08080D",
+"dn c #151527",
+"do c #06060B",
+"dp c #1F1F34",
+"dq c #1B1B30",
+"dr c #0C0C14",
+"ds c #0A0A12",
+"dt c #494967",
+"du c #23233B",
+"dv c white",
+"dw c #14141F",
+"dx c #212139",
+"dy c #1E1E2C",
+"dz c #2B2B46",
+"e` c #0C0C17",
+"ea c #292944",
+"eb c #0A0A15",
+"ec c #262637",
+"ed c #141422",
+"ee c #2D2D4B",
+"ef c #0E0E1C",
+"eg c #1A1A2B",
+"eh c #373758",
+"ei c #181829",
+"ej c #161627",
+"ek c #333354",
+"el c #141425",
+"em c #313152",
+"en c #121223",
+"eo c #222236",
+"ep c #030307",
+"eq c #BCBCD7",
+"er c #1E1E32",
+"es c #1C1C30",
+"et c #1A1A2E",
+"eu c #0B0B12",
+"ev c #18182C",
+"ew c #28283F",
+"ex c #090910",
+"ey c #222239",
+"ez c #202037",
+"f` c #11111B",
+"fa c #1E1E35",
+"fb c #0F0F19",
+"fc c #0D0D17",
+"fd c #0B0B15",
+"fe c #1B1B28",
+"ff c #090913",
+"fg c #262640",
+"fh c #171724",
+"fi c #151522",
+"fj c #212131",
+"fk c #2E2E4B",
+"fl c #2C2C49",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````bpcudf`tdeded`aedfdrau````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````cqd`e`fdbh`kckck`yesesckckbzbiegaobped````````````````````````````````````````````````````",
+"`````````````````````````````````````````````````ydeeidack`jficv`vdecscsdbazaccmaadgaf`jckdacuf`ed``````````````````````````````````````````````",
+"````````````````````````````````````````````ae`dbhfdcmaoczcs`oeyeyeyfee`bzamazaaesacbiazczbnerckdgdfae``````````````````````````````````````````",
+"````````````````````````````````````````ds`ybh`j`k`vbq`yeyduavavbddbcadbca`wdhaabravfedudpej`ocseraabubiau``````````````````````````````````````",
+"````````````````````````````````````btcfbh`jfbaa`oeycvav`w`wamezaidgdbbjbselfebvbvfgcw`w`wcmbzet`o`vaaffbhde`t``````````````````````````````````",
+"``````````````````````````````````dregckerdbaaeyfiaccxcwbvbvfeb`cabcbz`qduaielamdfcab`bvbvfeeyfhduey`yejerckcfej````````````````````````````````",
+"``````````````````````````````bpdgbh`jdpfedbelctd`aedyb`b`eaaf`qbdbj`aaybnctelcxbvayadeab`b`bvfg`wfeetaadwdp`jbccfcz````````````````````````````",
+"````````````````````````````fccuaxazda`o`odbcabja`b`b`addc`afj`adjbjfl`devbw`ndg`aafab`adcadb`b`bvcxcaey`o`o`qaobheied``````````````````````````",
+"``````````````````````````ed`zfb`vesbhdudxelcmaib`addc`accflbebeeeeeeebbeeeeao`idjbebeflcc`adccbdecsdxbwcxdu`vaie`e``dfi````````````````````````",
+"````````````````````````bpcufibier`qduaiaielaiefdc`accflbeeeeeakdidididididibjao`nakeeeebeflcca`af`kbdbvfi`wductazebaa`dat``````````````````````",
+"``````````````````````auei`kbcfb`jdudbdbcacjcjdeccflbeeeakdia`faevenaoeab`brajcxbeawdidiakfldjaodhefdjfedhfe`w`oesdb`z`keids````````````````````",
+"````````````````````czcfbhaxcsaidufecacxdgad`accfleeakdidiajam`ncjaodncjboevelcydqet`xajdidibhevbk`i`qbddecmfg`wfe`kbq`de``zcz``````````````````",
+"``````````````````atdeamca`jazcacx`vbzb`ad`accbeeeakdiajci`fajcybxccctcmagbhawet`gbkbw`fciajdib`bkdjcjdjefb`bvcw`bdbbsdp`jamcud`````````````````",
+"```````````````````tbibi`jacd`cxdycabcad`accbeeedidiajci`fcievcjbmbmee`e`e`ebgaw`gfaccbl`fci`wawfab`bkboevaib`bv`wboaa`obnesbi`s````````````````",
+"````````````````cqeiff`vcsey`v`waidhbwayccbeeedi`hci`f`fememeablbmbmembrekbbetdqaoctevbiem`faocjdqfaelevezbv`bbnbv`wcseycsbq`kdaed``````````````",
+"```````````````zcuegbuaxbsbzaofgeoa`efavfleedidici`fblemem`e`ech`hbmenchap`jagbednbmctccememccbabaagbjaw`dela`cbbvfgfe`jbsdpbuamat`m````````````",
+"``````````````atbiffercsctavcsbvb`cbetflbeakdiaj`fbbdnem`eekek`n`nfab`cmelcmcpapapapcgek`eemciajeldkageaa`cbabadb`bvaieleycsbqbdd`fi````````````",
+"````````````dsedame`debs`qaidbb`adfjbwbeeediajb`fa`hejc`ekekagevfaceaoecdldldlcpcpapapekek`edd`nbjciajdieecbccdcadbzduesdubs`qaae`de`y``````````",
+"````````````fibtffebcmesdbezfeb`adelet`dbhcteldnbmencebmekapdncyenevctagdldldleldn`jamapcgbbevcidn`fci`hdieeflabadeyedfeaveyfh`kaicufi``````````",
+"``````````drdeamfdejazaidb`nb`eaaybwbabmen`ncy`cecalenceapcpdndndqetfacncncnecdnecbockcgagb`bketfadzciajdieebecccjduayfg`wdubsbqdeeide`t````````",
+"``````````eddefdcabdazducsbdb`ad`wejcjendqb`babbembgawelapcpbe`ecscncncncncnclcncgbmfkclbkcybmbaaobl`fcidiakbebbfacjb`bv`waveycs`je`cfed````````",
+"`````````mcqbiffamazaicmcmeyb`dcccfl`icjdxfacjecagemdqapcpdlevccagcncncncncncncgcnecdldlch`haofjarem`fciajdieecbawcbb`bvcwaveycsckaibifbfd``````",
+"`````````y`sdsazazer`jetdb`kerdcccbedubmdcbv`nfaenbkelapcpamelbwelehcgbfbfbfbfaocgcndldlcp`jaoee`eembl`fa`dieedgelbdeaefdycxbr`obqfdamde`y``````",
+"````````dgcfdabudgacdkcsdbcjej`nb`beakbhevel`nbkaodncgcpdlenevbkb``rclahdtdtbfbf`rcncndldlcpaodnagembl`fcidiakdgbodqdgetefavdubs`qacbycfdg``````",
+"``````btfdeiaafd`zaxd`cm`wet`nctbddjakdicmdi`n`genawapcpdlenelcmeyahahdtdtanandtbfbfcndldlcpdnbmcgembl`fcidiakezbdfgdgfebzfiaveycsbqe`f`fi`m````",
+"```````zcqbiffbjerdbduca`qb`adaidcceakdicicjbxdubmarcmcpdlcmbvewdzandt`panananandtbfehcndlcpewdnbmemem`fcidiakcjaiefdhayer`qaveycserbqcuae`l````",
+"```````ybpbidadw`jeydgdbfeb``wefbb`nakdiciagccejenctcecpdlcsehehehan`peqeqeq`p`pandtbfcndlcpagbxboecbl`fcidiakdgcfdueyayeserbyeycsercrcud``y````",
+"``````by`tcuda`v`oey`naybnb`ad`wea`icbdici`fblemdnaoenekdlclekcl`p`peqdvdveqeqeq`pdtbfehdlcpcgbwbmcydk`fcidiakdjbaef`netelcacaey`obnesazbpby````",
+"````asczdeaebubq`vdwef`qfeb`ad`acccyevejci`fblemaoen`hapdlcmerdtan`pdvdvdvdvdveq`panbfehdlapewevet`xb`fjagdiakegbkefdxaidgbkbjey`obhes`tbtczeu``",
+"````atfbdee``jeb`ofeejfaay`dad`acc`qbkbkeaciblemfjbwbgapdzdleranan`pdvdvdvdvdveq`panbfehdlapcmcycybmbvcyetdiak`bduezdncmdhdbesey`oafbie``tfbat``",
+"`````td`de`t`jcr`oeydkdbcffeayayfjdcdj`xet`g`fememendnapdib`csehdt`peqdvdvdveqeq`pdtbfehdlbkblakawfa`gbadgdieebedgefbdbodh`wdhax`oebdsatf`d``t``",
+"````btbydeamesbncseyavayfgdebvaicj`n`nctaddx`fblem`nbmekec`famcgan`peqeqeqeqeq`pandtbfckenbmbmdncicjcjctawc`eeflccdccw`g`g`ndbdacsaxckcudefbds``",
+"````btbpdeamckercseydufefgcb`n`gefcjdjadetcyci`fagad`gb`apce`kbf`rdtan`p`p`p`pandtbf`j`abkekenejelcj`cabdiakbeflabdceabodhbddueycsbidgegbpcqas``",
+"`````md``scre`bccseydu`wfgaiduefcjdgesdgew`hci`fctbmcj`eekagelbibbbfdtbfdtanandtbfbf`netcm`eemembbeceo`hdieecb`db`adb`bccaaydueyazebckcucudsdm``",
+"````eucqf`f`fffddbbsbrcxcwbvendhdncmbvfjakdiaj`gcicx`nem`eekaocmbn`e`rch`rbfdtbfehcnenboctemembl`fciajdiakeeflbrdcadb`bvcacabrbsfbdfaxcraeexeu``",
+"````asdr`sfbaie`bd`oeyav`wfga`cacjcjaicbb`didicccjbwaiemembmenbbdlbhfkajcgbfehcndlapbbbwdnembl`fciajdidieebeccabdceab`fe`ncvey`ocvbubtbi`se`dr``",
+"````dscqae`dbudsebaaeydu`wfgbvcfeyezefdgbeakdieecjbmamblbbdnevbbfkc`cybxaodldlapek`eemb`enc``fcici`hdiakbeflccdcadb`dhdectbyey`odpdbe``daecqco``",
+"````epd`dfcfdgebdbebeyducxbwbvb`aebobk`gbeeeakagfgelb``fblelbgdnemenfa`xej`e`e`eemem`ffjccdg`waj`hdiakeebecc`udceab`dyay`kaceycserafamcf`tdreu``",
+"````dof`eddefdejaiam`oeyav`wfgbva`dudccjccbeeeakejbk`ici`fddenbwfaevcjdgememememewblbl`f`fbxfa`hdiakeebeccabdcadb`bvfgcvdjfe`o`qerd`at`scqcqas``",
+"``````fbbpdedgdebibz`veyducxbwbvbwcaeyefccflbeeeakbeaoajcibh`qcjelcjbxeiblblblec`f`f`fcicicb`gecakeebeflccdcaddya`bvbwboejesbhdp`je`e`dscqfb````",
+"``````btcuaecufdfcelcsbseyav`wfgdjfgbv`d`accflbeeebjeedi`hajajawbmbmfacjen`f`fciciciciaj`hdidneleebeflcc`aadeaayayfgavdhbjbjeleresbjfdau`tbt````",
+"``````atf`ficufdaabu`ycseyducxdyejfeafeadc`accccfjetfaakdidiecagcbfaevbkctfjciajaj`hdididiakelbkflcbcc`adceab`bvfg`wcvdbdbazd`buckf`dgd``yat````",
+"``````ds`leddeedfdbuazcs`ofedacd`qbnfeb`eadc`accb`djbveeeeakdididiavdq`ib`didididididiakeeeebj`gdjfafjdceab`bvfgcw`wdueyazdhelaobhbiaefd`zds````",
+"````````asczdff``tckdf`vcscvazacducdfebvb`eaaddcceetcyezbjeeeeeeakakc`aoakdiakakakeeeeee`dccctdxaocjdheab`bvbvcw`wavbrbhdbe`ckbiamcfdr`zfb``````",
+"````````dod``yde`ybjbcbt`q`ocve`dhcxaibvbvb`cbayducydxdqbmctbbfjbeeeeecxdjeleeeebebebeflccceaicya`a`cj`qfjfeay`wavduey`oebbudgbhbidefdd`do``````",
+"````````bp`sdraecfdafcejercsaiazesca`wcwfgbva`dudjefefcyctaicbccflflbefjdcbobeflflccccccabfjdyadadb`bo`nbo`wbyaocm`v`ocsbid`ckegcfaeeu`sep``````",
+"``````````fc`zeddedacuffbqdpczcaerduav`wcwfgbhcjdqdgbzay`day`aabccccccdgefdxccccccab`a`adcfjadeab`b`dyeddbdbbzbzdbczcsbqelffam`ddeedf`fc````````",
+"``````````ep`satdfcubdcuaferdpaz`odpduav`wbwdgdbaib`b`eaadaddcdcdcdcaydhefdxdjdcdcdcdcay`gelbhb`bvbvfgcvbs`kbd`jaibddpbubhaxbidedfczdseu````````",
+"````````````fcdoedafejcudg`jercmesbseyducdcmctcabdbvbvb`b`b`eaeaadayfjbocjbdfaafadeaeaa`cmbdbvcfbjai`wedczda`jbze`fier`jaidrcfaeedd`co``````````",
+"````````````as`lbycqdabpbick`jdweb`v`oeyfhdhbidbdbcwfgbvbvbvb`b`bcbkbzeybjefbddyb`b`b`ay`kbjbcbdbifiavdubrey`obtesdw`jcfe`dscufibyfbds``````````",
+"``````````````ateuczdfbpcuamck`jbi`ycs`oey`zacdgcz`w`wcwfgfgbvbvcbaiaiaocadhfeaybvbvbv`obhdy`d`wcxavdueyey`ocsctbce`ckcfbudacufdfdco````````````",
+"``````````````asbtd`bpededbiamcmbubj`vcscsbsdbcaaacvcx`w`w`wcwcwdyeyeldgejcmfefgfgcwcw`w`w`wcxavdubreybscscsdpbze`crambue`bybydoaqas````````````",
+"````````````````eufb`y`sfdf`bifdaxbhacerdpcsfiazcabrduduavcxcx`wbycs`qdgbzbjed`w`w`wcxcxavdudubreybs`ocsdpbtaidbe`ambidfaubyeufdaq``````````````",
+"``````````````````drfbdscqaedebideffaabuerdpfdbzaicafecfbrdudufhfhdpacbscsavavavavavdudubreyey`zbqcscsdpbubzbudwamcrdedsfd`ycqep````````````````",
+"``````````````````dmat`zdobyaedefdcudgfbcr`jeraxeldb`kdbczeyeyazbjbd`vfielca`vbrbreyeybnbs`o`oebcvdperbqffacdgfcdr`saeed`s`zaqep````````````````",
+"````````````````````coatdo`yeddfczbpde`d`kck`jer`v`zaibdescs`bamdbercvfi`veyeybsbs`ocvcscscsebazerer`jckdgfddrf`aue`dr`y`zatep``````````````````",
+"``````````````````````exat`s`ydsbtcufibiegbh`kck`jaxbzaieldpbheiacbjcscscscscscscscs`qdpdpfh`jbt`jck`kbhegcuejfcdse`bp`satbp````````````````````",
+"````````````````````````exdr`ldoaucqfidecfbiegbhcrcfao`y`jer`zebazdpdpdpdpdpdpdpbnerereregf`debqcrbhegbibzdfbybtcqcq`tatex``````````````````````",
+"``````````````````````````coaqatf`byeddfaedeeibidgcubyfdckckfdbuff`j`jf`eicf`j`j`j`j`jaacadrbhf`e`bieibpaieucuexdododmco````````````````````````",
+"````````````````````````````epeubtcq`yczbp`sbpbpdsfdaeegambheiff`sckckckckckckck`k`kf`buamegbi`dcfdedfdse`bpdofccqcodm``````````````````````````",
+"``````````````````````````````aqeuatdocqfbds`tdfaededecfeiaacucregamamamamamamamegegbibieicfdedsbtdsbpbpcqbt`lasasaq````````````````````````````",
+"``````````````````````````````````coepcqbpcq`yczedfidfaedeaecubpdeeieif`cucueieicfcfdededeaeatbpbybpdobpfdasdoep````````````````````````````````",
+"````````````````````````````````````epaqasdofbf``ybyczedfifidfcucubpcubpeufificu`saedf`sfiedczdrcudo`mascq`maq``````````````````````````````````",
+"````````````````````````````````````````epasdr`tfb`zf``ybyczeubpdscqaubtdred`tedededczczbyds`meufb`tasbpep``````````````````````````````````````",
+"````````````````````````````````````````````asepaqdocofbfb`zfbbtdobpcq`zbt`y`y`yd`d`f``zfbfb`tateuepaq``````````````````````````````````````````",
+"````````````````````````````````````````````````dodoepeudrat`tdodseudoas`mfbfbfbfbbt`tatdreudsdoaq``````````````````````````````````````````````",
+"``````````````````````````````````````````````````````aqasepepasepcoasepexdrdreueuds`mepdoaq````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````epepepepepdoaqaqasepaq````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue2[] = {
+/* width height ncolors chars_per_pixel */
+"12 12 70 2",
+/* colors */
+"`` c None",
+"`a c #323252",
+"`b c #303050",
+"`c c #0F0F1F",
+"`d c #1B1B2E",
+"`e c #17172A",
+"`f c #1F1F35",
+"`g c #181824",
+"`h c #25253E",
+"`i c #10101C",
+"`j c #20202F",
+"`k c #0E0E1A",
+"`l c #292945",
+"`m c #141423",
+"`n c #242436",
+"`o c #2D2D4C",
+"`p c #333355",
+"`q c #313153",
+"`r c #0D0D15",
+"`s c #24243C",
+"`t c #262641",
+"`u c #232334",
+"`v c #3C3C5D",
+"`w c #19192A",
+"`x c #303051",
+"`y c #111122",
+"`z c #1F1F33",
+"a` c #08080F",
+"aa c #212138",
+"ab c #12121F",
+"ac c #0E0E1B",
+"ad c #1E1E2E",
+"ae c #2B2B48",
+"af c #2F2F4F",
+"ag c #1C1C2F",
+"ah c #18182B",
+"ai c #353558",
+"aj c #15151E",
+"ak c #1C1C32",
+"al c #26263F",
+"am c #13131F",
+"an c #0F0F1B",
+"ao c #2A2A46",
+"ap c #131322",
+"aq c #2E2E4D",
+"ar c #0F0F1E",
+"as c #343456",
+"at c #151527",
+"au c #1F1F34",
+"av c #0C0C14",
+"aw c #494967",
+"ax c #23233B",
+"ay c white",
+"az c #0C0C17",
+"b` c #141422",
+"ba c #2D2D4B",
+"bb c #0E0E1C",
+"bc c #161627",
+"bd c #333354",
+"be c #141425",
+"bf c #1E1E32",
+"bg c #1C1C30",
+"bh c #0B0B12",
+"bi c #18182C",
+"bj c #090910",
+"bk c #222239",
+"bl c #0F0F19",
+"bm c #1B1B28",
+"bn c #262640",
+"bo c #151522",
+/* pixels */
+"`````````d`sacbmbf``````",
+"````a`axaobaaqba`max`r``",
+"````aabbaf`a`pak`t`jaa``",
+"```wah`c`nbiaias`qbaal`w",
+"``an`zadatbday`v`y`obebg",
+"``azbnbgakbeaw`e`uadacag",
+"``apaxbk`o`f`x`b`o`lbcaz",
+"``avbf`haradaoae`lab`wbh",
+"````b``g`kalbcalaxauaz``",
+"````bjboaj`iaubfajabbj``",
+"````````blbhavambl``````",
+"````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue3[] = {
+/* width height ncolors chars_per_pixel */
+"14 14 82 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #282845",
+"`c c #111121",
+"`d c #2E2E4E",
+"`e c #1B1B2E",
+"`f c #0A0A10",
+"`g c #17172A",
+"`h c #101019",
+"`i c #181824",
+"`j c #21213A",
+"`k c #10101C",
+"`l c #20202F",
+"`m c #0C0C18",
+"`n c #161628",
+"`o c #07070F",
+"`p c #24243C",
+"`q c #0B0B16",
+"`r c #282843",
+"`s c #11111F",
+"`t c #0F0F1D",
+"`u c #1B1B2C",
+"`v c #19192A",
+"`w c #151526",
+"`x c #303051",
+"`y c #111122",
+"`z c #19192D",
+"a` c #23233A",
+"aa c #212138",
+"ab c #0E0E18",
+"ac c #0A0A14",
+"ad c #272741",
+"ae c #23233D",
+"af c #202030",
+"ag c #1E1E2E",
+"ah c #2B2B48",
+"ai c #181828",
+"aj c #28283B",
+"ak c #2F2F4F",
+"al c #2D2D4D",
+"am c #1C1C2F",
+"an c #18182B",
+"ao c #353558",
+"ap c #15151E",
+"aq c #191925",
+"ar c #24243D",
+"as c #13131F",
+"at c #11111D",
+"au c #0D0D19",
+"av c #262642",
+"aw c #151524",
+"ax c #2E2E4D",
+"ay c #343456",
+"az c #06060B",
+"b` c #0C0C14",
+"ba c #494967",
+"bb c #23233B",
+"bc c white",
+"bd c #0C0C17",
+"be c #292944",
+"bf c #0A0A15",
+"bg c #2D2D4B",
+"bh c #0E0E1C",
+"bi c #1A1A2B",
+"bj c #373758",
+"bk c #181829",
+"bl c #161627",
+"bm c #141425",
+"bn c #313152",
+"bo c #121223",
+"bp c #1E1E32",
+"bq c #1C1C30",
+"br c #18182C",
+"bs c #222239",
+"bt c #11111B",
+"bu c #1E1E35",
+"bv c #0F0F19",
+"bw c #0D0D17",
+"bx c #0B0B15",
+"by c #1B1B28",
+"bz c #262640",
+"c` c #2C2C49",
+/* pixels */
+"``````````awbsau`mbp````````",
+"``````bdbhbe`wbu`lbe`p`w````",
+"`````var`aaxbmbn`caxbr`tb```",
+"````aqbeblbr`baybnboax`lat``",
+"``ai`pbq`g`ubmbaao`yak`g`pai",
+"```s`tahakalbabcbaajafbr`tbw",
+"``ap`p`cagav`vbabjbnax`l`i`n",
+"``aiaaadc``d`jbn`x`cc`adai`h",
+"``as`e`n`r`zagbzbgae`r`pacbx",
+"````as`qanad`r`n`rag`pbf`h``",
+"````bvbkbpbqaubba`byabbtbv``",
+"``````azaw`sauabambi`o`f````",
+"``````````abbw`katab````````",
+"````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue4[] = {
+/* width height ncolors chars_per_pixel */
+"20 20 130 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #282845",
+"`c c #323252",
+"`d c #303050",
+"`e c #111121",
+"`f c #2E2E4E",
+"`g c #0F0F1F",
+"`h c #1D1D30",
+"`i c #1B1B2E",
+"`j c #0C0C12",
+"`k c #0A0A10",
+"`l c #17172A",
+"`m c #212137",
+"`n c #767691",
+"`o c #1F1F35",
+"`p c #2F2F48",
+"`q c #101019",
+"`r c #0E0E17",
+"`s c #181824",
+"`t c #25253E",
+"`u c #12121E",
+"`v c #10101C",
+"`w c #20202F",
+"`x c #0E0E1A",
+"`y c #0C0C18",
+"`z c #292945",
+"a` c #161625",
+"aa c #141423",
+"ab c #121221",
+"ac c #2F2F4E",
+"ad c #2D2D4C",
+"ae c #1A1A2C",
+"af c #5C5C7A",
+"ag c #161628",
+"ah c #333355",
+"ai c #07070C",
+"aj c #313153",
+"ak c #05050A",
+"al c #0D0D15",
+"am c #24243C",
+"an c #202038",
+"ao c #1D1D2B",
+"ap c #0B0B16",
+"aq c #282843",
+"ar c #11111F",
+"as c #2C2C4A",
+"at c #3C3C5D",
+"au c #1B1B2C",
+"av c #19192A",
+"aw c #131324",
+"ax c #303051",
+"ay c #111122",
+"az c #1F1F33",
+"b` c #19192D",
+"ba c #08080F",
+"bb c #161620",
+"bc c #23233A",
+"bd c #0E0E18",
+"be c #0A0A14",
+"bf c #272741",
+"bg c #25253F",
+"bh c #10101D",
+"bi c #1E1E2E",
+"bj c #2B2B48",
+"bk c #0C0C19",
+"bl c #292946",
+"bm c #2F2F4F",
+"bn c #101020",
+"bo c #1C1C2F",
+"bp c #2A2A40",
+"bq c #18182B",
+"br c #353558",
+"bs c #09090F",
+"bt c #07070D",
+"bu c #15151E",
+"bv c #1C1C32",
+"bw c #090912",
+"bx c #191925",
+"by c #24243D",
+"bz c #22223B",
+"c` c #13131F",
+"ca c #11111D",
+"cb c #0D0D19",
+"cc c #2A2A46",
+"cd c #171726",
+"ce c #151524",
+"cf c #131322",
+"cg c #0F0F1E",
+"ch c #343456",
+"ci c #08080D",
+"cj c #151527",
+"ck c #1F1F34",
+"cl c #1B1B30",
+"cm c #0C0C14",
+"cn c #0A0A12",
+"co c #494967",
+"cp c #23233B",
+"cq c white",
+"cr c #14141F",
+"cs c #1E1E2C",
+"ct c #0C0C17",
+"cu c #292944",
+"cv c #141422",
+"cw c #2D2D4B",
+"cx c #0E0E1C",
+"cy c #373758",
+"cz c #181829",
+"d` c #161627",
+"da c #141425",
+"db c #313152",
+"dc c #121223",
+"dd c #030307",
+"de c #BCBCD7",
+"df c #1C1C30",
+"dg c #1A1A2E",
+"dh c #0B0B12",
+"di c #18182C",
+"dj c #090910",
+"dk c #222239",
+"dl c #202037",
+"dm c #11111B",
+"dn c #1E1E35",
+"do c #0D0D17",
+"dp c #0B0B15",
+"dq c #1B1B28",
+"dr c #262640",
+"ds c #171724",
+"dt c #151522",
+"du c #2C2C49",
+/* pixels */
+"```````````````vdpbbazd``idt````````````",
+"``````````cmbbbxbg`ecpbfbgckbedm````````",
+"`````````vdscb`zbjamcwbjbj`zcsbbav``````",
+"``````czcbbq`acwbmbvaccjbmdudrcsbxca````",
+"````c``vbvcxad`dajaqahdlbjbvcf`w`tbxc```",
+"````aecbaqagbncjahdachawahblbmascpdkbe``",
+"``baap`haodidn`bbpbpataechaw`dcwcsbyapba",
+"``c`bubvaoadbmad`icodeafbr`laxadbqb`ckcv",
+"``a`apbvcccl`danb``ncq`ncybmclcwcxagbd`q",
+"```rdpby`ldfacagah`pcocodcdbacbicubxaadj",
+"``cvbhbcbfdcadbn`oacd``cabbmadbiao`xabal",
+"``bsct`m`t`objbv`fbndgbm`fcgbjcu`t`ybbdm",
+"``akcdaparcfdqbvaqcw`gcwdubzbfaodkapcdbt",
+"````c`bw`ubcdsbfcuccaycc`wbfbg`lckdmc```",
+"````bacecr`sbobx`tbkd`dr`tamdkckaucndd``",
+"```````rcecf`hd`bbctc`dkbbct`hdpcmci````",
+"````````cmcfcdcvbocrcz`haeae`qdpal``````",
+"``````````ba`jc`cebdcncmcec``kak````````",
+"``````````````aidhcm`kdobsai````````````",
+"````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue5[] = {
+/* width height ncolors chars_per_pixel */
+"24 24 139 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #323252",
+"`c c #303050",
+"`d c #111121",
+"`e c #2E2E4E",
+"`f c #0F0F1F",
+"`g c #1D1D30",
+"`h c #1B1B2E",
+"`i c #0C0C12",
+"`j c #0A0A10",
+"`k c #17172A",
+"`l c #212137",
+"`m c #767691",
+"`n c #1F1F35",
+"`o c #101019",
+"`p c #181824",
+"`q c #25253E",
+"`r c #12121E",
+"`s c #10101C",
+"`t c #20202F",
+"`u c #0E0E1A",
+"`v c #292945",
+"`w c #161625",
+"`x c #141423",
+"`y c #242436",
+"`z c #313150",
+"a` c #121221",
+"aa c #2F2F4E",
+"ab c #2D2D4C",
+"ac c #1A1A2C",
+"ad c #161628",
+"ae c #333355",
+"af c #07070C",
+"ag c #313153",
+"ah c #05050A",
+"ai c #0D0D15",
+"aj c #24243C",
+"ak c #202038",
+"al c #0D0D18",
+"am c #1D1D2B",
+"an c #0B0B16",
+"ao c #282843",
+"ap c #262641",
+"aq c #232334",
+"ar c #0F0F1D",
+"as c #2C2C4A",
+"at c #3C3C5D",
+"au c #19192A",
+"av c #151526",
+"aw c #131324",
+"ax c #303051",
+"ay c #111122",
+"az c #1F1F33",
+"b` c #08080F",
+"ba c #161620",
+"bb c #23233A",
+"bc c #212138",
+"bd c #0E0E18",
+"be c #0A0A14",
+"bf c #272741",
+"bg c #25253F",
+"bh c #12121F",
+"bi c #10101D",
+"bj c #202030",
+"bk c #0E0E1B",
+"bl c #1E1E2E",
+"bm c #2B2B48",
+"bn c #0C0C19",
+"bo c #181828",
+"bp c #28283B",
+"bq c #2F2F4F",
+"br c #101020",
+"bs c #1C1C2F",
+"bt c #18182B",
+"bu c #353558",
+"bv c #09090F",
+"bw c #333356",
+"bx c #07070D",
+"by c #15151E",
+"bz c #202036",
+"c` c #1C1C32",
+"ca c #090912",
+"cb c #191925",
+"cc c #26263F",
+"cd c #24243D",
+"ce c #22223B",
+"cf c #13131F",
+"cg c #11111D",
+"ch c #0F0F1B",
+"ci c #0D0D19",
+"cj c #2A2A46",
+"ck c #171726",
+"cl c #131322",
+"cm c #111120",
+"cn c #2E2E4D",
+"co c #0F0F1E",
+"cp c #343456",
+"cq c #08080D",
+"cr c #151527",
+"cs c #06060B",
+"ct c #1F1F34",
+"cu c #0C0C14",
+"cv c #0A0A12",
+"cw c #494967",
+"cx c #23233B",
+"cy c white",
+"cz c #0C0C17",
+"d` c #292944",
+"da c #0A0A15",
+"db c #262637",
+"dc c #141422",
+"dd c #2D2D4B",
+"de c #0E0E1C",
+"df c #1A1A2B",
+"dg c #161627",
+"dh c #333354",
+"di c #141425",
+"dj c #313152",
+"dk c #121223",
+"dl c #030307",
+"dm c #BCBCD7",
+"dn c #1E1E32",
+"do c #1C1C30",
+"dp c #1A1A2E",
+"dq c #0B0B12",
+"dr c #18182C",
+"ds c #090910",
+"dt c #222239",
+"du c #11111B",
+"dv c #1E1E35",
+"dw c #0F0F19",
+"dx c #0D0D17",
+"dy c #0B0B15",
+"dz c #1B1B28",
+"e` c #262640",
+"ea c #151522",
+"eb c #212131",
+"ec c #2C2C49",
+/* pixels */
+"``````````````````bxdybsdobsdfdc````````````````",
+"```````````````r`h`rajcibk`udzdgdnau````````````",
+"``````````b``gcicgao`xavazcd`vao`q`u`gcf````````",
+"````````b`aucxdicjecddcncnadddec`xbfcxdaai``````",
+"``````aibkbkbi`addaaaabm`ydpbgaaawcobfci`gcg````",
+"``````dfbce`deddbqdj`bayaeasc`djapak`te`bcac````",
+"````eadaciaodpc`ayaycrdrcpdiacaqcr`eecdtaj`hea``",
+"````auanbtcj`fdv`yaedrbububpcp`eagbqddblccbzau``",
+"``bd`ual`qc`abcndkbwdi`zcwcwbubwbp`cabe`bidtcz`j",
+"``bhchdtaz`qbl`ccrdhdh`mcydmatbway`cabdedidtdobh",
+"``cg`gdtboamco`ddjaebz`mcydmatawakapdddecmalcvcg",
+"``cgczdte`dedo`ec``bdiatcwcw`k`baq`ebl`vbkdtbscv",
+"``bxbe`u`qbodeabbraxdrbjadaedjbjbqabbmaoc``lczbx",
+"``dwclbicxbfdtecabaa`nbraxdb`cblabec`vbfdgctczdw",
+"``cvckbe`lbndzcjaoddcnajaocncnddcocjbf`qanad`wcv",
+"````cuchdnan`qbfcocebleccjecbmeb`v`kbh`paudfdq``",
+"````dx`xclbtdtbtaraod`ambr`xd`aravdc`geaa``wbv``",
+"``````cgdcbt`pbc`u`qccdtdge`cc`qcxbcctbyczcs````",
+"``````cqcsckcl`gdicidtardibbdt`lcbbacl`o`odl````",
+"````````dscseaauby`r`sctctctdndubyaubhbxds``````",
+"``````````afcscv`wbocaacacacaubobdb``iaf````````",
+"``````````````ahdw`rdqbxcudccfcvdwb`````````````",
+"``````````````````afdlbvdsdq`jaf````````````````",
+"````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue6[] = {
+/* width height ncolors chars_per_pixel */
+"30 30 158 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #191929",
+"`c c #323252",
+"`d c #303050",
+"`e c #111121",
+"`f c #2E2E4E",
+"`g c #1D1D30",
+"`h c #1B1B2E",
+"`i c #0C0C12",
+"`j c #0A0A10",
+"`k c #17172A",
+"`l c #212137",
+"`m c #767691",
+"`n c #1F1F35",
+"`o c #2F2F48",
+"`p c #101019",
+"`q c #181824",
+"`r c #25253E",
+"`s c #12121E",
+"`t c #10101C",
+"`u c #20202F",
+"`v c #0E0E1A",
+"`w c #2B2B47",
+"`x c #0C0C18",
+"`y c #292945",
+"`z c #161625",
+"a` c #141423",
+"aa c #242436",
+"ab c #121221",
+"ac c #2F2F4E",
+"ad c #2D2D4C",
+"ae c #1A1A2C",
+"af c #5C5C7A",
+"ag c #161628",
+"ah c #333355",
+"ai c #07070C",
+"aj c #313153",
+"ak c #05050A",
+"al c #0D0D15",
+"am c #07070F",
+"an c #24243C",
+"ao c #202038",
+"ap c #0D0D18",
+"aq c #1D1D2B",
+"ar c #0B0B16",
+"as c #282843",
+"at c #232334",
+"au c #11111F",
+"av c #0F0F1D",
+"aw c #2C2C4A",
+"ax c #3C3C5D",
+"ay c #1B1B2C",
+"az c #19192A",
+"b` c #151526",
+"ba c #131324",
+"bb c #303051",
+"bc c #111122",
+"bd c #1F1F33",
+"be c #19192D",
+"bf c #08080F",
+"bg c #161620",
+"bh c #23233A",
+"bi c #212138",
+"bj c #0E0E18",
+"bk c #0A0A14",
+"bl c #272741",
+"bm c #25253F",
+"bn c #12121F",
+"bo c #10101D",
+"bp c #202030",
+"bq c #0E0E1B",
+"br c #1E1E2E",
+"bs c #2B2B48",
+"bt c #0C0C19",
+"bu c #181828",
+"bv c #28283B",
+"bw c #262639",
+"bx c #2F2F4F",
+"by c #101020",
+"bz c #18182B",
+"c` c #353558",
+"ca c #09090F",
+"cb c #333356",
+"cc c #07070D",
+"cd c #15151E",
+"ce c #202036",
+"cf c #1C1C32",
+"cg c #090912",
+"ch c #191925",
+"ci c #26263F",
+"cj c #24243D",
+"ck c #22223B",
+"cl c #13131F",
+"cm c #11111D",
+"cn c #0F0F1B",
+"co c #0D0D19",
+"cp c #2A2A46",
+"cq c #262642",
+"cr c #171726",
+"cs c #151524",
+"ct c #131322",
+"cu c #111120",
+"cv c #2E2E4D",
+"cw c #0F0F1E",
+"cx c #343456",
+"cy c #08080D",
+"cz c #151527",
+"d` c #06060B",
+"da c #1F1F34",
+"db c #1B1B30",
+"dc c #0C0C14",
+"dd c #0A0A12",
+"de c #494967",
+"df c #23233B",
+"dg c white",
+"dh c #14141F",
+"di c #212139",
+"dj c #1E1E2C",
+"dk c #0C0C17",
+"dl c #292944",
+"dm c #0A0A15",
+"dn c #262637",
+"do c #141422",
+"dp c #2D2D4B",
+"dq c #0E0E1C",
+"dr c #1A1A2B",
+"ds c #373758",
+"dt c #181829",
+"du c #161627",
+"dv c #333354",
+"dw c #141425",
+"dx c #313152",
+"dy c #121223",
+"dz c #222236",
+"e` c #030307",
+"ea c #BCBCD7",
+"eb c #1E1E32",
+"ec c #1C1C30",
+"ed c #1A1A2E",
+"ee c #0B0B12",
+"ef c #18182C",
+"eg c #28283F",
+"eh c #090910",
+"ei c #222239",
+"ej c #202037",
+"ek c #11111B",
+"el c #1E1E35",
+"em c #0F0F19",
+"en c #0D0D17",
+"eo c #0B0B15",
+"ep c #1B1B28",
+"eq c #090913",
+"er c #262640",
+"es c #171724",
+"et c #151522",
+"eu c #212131",
+"ev c #2C2C49",
+/* pixels */
+"````````````````````````d`dhazazdoap`s``````````````````````",
+"``````````````````ccdraubgbiei`hcu`xar`gbkcm````````````````",
+"````````````````drbgeianbmdfbydfaqblbmageibkb```````````````",
+"````````````eoeqceboeiascpcwbsctaoeucpaser`nce`sdo``````````",
+"``````````bfarb`eicwcpbsdpadcvcvdfaddpbsa`dj`raeddal````````",
+"````````bn`tcochas`aawcvbx`kbxacczbybxcvcwerab`rchbjbn``````",
+"````````ek`besav`aawcv`ddxdbejdvcqdbdxeuaweudfbl`hcedr``````",
+"``````am`gdtau`yevcv`dbpdvbcbbdwcbahdvbzeudzb``ydweict`z````",
+"````alaearabascubmbyeladahasaocxbwbeahagbabxdp`wdfcjcebk`j``",
+"````etbkbobzdlevcfbcaaagcxasc`c`bvbvcx`kaj`dcvaqdlcieictet``",
+"````craretcudqeueuczczahaeel`cdededscxbz`cbb`fdi`kbobh`qcr``",
+"``eeazcdazepaqcw`fbx`ecz`hax`mea`mdec`ahefbb`fbcbz`hdfdaddee",
+"```pdudkctdjcpefeu`dazb`agdseadgeaafdsahaobccv`ueccwdochek`p",
+"``ekcddadfci`hcjadatdxelcf`o`meaeadebdedbb`keueveubqab`qazen",
+"``ekazeobher`kdwdtaccfdwahdrdedeafaxdyajatacdpcrdlbqbha`dkd`",
+"```p`parei`rasdqatcvbybbckegacebc`dvcfbbbxcvaw`abrcjei`gdtee",
+"``akcrdwbganblecb`dpctdnabdw`f`wdxdx`d`ncvdpbs`yblco`lek`pen",
+"``aketdkbgei`rczaqbsdpaa`f`fefedbxbx`fcveubs`yaq`rb`arbgccai",
+"````bndtdk`lcedqas`yeccwdpadcvbscvadeicfby`yascidfareoazbj``",
+"````em`zeoebctctciascwbaabevevcpevevbs`b`ydbeianbiazay`zem``",
+"````e`clapay`sepanescoasdl`yeubcdq`y`u`uctbmcuebda`vbuclai``",
+"``````bjcgcgecdmbi`xcmcierbl`udqbhbldjdjcjdfbiabeccgetbj````",
+"`````````tbjazbjdrcecndfancj`kbt`rcjandfeiceabcmazbfd```````",
+"````````bfbfcseq`v`gararbgboducleieibgceda`g`temdcekcy``````",
+"``````````ehdccccrdrcddteb`vdadadaebebemcddrcsbncceh````````",
+"````````````akemccbk`tazal`p`h`h`haydrazeebfddeecc``````````",
+"````````````````eh`i`sdocseododd`p`zcsdobf`je```````````````",
+"``````````````````e`bfenemddeobjcmekemenddak````````````````",
+"````````````````````````aie`e`bfcaaiai``````````````````````",
+"````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue7[] = {
+/* width height ncolors chars_per_pixel */
+"36 36 169 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #1B1B2B",
+"`c c #191929",
+"`d c #323252",
+"`e c #303050",
+"`f c #111121",
+"`g c #2E2E4E",
+"`h c #0F0F1F",
+"`i c #1D1D30",
+"`j c #1B1B2E",
+"`k c #0C0C12",
+"`l c #0A0A10",
+"`m c #17172A",
+"`n c #212137",
+"`o c #767691",
+"`p c #1F1F35",
+"`q c #2F2F48",
+"`r c #101019",
+"`s c #0E0E17",
+"`t c #272740",
+"`u c #181824",
+"`v c #25253E",
+"`w c #21213A",
+"`x c #12121E",
+"`y c #10101C",
+"`z c #20202F",
+"a` c #0E0E1A",
+"aa c #2B2B47",
+"ab c #0C0C18",
+"ac c #292945",
+"ad c #161625",
+"ae c #141423",
+"af c #242436",
+"ag c #121221",
+"ah c #2F2F4E",
+"ai c #2D2D4C",
+"aj c #1A1A2C",
+"ak c #5C5C7A",
+"al c #161628",
+"am c #333355",
+"an c #07070C",
+"ao c #313153",
+"ap c #05050A",
+"aq c #0D0D15",
+"ar c #07070F",
+"as c #24243C",
+"at c #202038",
+"au c #0D0D18",
+"av c #1D1D2B",
+"aw c #0B0B16",
+"ax c #282843",
+"ay c #262641",
+"az c #232334",
+"b` c #11111F",
+"ba c #0F0F1D",
+"bb c #2C2C4A",
+"bc c #3C3C5D",
+"bd c #2A2A48",
+"be c #1B1B2C",
+"bf c #19192A",
+"bg c #151526",
+"bh c #131324",
+"bi c #303051",
+"bj c #111122",
+"bk c #1F1F33",
+"bl c #19192D",
+"bm c #08080F",
+"bn c #161620",
+"bo c #23233A",
+"bp c #212138",
+"bq c #0E0E18",
+"br c #0A0A14",
+"bs c #272741",
+"bt c #25253F",
+"bu c #23233D",
+"bv c #12121F",
+"bw c #10101D",
+"bx c #202030",
+"by c #0E0E1B",
+"bz c #1E1E2E",
+"c` c #2B2B48",
+"ca c #292946",
+"cb c #181828",
+"cc c #28283B",
+"cd c #262639",
+"ce c #2F2F4F",
+"cf c #101020",
+"cg c #1C1C2F",
+"ch c #2A2A40",
+"ci c #18182B",
+"cj c #353558",
+"ck c #09090F",
+"cl c #333356",
+"cm c #07070D",
+"cn c #15151E",
+"co c #202036",
+"cp c #1C1C32",
+"cq c #090912",
+"cr c #191925",
+"cs c #26263F",
+"ct c #24243D",
+"cu c #22223B",
+"cv c #13131F",
+"cw c #11111D",
+"cx c #0F0F1B",
+"cy c #0D0D19",
+"cz c #2A2A46",
+"d` c #262642",
+"da c #171726",
+"db c #151524",
+"dc c #131322",
+"dd c #111120",
+"de c #2E2E4D",
+"df c #0F0F1E",
+"dg c #1D1D2F",
+"dh c #343456",
+"di c #08080D",
+"dj c #151527",
+"dk c #06060B",
+"dl c #1F1F34",
+"dm c #1B1B30",
+"dn c #0C0C14",
+"do c #0A0A12",
+"dp c #494967",
+"dq c #23233B",
+"dr c white",
+"ds c #212139",
+"dt c #1E1E2C",
+"du c #2B2B46",
+"dv c #0C0C17",
+"dw c #292944",
+"dx c #0A0A15",
+"dy c #262637",
+"dz c #141422",
+"e` c #2D2D4B",
+"ea c #0E0E1C",
+"eb c #1A1A2B",
+"ec c #373758",
+"ed c #181829",
+"ee c #161627",
+"ef c #333354",
+"eg c #141425",
+"eh c #313152",
+"ei c #121223",
+"ej c #222236",
+"ek c #030307",
+"el c #BCBCD7",
+"em c #1E1E32",
+"en c #1C1C30",
+"eo c #1A1A2E",
+"ep c #0B0B12",
+"eq c #18182C",
+"er c #28283F",
+"es c #090910",
+"et c #222239",
+"eu c #11111B",
+"ev c #1E1E35",
+"ew c #0F0F19",
+"ex c #0D0D17",
+"ey c #0B0B15",
+"ez c #1B1B28",
+"f` c #090913",
+"fa c #262640",
+"fb c #171724",
+"fc c #151522",
+"fd c #212131",
+"fe c #2E2E4B",
+"ff c #2C2C49",
+/* pixels */
+"````````````````````````````````cq`sdaaddn``````````````````````````````",
+"`````````````````````````xedcgfc`ucocyaba`aecgcqdz``````````````````````",
+"````````````````````dobe`jbnetasbabybyddboezdl`nembrar``````````````````",
+"``````````````````ebema`fcctbsezbybwdqegdbaxbsetdq`xemcb````````````````",
+"``````````````exaucx`nby`zaxczfddfffeq`m`aaaczaxbsby`n`pbedz````````````",
+"````````````bmfcemdqagagczc`bbe`dededebg`me`bbc`aebafcdqawa`aq``````````",
+"``````````cvbecodqbydc`affaideajcfdjblegdm`wdebebh`pdafaezbndvcv````````",
+"``````````bf`icwdtb``abbdeah`eeqbje``dbd`fc``e`vevbheqax`va`bkbf````````",
+"````````cqbrbpalejeaffdecebieh`d`geiamafdjcpehc`aybg`c`zbsezbpbraq``````",
+"``````doajda`pcyacbte`aheveeefafevaldhdhclamefd`bgahe`c`acdqdq`pdv`x````",
+"``````daeyawcyaxavayeicudyeiamdjdmevcjdydycgafbhevcedebbcfav`vbpdada````",
+"`````lbfajagciaxc``hdscfafdmcleqafcjcjcjcjdhcdalao`eahe`ataxcsetcgbfey``",
+"````dccxdcdgcyeeaxaieq`malccdheqaxchdpbc`qcjdhalafbiceaibldceadq`pbvdc``",
+"````cmf`emdq`pacczaicebubjcidhbsdudpakakdpecdherbjehceaiagddemascobnad``",
+"`````scx`n`mbkacdwbzcebidjeidhef`oeldrel`obcdhccbjdgceaiay`megby`nenbm``",
+"``aqda`i`neeavacc`bhdwbifdbdduemakdrdrdr`obcdhcicubseoaidqdjdden`nbf`saq",
+"``bqdaencoasfabscf`mac`eehbjdyajakelelelakbceibjcecfate`c`cs`fcycocgdado",
+"```l`rdvcodqfadqcfenercecpcfefegazdpdpakbc`mciehazejdebzaxaxbydqawcgcqdi",
+"``ap`ragbaet`v`zcfagaxdecfageheidhfeccecdhazdjbicedee`c`czax`metcrbq`rdn",
+"``ekdbdccyetctbsadbhbbaifaaxbibdehevee`deh`ec``v`gaibb`tdwdt`jetemaj`sep",
+"````bmdcbf`udqbtbtetc`bbaialce`pegbubibi`e`ece`faibbc`ac`zbteebe`idvcm``",
+"````eucqa``xetcteeaeczc`fdevdedybzeqcpceahdedeegffc`czaxfacrcycwcgdc`x``",
+"````apdb`sdbcoawdqezaxaccacubge`aibxaiaiaie``ccpalddaxbs`vbocycgajdnew``",
+"````bmdncbexemagen`vfa`zdfeacpbzffbbczbbffc`aadtacblblbvci`nbfcgcbepek``",
+"```````rdbbaaedl`ndq`vdcagaxacczczaveadfczcz`fbebsfabpbaagdlbebfdbdo````",
+"``````apbvcxbf`idx`nfbbfcyfabsaxb`bwbgbaaxax`jb`bfasbo`nen`idvcqbvdo````",
+"````````bqbmdzajbr`ucocya`ct`vcsdtegeeezfacs`vctdqetcodldvajdvbvan``````",
+"``````````ewcmdadaa`emeyagezbodqfbabcoasasdqboetbncobrbrajdaeycm````````",
+"``````````ckdkdzcvda`j`i`uagen`bcycr`uetbpcrcodxem`idcdnardn`yek````````",
+"````````````es`karfccbebcnal`i`yawdldldlbkemebdacnebbwbvcm`ses``````````",
+"``````````````ekbq`xbmbmdoadajed`rcgcgcg`jeuajbfcbdbdvdkcmdi````````````",
+"``````````````````ekbm`xdzdbdacqdaedcqedcbdadaaqbvdkeydk````````````````",
+"````````````````````ekdneweubvepdoardn`sdzcvbv`lewapek``````````````````",
+"````````````````````````dkekdn`sdodk`lewew`sdndoan``````````````````````",
+"````````````````````````````````ekekdkanek``````````````````````````````",
+"````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue8[] = {
+/* width height ncolors chars_per_pixel */
+"44 44 168 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #1B1B2B",
+"`c c #282845",
+"`d c #191929",
+"`e c #323252",
+"`f c #303050",
+"`g c #111121",
+"`h c #2E2E4E",
+"`i c #1D1D30",
+"`j c #1B1B2E",
+"`k c #0A0A10",
+"`l c #17172A",
+"`m c #212137",
+"`n c #767691",
+"`o c #1F1F35",
+"`p c #2F2F48",
+"`q c #101019",
+"`r c #0E0E17",
+"`s c #272740",
+"`t c #181824",
+"`u c #25253E",
+"`v c #21213A",
+"`w c #12121E",
+"`x c #10101C",
+"`y c #20202F",
+"`z c #2B2B47",
+"a` c #0C0C18",
+"aa c #292945",
+"ab c #161625",
+"ac c #141423",
+"ad c #242436",
+"ae c #121221",
+"af c #2F2F4E",
+"ag c #2D2D4C",
+"ah c #2B2B4A",
+"ai c #1A1A2C",
+"aj c #5C5C7A",
+"ak c #161628",
+"al c #333355",
+"am c #07070C",
+"an c #05050A",
+"ao c #0D0D15",
+"ap c #07070F",
+"aq c #24243C",
+"ar c #202038",
+"as c #0D0D18",
+"at c #1D1D2B",
+"au c #0B0B16",
+"av c #282843",
+"aw c #262641",
+"ax c #232334",
+"ay c #11111F",
+"az c #0F0F1D",
+"b` c #2C2C4A",
+"ba c #3C3C5D",
+"bb c #2A2A48",
+"bc c #1B1B2C",
+"bd c #19192A",
+"be c #151526",
+"bf c #131324",
+"bg c #303051",
+"bh c #111122",
+"bi c #19192D",
+"bj c #08080F",
+"bk c #161620",
+"bl c #23233A",
+"bm c #212138",
+"bn c #0E0E18",
+"bo c #0A0A14",
+"bp c #272741",
+"bq c #25253F",
+"br c #23233D",
+"bs c #12121F",
+"bt c #10101D",
+"bu c #202030",
+"bv c #0E0E1B",
+"bw c #1E1E2E",
+"bx c #2B2B48",
+"by c #0C0C19",
+"bz c #292946",
+"c` c #181828",
+"ca c #28283B",
+"cb c #262639",
+"cc c #2F2F4F",
+"cd c #101020",
+"ce c #2D2D4D",
+"cf c #1C1C2F",
+"cg c #2A2A40",
+"ch c #18182B",
+"ci c #353558",
+"cj c #09090F",
+"ck c #333356",
+"cl c #07070D",
+"cm c #15151E",
+"cn c #202036",
+"co c #1C1C32",
+"cp c #090912",
+"cq c #191925",
+"cr c #26263F",
+"cs c #24243D",
+"ct c #22223B",
+"cu c #13131F",
+"cv c #11111D",
+"cw c #0F0F1B",
+"cx c #0D0D19",
+"cy c #2A2A46",
+"cz c #262642",
+"d` c #171726",
+"da c #151524",
+"db c #131322",
+"dc c #111120",
+"dd c #2E2E4D",
+"de c #0F0F1E",
+"df c #1D1D2F",
+"dg c #343456",
+"dh c #08080D",
+"di c #151527",
+"dj c #06060B",
+"dk c #1F1F34",
+"dl c #1B1B30",
+"dm c #0C0C14",
+"dn c #0A0A12",
+"do c #494967",
+"dp c #23233B",
+"dq c white",
+"dr c #14141F",
+"ds c #212139",
+"dt c #1E1E2C",
+"du c #2B2B46",
+"dv c #0C0C17",
+"dw c #292944",
+"dx c #0A0A15",
+"dy c #262637",
+"dz c #141422",
+"e` c #2D2D4B",
+"ea c #0E0E1C",
+"eb c #1A1A2B",
+"ec c #373758",
+"ed c #181829",
+"ee c #161627",
+"ef c #333354",
+"eg c #141425",
+"eh c #313152",
+"ei c #121223",
+"ej c #222236",
+"ek c #BCBCD7",
+"el c #1E1E32",
+"em c #1C1C30",
+"en c #1A1A2E",
+"eo c #0B0B12",
+"ep c #18182C",
+"eq c #28283F",
+"er c #090910",
+"es c #222239",
+"et c #202037",
+"eu c #11111B",
+"ev c #1E1E35",
+"ew c #0F0F19",
+"ex c #0D0D17",
+"ey c #0B0B15",
+"ez c #1B1B28",
+"f` c #090913",
+"fa c #262640",
+"fb c #171724",
+"fc c #151522",
+"fd c #212131",
+"fe c #2C2C49",
+/* pixels */
+"````````````````````````````````````````````ao``````````````````````````````````````````",
+"````````````````````````````````dmbs`wcffb`i`i`i`ieyaicxfc``````````````````````````````",
+"````````````````````````````c`euegcwcnbmesa`a`aza`cxcffb`ibo`x``````````````````````````",
+"````````````````````````c`cfau`mezdp`uenakaeeadpcr`u`ucxa``mbtcvc```````````````````````",
+"````````````````````cvaiel`lezazd`bpavdbbvdbdseaeiayavbpbvcsesa`eleufc``````````````````",
+"``````````````````eebeasaubycobpavaa`adic`cyeade`dbw`aaaavbpdbcvesdkdvd`````````````````",
+"````````````````bjdvcxeschaqavaa`zbxb`e`agagddbwbfbdb`bx`zaaemdt`uesauf`d```````````````",
+"``````````````d`cf`xcfazcx`j`ybxb`agddag`lchej`g`cbxddag`gdieaeaaz`ubeakcmbj````````````",
+"````````````dabcdxee`udedw`afee`ddafccaf`ccecobg`lcdejafddaecddedtbp`uchdk`w`q``````````",
+"``````````bnebdrcqbccxea`afee`ddcc`fbfbibhep`eaaawczbu`feqeiawbxegavfachbmelebcl````````",
+"``````````c`bdcncvezateafee`ddccbgeh`ecbetcaaldfbqegawehdibxad`vae`yavcr`lcnbocv````````",
+"````````dzaibkcwcvezaacse`ddccendf`eefbhdddlfeckckalef`ebfardddd`ybxaacseaes`taudz``````",
+"`````````xbobv`o`uavdtdcde`g`gawbgalck`vepfddgdg`leldwaketei`fafagfecyeacrdpbkf``r``````",
+"``````cuebazbvcdaedw`ybhegbqbudibfalcaahducicicaciegcbakei`lbgccddb`bmavbpcsbmbn`wcu````",
+"``````bjf`dx`jchcsaabxbfbrbhbh`cbfckctdgciecececadcidgckdiejeh`ffde`bmaad``uescq`jao````",
+"`````kd`dx`ofbenazcddbagbwcdcdawcbdgbrdi`i`pdodobaeccidgb`axeh`fafagbibpevdbdpcna`d`ex``",
+"`````w`dbofbeeakavc`cdagafctet`leqdg`cblecajajajajbacidgdwbbeh`fafagawaaatetdpcneudv`w``",
+"`````rbdcf`baidtavegdbebafeqcbbhavdg`i`pajekekek`ndobadgad`lai`fafagdpegazcoaz`m`ibodb``",
+"````dnbdelelcdeaavcybuevaf`feh`vcodgesba`ndqdqdqekajbadgalbhctbdaxagee`gaebvcv`mel`qdz``",
+"`````xcmau`mdfbt`yfdbwegbc`fehejbxdgefdo`ndqdqdq`najbadg`lepev`adye``lctem`jaz`mcfeudn``",
+"````fcebel`mdpezatcsdbenbqbzbgbe`lalakcgdo`nekek`ndoadakepbhcdcocde`bxcybv`oez`mbddbbn``",
+"``djcpbdeycndpesazeaeaemfdaf`fepaeefbpbdecajdoajdobaefaxehbgdyafagbw`yaaatdsdpcwdbdmcwdj",
+"````cwcmbd`jes`ubpdpcoegcyddenepdfehbxaxcgcgcabaecdgarbdeh`fccdde`fecyavezbiescney`rdz``",
+"````bnedf`auesaqfaavchazb`agcddidybgcdcacb`aegalef`eaxenfeccddagb`bxaaav`tevesdkbvedcl``",
+"````bjd`daau`mdp`ubpatawcrb`age`ch`fcdbhbibeehehehbg`fcfavddagb`bxcyavbp`ua``melcp`qdj``",
+"`````xabbdbodfescsfaeaarfdbxb`cyakafak`leieiax`f`fccccaf`lbwb`bx`aaadtfa`j`icv`iasas`x``",
+"`````kdzbndvdv`mdpbsbiabaa`abxbxbpddddaxbccddsafaf`hdddd`ycoeg`aaaavfa`ubydbbecfcpbjbn``",
+"````djcud`cpdbcnfcayaqezavaa`aazaaaxe`agagcdb`ddagage`ee`oakeaaaavbp`uaqfbcnbtd`eyewdn``",
+"```````xda`qeyelcnbv`iatbpavdteacocsdeesb`bueiavb`b`febxcdfdelbvbeezezescnazeybd`q`x````",
+"``````dmcud`eydvdkbeeaaq`ufadecdac`y`a`zbx`seaaqbx`z`acyaaavbpatbvbvaz`m`tdvaid`cuan````",
+"````````clfccvbt`iaycwescvdebv`yavavdwaaaa`yde`l`yaadwemavabel`uaeakeldk`iaec`fc`x``````",
+"````````dm`wap`x`j`icx`mescxbvaqfabpbpavaecodbabavavbpbmaebvcsdpes`mdv`i`j`x`r`wdm``````",
+"``````````ewcv`xbdakdx`tcnbmbycwcs`ubqcrbicxeeayfacrbq`ucsdpblbmcndk`i`jdncvcvbn````````",
+"``````````er`xex`qbddvbtbk`ocxazesdpaq`ta`by`jcscsaqaqbcescq`m`obecxbcbdcpbsaner````````",
+"````````````eobjcveebscwey`ibkeleldceselauezcxcqesesez`mcncuel`idvaydveudz`xan``````````",
+"``````````````dm`xaocpabebbccffbasbd`oegazcncncncncn`odkd`drcfbcazdzeybs`xdm````````````",
+"````````````````dhbjdm`qd`edebbkd`emdrazelelelelelel`ibocfbofcedee`xdmaneo``````````````",
+"``````````````````anbndjerbnbseydnebf`ai`jcfcfcf`jbcaiebbdc``qdmbndv`rdh````````````````",
+"````````````````````dhdjdnaodbfcabd`cpc``dbd`rbd`dedc`d`aodzbjdjdmcldh``````````````````",
+"````````````````````````anaoewcvbsdbdzeoclap`q`rdafcdzdbcldmewcjer``````````````````````",
+"````````````````````````````djdj`reweoexcldjbn`wcveu`xew`rdmdh``````````````````````````",
+"````````````````````````````````amcjdndjeoanandmdmdmdnamam``````````````````````````````",
+"````````````````````````````````````````````am``````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *blue9[] = {
+/* width height ncolors chars_per_pixel */
+"50 50 170 2",
+/* colors */
+"`` c None",
+"`a c #2A2A47",
+"`b c #1B1B2B",
+"`c c #282845",
+"`d c #191929",
+"`e c #323252",
+"`f c #303050",
+"`g c #111121",
+"`h c #2E2E4E",
+"`i c #0F0F1F",
+"`j c #1D1D30",
+"`k c #1B1B2E",
+"`l c #0C0C12",
+"`m c #0A0A10",
+"`n c #17172A",
+"`o c #212137",
+"`p c #767691",
+"`q c #1F1F35",
+"`r c #2F2F48",
+"`s c #101019",
+"`t c #0E0E17",
+"`u c #272740",
+"`v c #181824",
+"`w c #25253E",
+"`x c #21213A",
+"`y c #12121E",
+"`z c #10101C",
+"a` c #20202F",
+"aa c #0E0E1A",
+"ab c #2B2B47",
+"ac c #0C0C18",
+"ad c #292945",
+"ae c #161625",
+"af c #141423",
+"ag c #242436",
+"ah c #313150",
+"ai c #121221",
+"aj c #2F2F4E",
+"ak c #2D2D4C",
+"al c #1A1A2C",
+"am c #5C5C7A",
+"an c #161628",
+"ao c #333355",
+"ap c #07070C",
+"aq c #313153",
+"ar c #05050A",
+"as c #0D0D15",
+"at c #24243C",
+"au c #202038",
+"av c #0D0D18",
+"aw c #1D1D2B",
+"ax c #0B0B16",
+"ay c #282843",
+"az c #262641",
+"b` c #232334",
+"ba c #11111F",
+"bb c #0F0F1D",
+"bc c #2C2C4A",
+"bd c #3C3C5D",
+"be c #1B1B2C",
+"bf c #19192A",
+"bg c #151526",
+"bh c #131324",
+"bi c #303051",
+"bj c #111122",
+"bk c #1F1F33",
+"bl c #19192D",
+"bm c #08080F",
+"bn c #161620",
+"bo c #23233A",
+"bp c #212138",
+"bq c #0E0E18",
+"br c #0A0A14",
+"bs c #272741",
+"bt c #25253F",
+"bu c #23233D",
+"bv c #12121F",
+"bw c #10101D",
+"bx c #202030",
+"by c #0E0E1B",
+"bz c #1E1E2E",
+"c` c #2B2B48",
+"ca c #0C0C19",
+"cb c #292946",
+"cc c #181828",
+"cd c #28283B",
+"ce c #262639",
+"cf c #2F2F4F",
+"cg c #101020",
+"ch c #1C1C2F",
+"ci c #2A2A40",
+"cj c #18182B",
+"ck c #353558",
+"cl c #09090F",
+"cm c #333356",
+"cn c #07070D",
+"co c #15151E",
+"cp c #202036",
+"cq c #1C1C32",
+"cr c #090912",
+"cs c #191925",
+"ct c #26263F",
+"cu c #24243D",
+"cv c #22223B",
+"cw c #13131F",
+"cx c #11111D",
+"cy c #0F0F1B",
+"cz c #0D0D19",
+"d` c #2A2A46",
+"da c #262642",
+"db c #171726",
+"dc c #151524",
+"dd c #131322",
+"de c #111120",
+"df c #2E2E4D",
+"dg c #0F0F1E",
+"dh c #1D1D2F",
+"di c #343456",
+"dj c #08080D",
+"dk c #151527",
+"dl c #06060B",
+"dm c #1F1F34",
+"dn c #1B1B30",
+"do c #0C0C14",
+"dp c #0A0A12",
+"dq c #494967",
+"dr c #23233B",
+"ds c white",
+"dt c #14141F",
+"du c #1E1E2C",
+"dv c #2B2B46",
+"dw c #0C0C17",
+"dx c #292944",
+"dy c #0A0A15",
+"dz c #262637",
+"e` c #141422",
+"ea c #2D2D4B",
+"eb c #0E0E1C",
+"ec c #1A1A2B",
+"ed c #373758",
+"ee c #181829",
+"ef c #161627",
+"eg c #333354",
+"eh c #141425",
+"ei c #313152",
+"ej c #121223",
+"ek c #222236",
+"el c #030307",
+"em c #BCBCD7",
+"en c #1E1E32",
+"eo c #1C1C30",
+"ep c #1A1A2E",
+"eq c #0B0B12",
+"er c #18182C",
+"es c #28283F",
+"et c #090910",
+"eu c #222239",
+"ev c #202037",
+"ew c #11111B",
+"ex c #1E1E35",
+"ey c #0F0F19",
+"ez c #0D0D17",
+"f` c #0B0B15",
+"fa c #1B1B28",
+"fb c #090913",
+"fc c #262640",
+"fd c #171724",
+"fe c #151522",
+"ff c #212131",
+"fg c #2C2C49",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````cnddbvalfeewchch`kbbbfcre`````````````````````````````````````",
+"````````````````````````````````e`eeaibvendmcp`o`oaxczeoaxbyax`jcydwe```````````````````````````````",
+"````````````````````````````e`ewchf`bnaaeudrataicacabyatatfebvaacpen`yewdp``````````````````````````",
+"````````````````````````aseechbncpeucs`wbtatefbbcqdrcpfabsfcbtehbaeucpbrchbqew``````````````````````",
+"``````````````````````f`al`jdydeacbabwbsaydccucgffa`eheu`wdxaybsfc`watch`y`janfe````````````````````",
+"````````````````````cybrbr`oblcz`nbsdxad`aecdkccfgerfgdebzc``aaddxbsdkawfa`odwaaef``````````````````",
+"``````````````````bm`k`kbadrddcpayad`ac`bceaeaakdfdfdf`ieheabcc``aadbtbw`wdrdwbybgdb````````````````",
+"````````````````ef`kefbgatbyczdrddc`bceadfdzdkanekc`ffexblb`dfeadgdkcgcgbacsateoen`kf```````````````",
+"``````````````dcbecjczdrebehad`afgeaakdfcfbudn`cazajepercgeacfdfbxehbbfcawductdrcsenbecr````````````",
+"````````````bmbfbfaibb`wefdx`afgeadfajcf`fcgcgbjbxaqbhbtcuan`fcfdxdnbtaibldxbsbkcpcp`jbfet``````````",
+"``````````dpccdd`qeu`vbzbbefc`abdfaj`fbiei`ebcejenegdhepeh`g`nbibhbtdkddbsehcgbsfaeu`qchbmdl````````",
+"``````````eqcobncpendgaybba`bcdfaj`fb`ei`eb`ehbhau`ndzaoaoch`eeiayerb`a`b`bzd`ayeb`qbpezecfe````````",
+"````````ewcrfbchdddefadxaibcakffbeaddkdzegejdk`xehdididicmaoeg`eaydacf`hakbc`adxdgczeucyf`cceq``````",
+"````````fealdwacdeefay`d`adk`gcgercqeh`naodkehexdidididkbjanaobjbjex`fcfdfeac`aidrctat`oaxbrfe``````",
+"``````eydcbralacehebdx`absercvbcdzdhaycdcmer`jckckckagckeocdb`ayehdkei`f`hakfg`qdhbscueudmfbdbas````",
+"``````cwbfbraxen`n`nadc`bc`gd`bjbgcfaycmdiejehckedededcdfgdidiblblffei`feadfboejaddu`wbocpbfbfcw````",
+"``````cwbfbrbqboddcgbtayeaefdfbj`n`ncdcmbldkep`r`rdqdqbdceckdicmejdzeibicfdf`bdgebefdbdr`o`jdtfe````",
+"`````tcxavdbdwblcpbzaeepaidfdzbudkejagcmbhdkdm`rdqamamambdeddicm`jeieibicfdfcgaiebfadgatbpencraeeq``",
+"````ewdbaxcofedebwayawffejdfcfcfepbjdncm`kah`r`p`pem`p`pambdckcmdz`nb`bicfdfef`bcjbzatcseudmeycrew``",
+"`````yccbvdmeuehbaaybz`u`nescfbiei`n`ndidvbxdq`pdsdsememamdqeddidxbj`fbxcfdfecazbhbyczaceudmchcr`y``",
+"````aseechdycsczbwcpd`c`bhcucf`feidkcucmdicedq`pdsdsdsem`pdqedcmandkcgcgcbdfeaazehbtczbbchavaiewbm``",
+"````cneechdmeudhbwawddbzbtcjdn`feiaqbjao`wenam`pdsdsdsemamdqck`nbt`adnbjaidfbcddbscjbgdecscwbw`ydp``",
+"````doeechdmbpatbodueobjep`gayddbi`nbjegdaatdqdq`p`pem`pdq`rbucqexcgdkcvddakbcabadbyanatdmbqafcrcn``",
+"````cnccbff``odreke``n`g`n`nekaj`fcqbj`eaocqffbddqdqamdqbdb`ej`eeibiagajdfeabzatdxbyeodr`oafbvcrcr``",
+"````cn`scrdw`obo`wbsebeb`nbgakdfcqbj`nei`edkceekajcibdbdckagbjb`ei`fcfdfakbcc`d`aybsbgbo`oaxf`dbbm``",
+"`````ydbcrbrdmeucufcay`kexayeadf`xcgbhbiadaycdcjfgcjdiaoeg`eaybh`fcf`hdfeafg`aaddudd`jeucpeffedbdl``",
+"````ewaecrddaxbpdr`wbsbzepddfgeadfcbev`fcf`xag`abcbf`eeieieibicgbo`hdfeafgc`a`aybs`weubpdmavecaveq``",
+"````eyfeczf`dycsbocufcbw`gbbc`bceaefdkajb`anbj`gehbibiag`f`fcfajbhdfeabcc`d`ctayfcanaccpenbacocney``",
+"````ase`avdwddcpeuat`wcz`kba`ac`bcd`cqdf`hbcc`cgc`ep`fcfcfaj`hdfbsejbcc``aadayfa`webdmal`jbnbm`yas``",
+"````dp`yae`zdydw`ochddcjfaayad`ac`cjbleaakdfdf`hbjepaj`hdfdfakea`dbbbs`aadaybsctcudeeeefbrecbm`ydp``",
+"```````zfe`ycrbgcpfd`qbpaibsayadd`bbcueubxeaakakcgbcakakakeabcdecqepdkawaybsct`wdrbpchcjeweeet`z````",
+"``````ascwdbdpdpencpbl`ncjfcbsaybgeberbsd`bzbcbcb`ehb`bcbcfgc`bgaiawdxbycueb`vcxeucpczcxecdbcneq````",
+"``````elewfeaaf`aadmcjaidr`wctbscgcgebafek`ac`c`ctbbffc`c``a`aawadayayfaddca`ndw`o`ybbbeccfeewdj````",
+"`````````tcwaeddax`j`yaleudre`fdebaiayaydxadd`d`dubjcqffd`ada`aybka`fcbtbwcpbbacdmdtcrbfaecwdp``````",
+"````````cnbmetcraach`jdy`oeuacbbczccfcbsbsaya`deayblazaeayaydbcqddexcwat`jeu`ybk`jbfcrdoe``zet``````",
+"``````````as`yfef`bfcobfcocpbpaibgcs`wbtfcfcbsbwbyczbabsbsfcfcbt`wcudreubpcpbqdcchezaebmcxar````````",
+"``````````elbq`t`zeyecaxbbbkcp`oaxbodratcu`w`weubhbwalbt`w`wcuatdrboeu`ocpbkdwbwecdwbmdoarap````````",
+"`````````````meyeze`ccbrcrbren`dbwbfbvcsbodrbaaieu`katatdrdrboeueucscpdmbrbff`ecccdobm`ldl``````````",
+"``````````````eqeqbmdc`screy`d`jenacac`qbnfdczbg`vcweueueubpbncpacbnen`jeecr`ycrdocw`sel````````````",
+"````````````````eqeybm`ze`coecbech`jbwandmbnaxbkcpcpcpcpcp`qdmen`kchchbeec`zf`dodleyeq``````````````",
+"``````````````````dlas`y`zaedb`decbnbfbe`jbrbfenenenenenen`j`jdpchf``y`ddpdobvbm`meq````````````````",
+"````````````````````elbqarcwdpcxcrdbccalbebefbchch`dchchch`kfbalbfeedbbqcrcneyarap``````````````````",
+"``````````````````````djdocncncne`aedbdbccdwbfbfecececbfbfbfeedbdbcxezcncnclarbm````````````````````",
+"````````````````````````eldlas`lcxcwe`fedcaedpe`bmdpdbeqefaedcfee`dpbq`mcnelap``````````````````````",
+"````````````````````````````elelasey`zcx`ycnbmbm`zcre`e`cwcw`ycx`zeyasdjap``````````````````````````",
+"````````````````````````````````dlararas`tcndparareq`z`zey`m`taseqclap``````````````````````````````",
+"``````````````````````````````````````apdlelaparelareqeqdpetelap````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+#include "colors.inc"
+#include "shapes.inc"
+#include "textures.inc"
+
+/* The following make the field of view as wide as it is high
+ * Thus, you should have the -W and -H command line options
+ * equal to each other. */
+camera {
+ location <5.8, 0, 0>
+ up <0, 1, 0>
+ right <1, 0, 0>
+ look_at <0, 0, 0>
+}
+
+sphere {
+ <0,0,0>, 2.5
+ texture { Glass
+ scale <0.7, 0.7, 0.7>
+ rotate y*clock
+ normal {bumps 0.4 scale 0.1}
+ finish { Shiny }
+# finish { phong 0.4 }
+ }
+}
+
+light_source {<6, 7, 0> color White}
+light_source {<6.1, 1, 0> color Blue}
--- /dev/null
+/* XPM */
+static char *glass1[] = {
+/* width height ncolors chars_per_pixel */
+"10 10 61 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #29293F",
+"`c c #2C2C63",
+"`d c #353579",
+"`e c #242447",
+"`f c #222245",
+"`g c #25253E",
+"`h c #1C1C3F",
+"`i c #2B2B47",
+"`j c #252544",
+"`k c #222251",
+"`l c #323264",
+"`m c #212146",
+"`n c #37374B",
+"`o c #22223D",
+"`p c #252536",
+"`q c #232337",
+"`r c #34346C",
+"`s c #303068",
+"`t c #26264A",
+"`u c #5D5D97",
+"`v c #363674",
+"`w c #2C2C6A",
+"`x c #2E2E5B",
+"`y c #242451",
+"`z c #343464",
+"a` c #3C3C6F",
+"aa c #353572",
+"ab c #38386B",
+"ac c #242454",
+"ad c #181831",
+"ae c #28285B",
+"af c #37377A",
+"ag c #20203F",
+"ah c #26265C",
+"ai c #4C4C60",
+"aj c #383874",
+"ak c #333379",
+"al c #444458",
+"am c #272756",
+"an c #32326E",
+"ao c #30306C",
+"ap c #40407F",
+"aq c #292944",
+"ar c #212150",
+"as c #323271",
+"at c #2D2D76",
+"au c #21213F",
+"av c #25255A",
+"aw c #35356D",
+"ax c #313169",
+"ay c #2C2C6E",
+"az c #18182C",
+"b` c #232344",
+"ba c #292961",
+"bb c #202037",
+"bc c #1C1C33",
+"bd c #242452",
+"be c #45456F",
+"bf c #242455",
+/* pixels */
+"``````aibebebeal````",
+"`````n`zaw`ua``l`n``",
+"```i`xab`wasaj`r`x`q",
+"``auaean`daf`vao`c`t",
+"```haxahayatakbaaeb`",
+"``adbfav`wapao`sam`m",
+"``azagaracaaae`k`fbc",
+"````bb`ybd`aar`e`o``",
+"```````paq`j`b`g````",
+"````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass10[] = {
+/* width height ncolors chars_per_pixel */
+"60 60 189 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #272751",
+"`j c #23234D",
+"`k c #29293F",
+"`l c #2C2C63",
+"`m c #2A2A61",
+"`n c #33334C",
+"`o c #353579",
+"`p c #272754",
+"`q c #414188",
+"`r c #20202C",
+"`s c #2E2E3D",
+"`t c #1C1C28",
+"`u c #2E2E68",
+"`v c #242447",
+"`w c #2C2C66",
+"`x c #222245",
+"`y c #181824",
+"`z c #25253E",
+"a` c #161622",
+"aa c #B9B9ED",
+"ab c #3E3E67",
+"ac c #1C1C3F",
+"ad c #6767A3",
+"ae c #2B2B47",
+"af c #272743",
+"ag c #222248",
+"ah c #292931",
+"ai c #29295C",
+"aj c #1D1D39",
+"ak c #252544",
+"al c #1E1E47",
+"am c #2B2B61",
+"an c #29295F",
+"ao c #1F1F3E",
+"ap c #2F2F68",
+"aq c #2D2D66",
+"ar c #30305F",
+"as c #2C2C5B",
+"at c #11111C",
+"au c #262655",
+"av c #31316D",
+"aw c #4C4C6D",
+"ax c #222251",
+"ay c #323264",
+"az c #2D2D69",
+"b` c #33335B",
+"ba c #43436E",
+"bb c #2B2B67",
+"bc c #212146",
+"bd c #37374B",
+"be c #22223D",
+"bf c #252536",
+"bg c #1D1D42",
+"bh c #2A2A5C",
+"bi c #28285A",
+"bj c #2B2B53",
+"bk c #333372",
+"bl c #2F2F6E",
+"bm c #2B2B3F",
+"bn c #2C2C36",
+"bo c #424266",
+"bp c #232337",
+"bq c #2F2FB0",
+"br c #34346C",
+"bs c #525265",
+"bt c #32326A",
+"bu c #1B1B2F",
+"bv c #3B3B55",
+"bw c #303068",
+"bx c #21214C",
+"by c #2C2C64",
+"bz c #292957",
+"c` c #232351",
+"ca c #26264A",
+"cb c #2F2F60",
+"cc c #202044",
+"cd c #5D5D97",
+"ce c #2B2B5C",
+"cf c #363674",
+"cg c #3C3C66",
+"ch c #252556",
+"ci c #30306E",
+"cj c #3E3E54",
+"ck c #414178",
+"cl c #2C2C6A",
+"cm c #2F2F4F",
+"cn c #25252E",
+"co c #27275B",
+"cp c #363663",
+"cq c #4C4C68",
+"cr c #20204A",
+"cs c #2E2E5B",
+"ct c #29294C",
+"cu c #242451",
+"cv c #27274A",
+"cw c #343464",
+"cx c #4F4F64",
+"cy c #252548",
+"cz c #16162C",
+"d` c #292938",
+"da c #333384",
+"db c #3C3C6F",
+"dc c #353572",
+"dd c #1E1E37",
+"de c #38386B",
+"df c #414156",
+"dg c #242454",
+"dh c #31316E",
+"di c #181831",
+"dj c #232349",
+"dk c #272739",
+"dl c #393979",
+"dm c #4C4C85",
+"dn c #2F2F83",
+"do c #28285B",
+"dp c #292952",
+"dq c #36366C",
+"dr c #48486D",
+"ds c #23234C",
+"dt c #37377A",
+"du c #20203F",
+"dv c #1E1E3D",
+"dw c #26265C",
+"dx c #313174",
+"dy c #4C4C60",
+"dz c #27273F",
+"e` c #3C3C78",
+"ea c #48485C",
+"eb c white",
+"ec c #383874",
+"ed c #333379",
+"ee c #444458",
+"ef c #272756",
+"eg c #47477C",
+"eh c #32326E",
+"ei c #1B1B33",
+"ej c #1E1E2C",
+"ek c #30306C",
+"el c #40407F",
+"em c #292944",
+"en c #212150",
+"eo c #23233E",
+"ep c #141422",
+"eq c #343473",
+"er c #323271",
+"es c #2D2D76",
+"et c #2E2E6D",
+"eu c #40406E",
+"ev c #21213F",
+"ew c #272731",
+"ex c #8080BA",
+"ey c #23232D",
+"ez c #25255A",
+"f` c #1B1B39",
+"fa c #35356D",
+"fb c #191937",
+"fc c #262651",
+"fd c #313169",
+"fe c #2C2C6E",
+"ff c #22224D",
+"fg c #18182C",
+"fh c #373786",
+"fi c #2D2D65",
+"fj c #232344",
+"fk c #2B2B63",
+"fl c #292961",
+"fm c #27275F",
+"fn c #202037",
+"fo c #1C1C33",
+"fp c #242452",
+"fq c #45456F",
+"fr c #484868",
+"fs c #535380",
+"ft c #1F1F43",
+"fu c #2C2C5D",
+"fv c #3535DD",
+"fw c #353573",
+"fx c #262657",
+"fy c #393963",
+"fz c #242455",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````bsbsbsbsbsbsbsbsbsbsbscxbs``````````````````````````````````````````````",
+"``````````````````````````````````````````dycxdydycxawawawbsbsbsawcxcxcqdycxcxbs````````````````````````````````````````",
+"````````````````````````````````````dyeacxfrawcqawfrawcqcxawcqawawawawawawfrfrcxcqeabs``````````````````````````````````",
+"````````````````````````````````dfeadydyawcqawawfrcqawawdrawcqawawfqawcqcqfrawawfrdyeaeadf``````````````````````````````",
+"``````````````````````````````eadyeadyfreedrboawfqfqfqdrfqeufqawbaawbabofqeufqdrcqfreeboeadf````````````````````````````",
+"``````````````````````````dydffrbocjfrfrdrfrfrfqfqbabofrfqfsbaeubafqfqcgeubafqdrbaabbobobocjeedf````````````````````````",
+"````````````````````````dfeeeadffyboeecgeufrfreufqeueueucgbaeubadrdbbacdbaeucgbabocpboboabboeaeebd``````````````````````",
+"``````````````````````bdbdcjbd`cfyeefybaabcgfyeubaabdmfseudbdefsaackdbeudebaeudedebocgbofyfycjcjeecj````````````````````",
+"````````````````````cjdfabbvb`cg`cfyfyfycgabcgdeckbrfscddecdcddmdmfsabdeeucwcpdbdbcgcgcp`cbvbvcjbvbdcj``````````````````",
+"``````````````````bdbddfbv`ccgfyb`cgcgcpfycwdedbdbcdadcdexexckcd`u`uegdedbdbaycpaydecpcpb`bvfybvbdcj`s`s````````````````",
+"````````````````dfbdcjbvbd`c`c`cb`cpcwcgdededqayfabrcdexdbcdcdcddeexebbrdbecdedqcwfdaycpcgarb`b`bd`cbd`sbd``````````````",
+"```````````````sbdbd`n`ncmcscsarcscwcpdbbtbwbwbtbrfaebexegexaddbdeeceldqbrbrdqbtbkaybt`fbjcscpb`b``ncmctbdbd````````````",
+"``````````````aebd`c`ncmcsb`cwayascsdebraybwbrfdbtazdmdeexaddladexckdedmdme`btay`lcbcscwarasfucpb`cmcmae`nbd````````````",
+"`````````````saeeo`nbjcmcsarar`paycsbtcb`fbrbtfkfdciecdmdqebcdaacddmece`elbrazfabr`f`wbwbtarbzcsascsarbjbm`kbn``````````",
+"``````````ewd`ae`z`c`zbjcsb`cscscwcwbrbravbtecbrfackaadmckexavciexdme`bkfabtapanbr`ffabtfdbtdpcscsbjbjdpbeae`s`s````````",
+"``````````ahcm`kcm`bdparaycsay`fcscsfdbrfibwbtbrfdeqcd`qdmelbkeldmexdmeqdce`faerdcapbtbwfa`waucscscvdpdpafcmae`n````````",
+"````````cncmaeakcmct`adpcsarcbcbbwdqdeapamdcehcfclbldlbldmeqeradexade`esecelehehdc`ubrbrbtfucsbhcsas`actbecmbpbpey``````",
+"````````ejbpeo`vctcv`abzb`ef`ffxfucbbwapbldcdheqetesdlfwdmescfcddmdmdmbkbleldldhaq`ubrfabtcbcsbtcs`pcccycm`veobe`t``````",
+"`````````rae`aajevdjdsasas`jbifiapbrbtav`uapclcfdlad`odndnfvdxededexegeceqe`e`cfbybydcbrfmcwcbfdcbbjdjca`bcv`zdd`t``````",
+"``````ej`rbu`vcvcv`vcyfcbzefbz`f`uclapfderfeerclerdldlerdada`hedfhe`aacferdtcfciazapfk`ubramcbfuararbzfc`zaeaofo`t`r````",
+"``````bpfodibedsdp`jcs`abwbh`lfadccidcecerclet`gfe`hdxdx`hededdt`hdaelcfereterer`wbk`ubtfdbtef`fefcb`paudpbcdiczdi`y````",
+"``````ejddddemfcbjefcscs`faycedcececapciazcieqbldterdxdnbqelcdfhfv`h`oe`ererdnetfkfdekfabwbtfubifxfcar`affdpf``yepfo````",
+"`````tej`ycyevcuctftbzefdoaiapaqbrbrehfw`udcfwda`oerekfhfhdxdtdaes`hbqfwcferbkehflfkekcffabwfuco`lbzcsbzftbccaevfneja```",
+"````atddddem`xaocscsar`pdwdwfibwapbyapeccfdlcf`hdnfmbl`hfhdtdt`hclfvbq`qfhdxbkcfcl`gfkehfa`ufufpamaycsaydjcc`v`vfoepat``",
+"````ejfgbucy`vccceaseffdfldgai`ubbfzfdazazcfblereqdt`hdnbq`hedbqfedndndte`dtdtdletfmdhehfkapapbt`mdgfubzacdp`xf`dicz`y``",
+"````budddi`x`vevdpcsbzcwfxai`mapfdflfaavblercibkcffhcl`gfvfvfvdadaedclcfcfdteqecdcfkercfav`lbt`famchfdcsbe`bcaczfjbefg``",
+"````a`buepccevcrdpbzbzcbfxbifdfififacfekazereretblfe`hfhbqesesdnfh`h`hbq`hfwecdldcerclavecaqaqfifxbhbzbzcv`xfjfodufnat``",
+"````atepbufodualfcdp`lauauchfi`lapek`gcicieretfecl`gfhed`hesfm`gfefvfvfvdxbl`oederetfm`wdlfkfxaybzau`d`j`xduf`fgdufga```",
+"`````yepddfjacccbz`benamfd`f`mfdbr`mdwcidtcfclfmfebldadneddnesdadadx`hdaededdaclflfmflfmehbyaiaydofuarasftccfjdidiei`t``",
+"````a``yczczfbbcbc`bacficucraqfdanfkflaz`oehbbesbldndxfefefeesfvbqbqdnbbdtedciciazaqfkazaz`ubw`laicbas`pdjcccc`advddat``",
+"````fo`yddccf`fcalcefucbcufpbi`fbyav`wazbt`ucldxed`hblescldn`hbqdndncl`gazedazazazfw`wekfzanameffucbbzbxbz`jf`fbevbuep``",
+"````at`yfbaccy`a`bdsceaiffbzbichfi`manekaq`uclbkcffheletfvesfh`hesdx`qclci`gfkapap`wekapezanfzaifubxeffcfc`bdubufgepat``",
+"````a`czdvf`bcdv`bffbzbicrax`fbiezcofifiekbkfk`geredeserbqdndndtadfhazcfblfecl`u`laiflaq`f`lez`ucbdgff`j`bdpccdddiepep``",
+"````atczdidvaocy`v`edsbcaxdwbxfzefchameqecdlbl`gazdh`qfhaaadelesfhdaflblbkblerazapfidwbhchaqdobibzalfp`pccbgdveiczepat``",
+"````a`epfoczdi`dccac`jaufzcraxaubxdwez`wfkehekbbclbkelaa`obqeleddldafkdmekfm`wfk`wfibwfidobhaiaxef`j`pdsbcacbcaodiddat``",
+"``````eifgczevccfbau`jefdgffbhamaxfxezfd`w`l`odl`udcbk`wdneldtegadaaazetdlfmanan`waqfkehfifpbic``p`dbzagftao`vdifbfg````",
+"``````a``yfgdv`b`v`ifcbz`b`ibwbtamfxfxfmfxekdhcfby`lciehec`wdlaverapcdecelaz`lby`lfidofiap`mcefxfp`idsagbcagajeicza`````",
+"``````ata`czfbdv`vdjceasac`ibiamfian`maifxanazehave`apekehap`uege`ecazcfbkekdwfkfifiauchefbiencuftbcdvfbfof`fbdi`y`y````",
+"`````````yczbudvdvdvfbcubgfcaucrbicraxfzchco`wekfke`aqflav`uaa`udm`u`w`uamfzchfmanameffpdgaidgfpaldvaoevf``zfbfgbu``````",
+"````````a``tejeif`ajddajdsccbz`pbi`jfpdoanfzanbtai`f`ufkfkdq`lanebexaidcfme`fafiancodgenenbiai`pcracccf`bpddbufg`t``````",
+"`````````t`yfgfgbpacaoakdubgbiauffdsenanfidoamaidgcdcoezbtecdc`mdmanbifidoanan`uapfzaxfpfpbhcecr`xbcbgbxddbufoej`t``````",
+"```````````t`yfoddaodidv`i`xaleffpc`chfxamchezaichezfmfzanbwanfpcb`famfkanfxfzezcoanbifxc`ffefacbgccacf`ddddej`t````````",
+"```````````tcnfobpdvbgdvbgbxftefbibxaiaudofzaxfichanfxfpfxezananfxchdgefezfzfxcuc`crdsfpcubz`jft`eeofcfbfoejfg`r````````",
+"````````````eyfgbudiaoajbgdvbecrfpfpff`bffefbwaichchdgdgbhdgbjbidoaicofxfpaicubxds`afpdgas`e`vduag`z`zajdibuey``````````",
+"```````````````t`rbuddeodvft`zalbccr`ec``bc`auenfp`jezchfxaidpc`fxdgfpfiamfcdgfxcvcrfcfpalcr`zbeajf`dvajbfey````````````",
+"```````````````rbfbpfofbbgdvaffjfjcc`jfxbxfcc``b`bdsbiau`jc`biaibifxfpfcch`afpc``d`d`vdvfjfj`zdvajfbdvbp`tcn````````````",
+"````````````````cnfnfnbpfnaoftftdj`ecuftfpaubidgfp`j`bfcfpfc`afpdgc``jfpencuc``b`j`e`vcrevdkdzewbefnfobfej``````````````",
+"``````````````````bffnfnajfodvddccftaf`e`b`jdgcuai`jcv`jc`fcdj`jbxcvcvdsdsbxbxdjcr`xbxdjft`z`zddbefnbf`r````````````````",
+"````````````````````d`eyewbeduak`zfjemcads`dfp`jdj`b`bcu`jcudgfpefds`bcacacvctct`dagak`xaoddbeeybpfn`r``````````````````",
+"``````````````````````eyfnbpdkdz`z`zbmakfj`bag`v`dctctctctem`d`ecvctaeaeafcu`v`ecc`zakafbp`kbpewbfew````````````````````",
+"````````````````````````eyeybfbpdk`zemcvcyafemakcvcvaeaeffdjcvcv`j`vae`vemaf`vagcc`z`z`zeodkbfd`ey``````````````````````",
+"``````````````````````````cnbnfobe`kbe`kevemdzfj`k`z`b`edjctaeaeemds`eaf`vevdzdjafemd`dk`zbfd`ey````````````````````````",
+"``````````````````````````````bncneybf`kbeaf`kememem`kcvafemakaeaeakemem`kdk`z`kbebm`zd`d`ah````````````````````````````",
+"````````````````````````````````ahcnewd`dk`z`zaeaf`kaf`k`vemaedzcvakak`z`kdzd`dkdkbmbfbnah``````````````````````````````",
+"````````````````````````````````````cncnbf`z`sd``s`k`z`s`zbm`s`kd`d``s`s`k`kd`ahd`bncn``````````````````````````````````",
+"``````````````````````````````````````````bnd``s`s`kbnd`d`bfd``kbnbnd`bnd`ewahbn````````````````````````````````````````",
+"````````````````````````````````````````````````ahbnahbnd`ewdkbfewahahewbn``````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass11[] = {
+/* width height ncolors chars_per_pixel */
+"72 72 189 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #272751",
+"`j c #23234D",
+"`k c #29293F",
+"`l c #2C2C63",
+"`m c #2A2A61",
+"`n c #33334C",
+"`o c #353579",
+"`p c #272754",
+"`q c #414188",
+"`r c #20202C",
+"`s c #2E2E3D",
+"`t c #1C1C28",
+"`u c #2E2E68",
+"`v c #242447",
+"`w c #2C2C66",
+"`x c #222245",
+"`y c #181824",
+"`z c #25253E",
+"a` c #161622",
+"aa c #B9B9ED",
+"ab c #3E3E67",
+"ac c #1C1C3F",
+"ad c #6767A3",
+"ae c #2B2B47",
+"af c #272743",
+"ag c #222248",
+"ah c #292931",
+"ai c #29295C",
+"aj c #1D1D39",
+"ak c #252544",
+"al c #1E1E47",
+"am c #2B2B61",
+"an c #29295F",
+"ao c #1F1F3E",
+"ap c #2F2F68",
+"aq c #2D2D66",
+"ar c #30305F",
+"as c #2C2C5B",
+"at c #11111C",
+"au c #262655",
+"av c #31316D",
+"aw c #4C4C6D",
+"ax c #222251",
+"ay c #323264",
+"az c #2D2D69",
+"b` c #33335B",
+"ba c #43436E",
+"bb c #2B2B67",
+"bc c #212146",
+"bd c #37374B",
+"be c #22223D",
+"bf c #252536",
+"bg c #1D1D42",
+"bh c #2A2A5C",
+"bi c #28285A",
+"bj c #2B2B53",
+"bk c #333372",
+"bl c #2F2F6E",
+"bm c #2B2B3F",
+"bn c #2C2C36",
+"bo c #424266",
+"bp c #232337",
+"bq c #2F2FB0",
+"br c #34346C",
+"bs c #525265",
+"bt c #32326A",
+"bu c #1B1B2F",
+"bv c #3B3B55",
+"bw c #303068",
+"bx c #21214C",
+"by c #2C2C64",
+"bz c #292957",
+"c` c #232351",
+"ca c #26264A",
+"cb c #2F2F60",
+"cc c #202044",
+"cd c #5D5D97",
+"ce c #2B2B5C",
+"cf c #363674",
+"cg c #3C3C66",
+"ch c #252556",
+"ci c #30306E",
+"cj c #3E3E54",
+"ck c #414178",
+"cl c #2C2C6A",
+"cm c #2F2F4F",
+"cn c #25252E",
+"co c #27275B",
+"cp c #363663",
+"cq c #4C4C68",
+"cr c #20204A",
+"cs c #2E2E5B",
+"ct c #29294C",
+"cu c #242451",
+"cv c #27274A",
+"cw c #343464",
+"cx c #4F4F64",
+"cy c #252548",
+"cz c #16162C",
+"d` c #292938",
+"da c #333384",
+"db c #3C3C6F",
+"dc c #353572",
+"dd c #1E1E37",
+"de c #38386B",
+"df c #414156",
+"dg c #242454",
+"dh c #31316E",
+"di c #181831",
+"dj c #232349",
+"dk c #272739",
+"dl c #393979",
+"dm c #4C4C85",
+"dn c #2F2F83",
+"do c #28285B",
+"dp c #292952",
+"dq c #36366C",
+"dr c #48486D",
+"ds c #23234C",
+"dt c #37377A",
+"du c #20203F",
+"dv c #1E1E3D",
+"dw c #26265C",
+"dx c #313174",
+"dy c #4C4C60",
+"dz c #27273F",
+"e` c #3C3C78",
+"ea c #48485C",
+"eb c white",
+"ec c #383874",
+"ed c #333379",
+"ee c #444458",
+"ef c #272756",
+"eg c #47477C",
+"eh c #32326E",
+"ei c #1B1B33",
+"ej c #1E1E2C",
+"ek c #30306C",
+"el c #40407F",
+"em c #292944",
+"en c #212150",
+"eo c #23233E",
+"ep c #141422",
+"eq c #343473",
+"er c #323271",
+"es c #2D2D76",
+"et c #2E2E6D",
+"eu c #40406E",
+"ev c #21213F",
+"ew c #272731",
+"ex c #8080BA",
+"ey c #23232D",
+"ez c #25255A",
+"f` c #1B1B39",
+"fa c #35356D",
+"fb c #191937",
+"fc c #262651",
+"fd c #313169",
+"fe c #2C2C6E",
+"ff c #22224D",
+"fg c #18182C",
+"fh c #373786",
+"fi c #2D2D65",
+"fj c #232344",
+"fk c #2B2B63",
+"fl c #292961",
+"fm c #27275F",
+"fn c #202037",
+"fo c #1C1C33",
+"fp c #242452",
+"fq c #45456F",
+"fr c #484868",
+"fs c #535380",
+"ft c #1F1F43",
+"fu c #2C2C5D",
+"fv c #3535DD",
+"fw c #353573",
+"fx c #262657",
+"fy c #393963",
+"fz c #242455",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````bsbsbsbsbsbsdydybsbsea````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````eabsbsdybsbsbsbsbsbscqcxbsbsbsbsbscxdy````````````````````````````````````````````````````",
+"````````````````````````````````````````````````dydybsbsdycqcqdycxbsbsfrcqcxdyfrcqcxcxbseacxcxbsbs``````````````````````````````````````````````",
+"````````````````````````````````````````````eaeaeafrcqawawawdrdrawcxawawcqcqawawawawawbscqfrfrdycxcxea``````````````````````````````````````````",
+"````````````````````````````````````````frdfcxcqawcqcqawawfrcqdrawfrawawcqawawawfqawcqawcqdrawdrfrdycqdycx``````````````````````````````````````",
+"````````````````````````````````````eeeaeaeadycqdffrboboawfqfqfqdrdrfqbabadrdrdrdrbobodrdrbaawdrdyfreaeaboeeee``````````````````````````````````",
+"``````````````````````````````````eeeefreeeefrbofrfrbofrfqeudrbadrfqdrfqeubabababababafqdreufqfrbafrfreeeeeacjdf````````````````````````````````",
+"``````````````````````````````eecjboeebocjboboababboabdrfsfqfqbabobobafqfqawdrfqawbaeueudrdebafrbocgbobobobodfdfcjbd````````````````````````````",
+"````````````````````````````dfeeeedfcjbvab`ccgfyeuabboabbabaabdbadeucgdeabbabadbegfqfqfqbaeueueubobob`bocgcgdfeacjcjcj``````````````````````````",
+"``````````````````````````cjbddfcjbv`ccgdffycgfqbofyfyabdbeuabfqexbaeueudefqexadckdbbadedebaabdedeeufyboabcpfycjdfdfeecj````````````````````````",
+"````````````````````````cjcjdfdfbvb`cg`cfyfyfyfycgabcgdeeudbbregexdbdbadcddmegexeucgdedbdbayfydbdbabcgfycpb`bv`cbvcjdfbdcj``````````````````````",
+"``````````````````````bdbdcjbvbvfy`c`cb`cpcgfyfyfycpdededbdeegexdmaaebexckaadm`ucddbdedbdbcwcpcpfddedeb`fyb`bvfycjcmbdcj`s`s````````````````````",
+"````````````````````bd`nbvbvbv`ccg`c`ccscpcwcwcgdebrcwbraydqckdbcdegegcdcdade`btdcadbrdqfabrdebrcpbwaycpfyfyb``car`n`nbdcjbnbd``````````````````",
+"```````````````````n`s`n`ncj`nb`b`b`b`b`b`arcpdqfabrbrcwaybtbrexadcddbadaae`dedeexaddbdqdebrdedbdededeayb`b`cpb`b`fy`n`c`ncmbdbd````````````````",
+"```````````````````n`sbdaecmcmcscscscpcscscpcwfsbwfiaqfdaybtecadexaafsexe`exckdbbtecdedqfdaycpbrekcbcsaycb`icsaycpb`b``ncm`naebd````````````````",
+"`````````````````scj`c`ccmctbjcsb`cparasascsdqayaybwecbwbrbrbbe`dee`ebadegcdexadegdbcdade`ecbrbwfk`ffuarcwarcscscscpcscmcmct`nd`bd``````````````",
+"```````````````s`saecv`nbjaecmasarar`parcsayfdcb`fbrbtaq`fbtciecdmdbdeebcdebcdebehece`egfabtaqecbrcbazap`fayarcsas`casbjarcmem`n`sbn````````````",
+"``````````````ew`s`zcv`nevcmbjcscsbzcscwaydedqbwavfafdfadcdcckadebcke`aaehdhadebe`dcehdcbtbran`fbr`fbrfibtayaybzbjarcsb`bjbjafbm`sae````````````",
+"````````````bnaeae`kcmagdjfuaycsb``ffucscsbtbwdcaqfifdfabwave`exaaadcdcddh`oecadcddmfwapdbe`fdaqbrapbtbtfdecaqbhbzarcs`adpcmaf`zcmcncn``````````",
+"````````````dz`n`kctcmct`idparcwaybw`farfubrdqbr`ffdfafaecekerdcfeazeleqavdmexaddmelcibkegbrbtbkfa`uehbwfifiambzfxcscs`abjbjakctcmcm`z``````````",
+"``````````ey`saf`zafbjcv`befascsfuar`ffdbrde`faq`wdcdcbkerclesdlcfdmcdblfwcdebaddmdldxercdecbkavbkapbrbtfdbt`fcbbwcbbjbzcactaebectfn`zey````````",
+"``````````a`bf`zcacvdpcv`icucscsbi`fefbhar`fbr`uekbrekcierdxdxdlcieleqes`odmelelexdmcfere`eldcetaqfibwfadcapcbcscsbtcsfcccakdp`vcv`zfncn````````",
+"`````````tbpaecvao`vcccydsbzcsbzffaifiekbwbtbrap`uekbber`odladdteddndnbqdxeqedeqebeleceqdtelelerbyfkavdcfiancwarbtfdcsbjdjfcbjctaebpddbpbf``````",
+"````````bf`rfodpevcv`vfjcybz`idpefbhayapetblapfdciblcleqeteqeldldxdxdadadaesdadtadcdcfereqdldcekapap`wflbwayamcbbhcbasasdp`pbjakcvfjfo`y`y``````",
+"````````ewdddidvdj`abzagdpcu`p`lbzambwfdbbclehdcerfeetetflfedaedbldxdadndaeddada`qdmcfeqdxdheqblfkap`waqfddq`fdgaycs`pcsefef`afjeveieifo`k``````",
+"```````ybfevei`zft`afubzcsas`fam`fbwfaecdcdcdccfetbbblcieretedesed`h`heldm`qdafvdndleceqercledetaqbrapbkfaayfabwbz`fbiascs`p`j`vftf`a`epbu`t````",
+"```````y`ybufnaefc`bdpcucs`pfubw`lbwbrdqdcehavfw`wcfcfereqfwercidt`hdae``qdtbqbqeddle`cfdtdxercifk`uavavecbwbw`fbz`m`mefay`jbc`d`aaobua`fg`t````",
+"``````epbuddcvfjefca`bdsbzbzbhezbyaqaqbrdqehecdcfddccfeqdaedblazdtfhfhdxdtdnfednfvfvcfdtererdcehfl`wfkbkfafaap`fcefifiasasfudjbc`bcadudda``t````",
+"``````a`foeoemak`adparcsarefaidwamapbwapbyazeheccfeccfdxbqesfmblesbqeldtdtbq`g`hfvbq`q`qeqerfweqclbbfmdhbwfa`ufubifxbtarcscb`b`bcv`v`vfgfgbu````",
+"````atejfgfgcy`v`bbcfuasef`ffiezchco`uazezezap`uekdlererereqeddadnfvfved`ofvesesbqfvdle`dleddtdlclfmfkerbr`mapfibtbi`lbzfufuccfccvccdvfg`yfoat``",
+"`````yfodiaj`v`v`x`bdpcsbzdeamamaxfkaqehfm`wav`ueteretbkbkcffhdxfednfefv`hbqdadxesfedtfwcfdtfwe`dcflcldlbkfdfibtap`fanfpayasao`idpagczfneifg`t``",
+"````atfgfofgagccao`abjasbzcbfufxbibtbwfdapecdlavekerblbkeqeqdaesfedafvdndn`hfvfv`hdxeddtdtcffwdlecdhcleqehbkaqaqfkfkco`f`fayafctdjcadiajdv`yfo``",
+"````atejbpczaocc`aaldpbzbzfudoen`mbtfiambtbtereretererbletetfeesbq`hfv`g`gdn`hdafhdabqfvbkbkdldlfwerclfkekecaqaqfdfidgef`b`pctccftakfoajfgbua```",
+"````ata`befofoft`daldp`p`laubzambi`lby`lehfm`gavciererclfe`g`gfhdtdxed`g`gesfmdnfvfvdndnetdxedblblazfmfmapec`mfzcbarc`bzbxfcaoccftf`fgbcepfgbu``",
+"`````y`yevbefjdv`xfpdp`jenbifd`lfufkfdbtazdw`merdtdtci`g`gfebledfhesdnfeesdafvededfvdaed`hdadaclflfmflezfibtbycobwfudgfuarfuds`v`xaodidia`atat``",
+"````atfgaobudif`acfp`ebxacfu`fc`fxfdfdan`mdw`gaz`ocfekcletesdndxfecletesdn`h`hfvfhedclfheqfherek`gbyazfm`uaz`ubtamanfucbceaufcccccducaevfoatat``",
+"````atfoejfof`fbcc`jcrbheffufualaxamfiancifkbbciehekflcleleqdadxfedn`gbq`hfvesdnblfmflbberedcletazeqazehapfm`w`lfubzcbcsbzcr`jdpacf`ftdvfn`yat``",
+"````atfgbufodjfjdudp`afpfu`l`jfcbiefdoapavfkfketazbyazbldxdt`hes`hesdxdx`h`hesdndaet`gazeler`wazdhdhcidhanbxezfzchbibh`p`pfceffffcf`czfodd`yat``",
+"````atatczdif``b`v`v`afffu`facfcfubidgfmcoez`lapbbap`gbbedecfhedetdaesesfv`h`qcifhfhdadletfl`wekfianfkcifk`lfkchfl`lbzcrcufc`ift`aaodddda`buat``",
+"````at`tdif`dvagcycc`iff`pefcraxfz`fbianezfkap`uehfw`ufl`gcieqcderfh`hdnedeqdcfedmazdldxdl`gazaq`lfmfmdwfi`l`lan`wfdfucrc`fp`b`d`daoddbufnatat``",
+"``````fga`f`dvdvcycc`xffdsdscrchezcrfzeffxezfieqecdlbkfebbcidh`qfhfhad`qelfedndadnfkblcfclcierazapaqdwaibhchaqanfxcecealfpef`x`bdvf`eiczfg`y````",
+"``````at`yeiczeiajftftac`j`pfpaxalaxefbxfzch`maqfkbkerazclblbkdmdtdaaaedexfvaddafe`udmblflfkazbbazaqfiaqanbiamanaxfpbzds`pfcbcccdvftaoei`yep````",
+"``````a`a`didif`f`acbxalfp`pbxax`jcefufzfzfmfmbbfifkfibkdhaveqelexfv`qcddndmcdadfeekdl`hflanfkfm`wfdfkapapbhcuefchcuau`bbz`jacccf``vdidvat`y````",
+"``````a`epfoczdv`baoacefbxbzcscr`pfi`fcochchezez`mavekdcecfmfmdmfa`wdlapexcdcddmaabbazes`wfd`lan`maqaibwehapcofiauauau`befalbcdp`ddvfodieiat````",
+"````````ata`difbftao`a`bbzfu`bagbzfdbrfiandoaiaifp`wekeqfw`wfkeke`apckaqelecerfkckcdfherer`ufk`wbyaqaidoanamanbzcufx`b`pbgbcbgccagdieiczep``````",
+"````````at`yfgf`difbctagbzascrbcefaubififx`lananezdo`mcidhapav`uelcddcecape`dcflfaekbkeqekdwcofkfiapaidgefchbic`ffalftaldvf`bpf`fbdidia`a```````",
+"````````at`yczddeiaof`dvfb`jbgccasc`crbhcrfpenchchcoanekeh`we``wfkelececaaek`qcdaqfk`ufiezdgdwfman`lbhenfzfzaifpcealcraoaodueobeajdifg`ya```````",
+"``````````a`bueibueiajajddddbcbgalbzfcbh`j`pfpdoaichchavapdodmbtbyad`mfkbydweccfckaielfmbybt`l`mcodwanaxaxenbifxbzdsbxf`ftacfndkajfofgfg````````",
+"``````````a``teifgbubeftdvafccbgalamef`j`dbxcofkaqcodo`famdgdeanaidqanape``me`fiaianfk`m`mbwfdapaqfzffenfpc`bhfu`pftagagft`jddddfofofga`````````",
+"````````````fg`tbueibpf`dvevfbevbgfpfpcrenbxaxamfiananfkbiaxfpezezfxfkecbwbifzch`mezfiamdocochfi`lcobibibzfpfpbzcufjevccac`efgbubu`tej``````````",
+"`````````````tbu`rejf`aodidvdjfcagacbzbhaxdochfxanfzfpbiaichanbychchchbt`lfzbhezcofxaiaichchaufzc`fxch`jdoffenefbgalbgbcbccceiddfo`y`r``````````",
+"```````````````rejeifodvdvajacbcccccdgbibxfpdgaufuezfz`manfzanfxaufp`fcodocoezchchenauchfxchefff`jagffbxenbzbi`dftbc`edz`df`buddbudd````````````",
+"```````````````y`rbuf`diaoajacbgevevcrfpfpfp`afffffc`faqfxchchfzc`dgfxdgbjfxaiaiancofxfpcodg`bffds`adgbxbzbz`e`v`vftbeev`zajf`ddei`t````````````",
+"`````````````````yfoeyfbaj`zajbgevakalbxcccu`e`b`bc`efbic`axaxchfxfpezchbjfcdodochfx`fanbzcuaufxcv`bfp`pef`e`eeoeoaof`f`ajdv`rfn`r``````````````",
+"``````````````````cn`rejeidvacdveoak`vccccfffpbibx`ac``jcucu`jfxbifxfpfxfxfxcodgc`aybiai`i`jch`j`a`edjagacbc`x`zfnddajf`eodvey`t````````````````",
+"``````````````````eybfej`rejfoaoevcccc`v`xbcc`c`fffpbicubxcucuffc`cu`pfcfpdgbhdoaucu`jcuffbxbx`bcr`efjagbcfjeodkeodkevddfobpcney````````````````",
+"````````````````````eyejbpejbpdddvaoaodjbcagbcft`jefchfxbiauc``a`ac`c`fc`afcfccufcenfp`jfffp`jdsfpftcycrbcccdz`zdkbebebfddbf`r``````````````````",
+"``````````````````````cnbpeyfofofodudd`eacdjafcr`d`dcufpffef`jca`bff`jfcbxcuc`dsaecv`d`jds`dcy`vag`xagbcfteo`zbpfnbpbfej`r`r````````````````````",
+"````````````````````````d`bpddbfbebgak`zfj`z`kdsdsbxffff`bdj`b`b`jcucucudgcueffp`b`bcacacvcvctct`dagcyfjccevddeoeybpd`ej`r``````````````````````",
+"``````````````````````````eyddbp`r`k`z`zdzem`kfjfj`b`d`vdjcyctctcactctcv`dcr`bcvctaeaecv`b`jfjdsccakcveoakbedz`zd`ahewah````````````````````````",
+"````````````````````````````ewcnbnbndd`kdzfjdzemakemae`zcv`dcaaeaecy`e`acadsag`vaeaecvakaffjcacrbcajfj`zbp`z`kfnewewcn``````````````````````````",
+"```````````````````````````````rewbfbp`z`zbedzafcyakembeafctcaak`d`v`acvaeae`dff`dag`baeakfj`zcy`zbm`z`z`k`zbfd`ahcn````````````````````````````",
+"```````````````````````````````````sd`eyfnbmeobm`zdz`saf`v`k`kcvbcag`bcvemaeaecvagcyaecvevafaf`zem`zd`dkbmd`bfbf````````````````````````````````",
+"````````````````````````````````````ahewfoewbf`k`z`zdz`zafemememcvaf`kdz`vafaeafakemembmbpafdkdkbp`k`zbp`seyah``````````````````````````````````",
+"`````````````````````````````````````````sah`zewdk`z`zdzaeaf`kemdzakakaeae`kemakemeo`z`kemdkbfbpdk`kd`d`bn``````````````````````````````````````",
+"````````````````````````````````````````````ahbnbf`zd`d``sbm`kdz`sdkdk`sae`k`zbmd``k`sbmdz`kbnah`s`sbn``````````````````````````````````````````",
+"````````````````````````````````````````````````bncnbmbnd`dkdkdkdkbm`sbnbnbndzd`d``sbm`sbfd`bnewah``````````````````````````````````````````````",
+"``````````````````````````````````````````````````````cnd``s`s`sahd`dkbmbnbn`sbnd`bnbn`newah````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````ahcn`sbnahewbn`sewahbn````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass2[] = {
+/* width height ncolors chars_per_pixel */
+"12 12 75 2",
+/* colors */
+"`` c None",
+"`a c #25254C",
+"`b c #23234A",
+"`c c #212148",
+"`d c #2E2E62",
+"`e c #29293F",
+"`f c #272754",
+"`g c #414188",
+"`h c #20202C",
+"`i c #2E2E68",
+"`j c #242447",
+"`k c #25253E",
+"`l c #B9B9ED",
+"`m c #6767A3",
+"`n c #2B2B47",
+"`o c #29295C",
+"`p c #252544",
+"`q c #29295F",
+"`r c #1F1F3E",
+"`s c #2F2F68",
+"`t c #2D2D66",
+"`u c #30305F",
+"`v c #4C4C6D",
+"`w c #2B2B53",
+"`x c #2F2F6E",
+"`y c #34346C",
+"`z c #3B3B55",
+"a` c #303068",
+"aa c #2C2C64",
+"ab c #26264A",
+"ac c #5D5D97",
+"ad c #363674",
+"ae c #3C3C66",
+"af c #252556",
+"ag c #30306E",
+"ah c #3E3E54",
+"ai c #2C2C6A",
+"aj c #4C4C68",
+"ak c #20204A",
+"al c #2E2E5B",
+"am c #343464",
+"an c #16162C",
+"ao c #292938",
+"ap c #333384",
+"aq c #3C3C6F",
+"ar c #1E1E37",
+"as c #38386B",
+"at c #242454",
+"au c #31316E",
+"av c #181831",
+"aw c #232349",
+"ax c #272739",
+"ay c #23234C",
+"az c #37377A",
+"b` c #1E1E3D",
+"ba c #313174",
+"bb c #3C3C78",
+"bc c #383874",
+"bd c #1B1B33",
+"be c #40407F",
+"bf c #292944",
+"bg c #212150",
+"bh c #2D2D76",
+"bi c #191937",
+"bj c #313169",
+"bk c #22224D",
+"bl c #18182C",
+"bm c #2D2D65",
+"bn c #232344",
+"bo c #292961",
+"bp c #27275F",
+"bq c #242452",
+"br c #484868",
+"bs c #262657",
+"bt c #242455",
+/* pixels */
+"`````````vajajajbr``````",
+"````ahaeae`yacasaq`zah``",
+"`````w`f`dagacbb`y`u`u``",
+"```naybm`i`mbabcaaamawar",
+"``bf`ua`adbpaz`gai`ial`j",
+"``bnbgbjaz`xbhapboaa`uav",
+"``b`aybtbcaube`x`s`tbqbd",
+"``anbiakafbb`l`i`q`o`rbl",
+"`````rakbkaf`wbsay`c`k``",
+"````ao`pay`aatab`bar`h``",
+"````````ax`e`n`kax``````",
+"````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass3[] = {
+/* width height ncolors chars_per_pixel */
+"14 14 90 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #383858",
+"`c c #2E2E62",
+"`d c #292967",
+"`e c #3535A1",
+"`f c #272751",
+"`g c #23234D",
+"`h c #29293F",
+"`i c #353579",
+"`j c #272754",
+"`k c #20202C",
+"`l c #2E2E3D",
+"`m c #242447",
+"`n c #25253E",
+"`o c #3E3E67",
+"`p c #1C1C3F",
+"`q c #6767A3",
+"`r c #2B2B47",
+"`s c #29295C",
+"`t c #2B2B61",
+"`u c #29295F",
+"`v c #1F1F3E",
+"`w c #2F2F68",
+"`x c #2D2D66",
+"`y c #222251",
+"`z c #2D2D69",
+"a` c #33335B",
+"aa c #37374B",
+"ab c #22223D",
+"ac c #28285A",
+"ad c #2B2B53",
+"ae c #2C2C36",
+"af c #424266",
+"ag c #232337",
+"ah c #525265",
+"ai c #32326A",
+"aj c #1B1B2F",
+"ak c #303068",
+"al c #232351",
+"am c #363674",
+"an c #3C3C66",
+"ao c #252556",
+"ap c #27275B",
+"aq c #363663",
+"ar c #4C4C68",
+"as c #2E2E5B",
+"at c #29294C",
+"au c #27274A",
+"av c #252548",
+"aw c #16162C",
+"ax c #292938",
+"ay c #353572",
+"az c #38386B",
+"b` c #4C4C85",
+"ba c #2F2F83",
+"bb c #20203F",
+"bc c #313174",
+"bd c #333379",
+"be c #444458",
+"bf c #272756",
+"bg c #47477C",
+"bh c #32326E",
+"bi c #1B1B33",
+"bj c #30306C",
+"bk c #40407F",
+"bl c #23233E",
+"bm c #141422",
+"bn c #343473",
+"bo c #2D2D76",
+"bp c #2E2E6D",
+"bq c #40406E",
+"br c #21213F",
+"bs c #8080BA",
+"bt c #25255A",
+"bu c #1B1B39",
+"bv c #35356D",
+"bw c #262651",
+"bx c #18182C",
+"by c #373786",
+"bz c #2B2B63",
+"c` c #202037",
+"ca c #1C1C33",
+"cb c #242452",
+"cc c #484868",
+"cd c #1F1F43",
+"ce c #2C2C5D",
+"cf c #3535DD",
+"cg c #262657",
+"ch c #242455",
+/* pixels */
+"``````````arccaharcc````````",
+"``````bea``obqbqbqanafaa````",
+"`````ladaqbv`qbsbgai`ca``b``",
+"````a`a`asaib`bhb`bhakasau``",
+"``c``j`c`d`dbd`eb`am`wce`aca",
+"``bxasaobt`ibdbycf`iay`u`abx",
+"``bl`a`t`ubnbdbocfbcbt`cbwbu",
+"``bi`fch`sbhbkbabp`z`u`w`gaj",
+"``bm`a`a`u`xbjaibgbzcgbf`paw",
+"````agbralazap`t`ucbacbbaj``",
+"`````kbrcdcbcbcgbw`y`vab`k``",
+"``````axbrauatav`r`m`n`n````",
+"``````````ax`h`r`nae````````",
+"````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass4[] = {
+/* width height ncolors chars_per_pixel */
+"20 20 151 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #29293F",
+"`j c #2C2C63",
+"`k c #2A2A61",
+"`l c #33334C",
+"`m c #353579",
+"`n c #272754",
+"`o c #20202C",
+"`p c #2E2E3D",
+"`q c #2E2E68",
+"`r c #242447",
+"`s c #2C2C66",
+"`t c #222245",
+"`u c #181824",
+"`v c #25253E",
+"`w c #B9B9ED",
+"`x c #1C1C3F",
+"`y c #6767A3",
+"`z c #2B2B47",
+"a` c #272743",
+"aa c #222248",
+"ab c #292931",
+"ac c #29295C",
+"ad c #1D1D39",
+"ae c #252544",
+"af c #2B2B61",
+"ag c #29295F",
+"ah c #1F1F3E",
+"ai c #2F2F68",
+"aj c #2D2D66",
+"ak c #30305F",
+"al c #2C2C5B",
+"am c #11111C",
+"an c #262655",
+"ao c #31316D",
+"ap c #4C4C6D",
+"aq c #222251",
+"ar c #323264",
+"as c #43436E",
+"at c #212146",
+"au c #37374B",
+"av c #22223D",
+"aw c #252536",
+"ax c #1D1D42",
+"ay c #2A2A5C",
+"az c #28285A",
+"b` c #2B2B53",
+"ba c #333372",
+"bb c #2F2F6E",
+"bc c #2B2B3F",
+"bd c #2C2C36",
+"be c #232337",
+"bf c #34346C",
+"bg c #525265",
+"bh c #32326A",
+"bi c #303068",
+"bj c #21214C",
+"bk c #2C2C64",
+"bl c #292957",
+"bm c #232351",
+"bn c #26264A",
+"bo c #2F2F60",
+"bp c #5D5D97",
+"bq c #363674",
+"br c #3C3C66",
+"bs c #252556",
+"bt c #30306E",
+"bu c #414178",
+"bv c #2C2C6A",
+"bw c #20204A",
+"bx c #2E2E5B",
+"by c #29294C",
+"bz c #242451",
+"c` c #27274A",
+"ca c #343464",
+"cb c #4F4F64",
+"cc c #252548",
+"cd c #292938",
+"ce c #333384",
+"cf c #3C3C6F",
+"cg c #353572",
+"ch c #1E1E37",
+"ci c #38386B",
+"cj c #414156",
+"ck c #242454",
+"cl c #181831",
+"cm c #232349",
+"cn c #272739",
+"co c #4C4C85",
+"cp c #2F2F83",
+"cq c #28285B",
+"cr c #36366C",
+"cs c #48486D",
+"ct c #23234C",
+"cu c #37377A",
+"cv c #20203F",
+"cw c #26265C",
+"cx c #313174",
+"cy c #4C4C60",
+"cz c #27273F",
+"d` c #3C3C78",
+"da c #48485C",
+"db c #383874",
+"dc c #333379",
+"dd c #444458",
+"de c #272756",
+"df c #32326E",
+"dg c #1B1B33",
+"dh c #1E1E2C",
+"di c #30306C",
+"dj c #40407F",
+"dk c #292944",
+"dl c #212150",
+"dm c #141422",
+"dn c #323271",
+"do c #2D2D76",
+"dp c #2E2E6D",
+"dq c #21213F",
+"dr c #8080BA",
+"ds c #23232D",
+"dt c #25255A",
+"du c #35356D",
+"dv c #191937",
+"dw c #262651",
+"dx c #313169",
+"dy c #2C2C6E",
+"dz c #22224D",
+"e` c #18182C",
+"ea c #373786",
+"eb c #232344",
+"ec c #2B2B63",
+"ed c #292961",
+"ee c #202037",
+"ef c #1C1C33",
+"eg c #242452",
+"eh c #45456F",
+"ei c #535380",
+"ej c #1F1F43",
+"ek c #2C2C5D",
+"el c #3535DD",
+"em c #262657",
+"en c #393963",
+"eo c #242455",
+/* pixels */
+"``````````````cycyapbgcbcybg````````````",
+"``````````dacycsehcsehapehcsddcj````````",
+"````````au`cenbraseicibucicibrendd``````",
+"``````auau`ccacidudrbpdrcfcrarakau`p````",
+"`````p`lbx`nbhbfdxcobpcodjdu`sakalb`bd``",
+"`````zbybxbocicgbvbbdn`ydbdfbfekbxbybe``",
+"``dh`r`rbl`faidydndn`hd`dnbtecafakdwah`o",
+"``dhdqejcqajdfcg`meacu`hbqdfdibi`jblbndh",
+"``ch`rbxemaidudnbq`geldcbqdbdn`jafbxbnav",
+"``dm`x`bdxdxcwbqdycpdocxdcbvedbkcqalebdg",
+"```uccctdzbsag`qbqdpeacxbtaidiagekdwcvdm",
+"``dmcl`xeoandtdfbv`wdjcediecbiaydectatch",
+"``amdvcm`xaf`kagaodi`qdbbaecanazejdvdv`u",
+"````e``xcvandlcqckdtcgagcq`qaqay`tbjef``",
+"````dsclaxbwdzdebsckb`acegbjeg`eaaadds``",
+"``````eeeeejbzanegdw`abmdl`b`rcnavaw````",
+"````````eeczbc`b`dby`dbya``eae`iaw``````",
+"``````````bdawa`dkc`aeae`i`i`vab````````",
+"``````````````bd`pcdcdbdcdbd````````````",
+"````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass5[] = {
+/* width height ncolors chars_per_pixel */
+"24 24 164 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #272751",
+"`j c #23234D",
+"`k c #29293F",
+"`l c #2C2C63",
+"`m c #2A2A61",
+"`n c #33334C",
+"`o c #272754",
+"`p c #414188",
+"`q c #20202C",
+"`r c #2E2E3D",
+"`s c #1C1C28",
+"`t c #2E2E68",
+"`u c #242447",
+"`v c #2C2C66",
+"`w c #181824",
+"`x c #25253E",
+"`y c #161622",
+"`z c #B9B9ED",
+"a` c #3E3E67",
+"aa c #1C1C3F",
+"ab c #6767A3",
+"ac c #2B2B47",
+"ad c #222248",
+"ae c #292931",
+"af c #29295C",
+"ag c #252544",
+"ah c #1E1E47",
+"ai c #2B2B61",
+"aj c #29295F",
+"ak c #1F1F3E",
+"al c #2F2F68",
+"am c #2D2D66",
+"an c #30305F",
+"ao c #2C2C5B",
+"ap c #11111C",
+"aq c #262655",
+"ar c #31316D",
+"as c #4C4C6D",
+"at c #323264",
+"au c #2D2D69",
+"av c #33335B",
+"aw c #212146",
+"ax c #37374B",
+"ay c #22223D",
+"az c #252536",
+"b` c #1D1D42",
+"ba c #28285A",
+"bb c #2B2B53",
+"bc c #333372",
+"bd c #2F2F6E",
+"be c #2C2C36",
+"bf c #424266",
+"bg c #232337",
+"bh c #2F2FB0",
+"bi c #34346C",
+"bj c #525265",
+"bk c #32326A",
+"bl c #1B1B2F",
+"bm c #3B3B55",
+"bn c #303068",
+"bo c #21214C",
+"bp c #2C2C64",
+"bq c #292957",
+"br c #26264A",
+"bs c #202044",
+"bt c #5D5D97",
+"bu c #2B2B5C",
+"bv c #363674",
+"bw c #3C3C66",
+"bx c #252556",
+"by c #30306E",
+"bz c #3E3E54",
+"c` c #2C2C6A",
+"ca c #25252E",
+"cb c #27275B",
+"cc c #363663",
+"cd c #4C4C68",
+"ce c #20204A",
+"cf c #2E2E5B",
+"cg c #29294C",
+"ch c #242451",
+"ci c #27274A",
+"cj c #343464",
+"ck c #252548",
+"cl c #16162C",
+"cm c #292938",
+"cn c #333384",
+"co c #3C3C6F",
+"cp c #353572",
+"cq c #1E1E37",
+"cr c #38386B",
+"cs c #414156",
+"ct c #242454",
+"cu c #31316E",
+"cv c #181831",
+"cw c #232349",
+"cx c #272739",
+"cy c #4C4C85",
+"cz c #2F2F83",
+"d` c #28285B",
+"da c #292952",
+"db c #48486D",
+"dc c #23234C",
+"dd c #37377A",
+"de c #1E1E3D",
+"df c #26265C",
+"dg c #313174",
+"dh c #4C4C60",
+"di c #27273F",
+"dj c #3C3C78",
+"dk c #48485C",
+"dl c white",
+"dm c #383874",
+"dn c #333379",
+"do c #444458",
+"dp c #272756",
+"dq c #1B1B33",
+"dr c #1E1E2C",
+"ds c #30306C",
+"dt c #40407F",
+"du c #292944",
+"dv c #212150",
+"dw c #23233E",
+"dx c #343473",
+"dy c #323271",
+"dz c #2D2D76",
+"e` c #2E2E6D",
+"ea c #40406E",
+"eb c #21213F",
+"ec c #8080BA",
+"ed c #23232D",
+"ee c #25255A",
+"ef c #35356D",
+"eg c #191937",
+"eh c #262651",
+"ei c #313169",
+"ej c #2C2C6E",
+"ek c #22224D",
+"el c #18182C",
+"em c #373786",
+"en c #2D2D65",
+"eo c #232344",
+"ep c #2B2B63",
+"eq c #292961",
+"er c #27275F",
+"es c #1C1C33",
+"et c #242452",
+"eu c #45456F",
+"ev c #484868",
+"ew c #1F1F43",
+"ex c #2C2C5D",
+"ey c #3535DD",
+"ez c #262657",
+"f` c #393963",
+"fa c #242455",
+/* pixels */
+"``````````````````dkdhbjbjbjbjdh````````````````",
+"``````````````csasascdevcdascddbevdh````````````",
+"``````````dodobfa`dbeubfeueueacrbfbfcsax````````",
+"````````bzcsbwf`bwcrbicobteccratcof`bmbzbz``````",
+"```````n`navavanefcjbibt`zcrcobicratccf``nax````",
+"``````acbbao`oat`fambycobtdldjbkbialan`can`n````",
+"````dicg`icj`fbi`fefdyauarabbybiefbnaicfbbcg`x``",
+"````ac`udcbqenbk`tdyabczdgdxdmdtbpcpcjeicwcgcq``",
+"```wdq`acfaiefcpe`bydn`hcyeydmc`ambcef`fcf`u`y`s",
+"```ydudaandfbnaubvdgerbhdd`h`pdyc`cu`tezcf`b`ubl",
+"``elad`abqezbndmdsbccncnczeydnbvdmdxamep`fcgcv`w",
+"```weoetdv`leidfdd`gbddzdzdncncneqeebpexan`ucvap",
+"``elcwdaexehd`epaubd`hdz`hcz`gdycucueeba`oekcl`w",
+"``eldebsdcbxfaeedmejcuemdtcnbdbyalafambuet`bdq`w",
+"```yclakboce`fbx`mcper`veccyauei`mbncbaqdpdaesap",
+"````clakegbsceetbxdsdjdt`zbt`tctajdvafahakayel``",
+"````eldqdeebetboenepetezbnbxencb`lbaeteoaabldr``",
+"``````blakb`ceetekambxctbbafezctdcbo`eew`xcq````",
+"``````ed`qakbsawekchchchetd``jboceaddwcxesed````",
+"````````cmazag`xdcek`bchctetbrci`deocqbg`q``````",
+"```````````qbgayckaybr`uacek`beo`x`xazca````````",
+"``````````````aecxdi`kagacag`xcxcxcm````````````",
+"``````````````````ca`rcmbebebeae````````````````",
+"````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass6[] = {
+/* width height ncolors chars_per_pixel */
+"30 30 181 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #3535A1",
+"`h c #23234D",
+"`i c #29293F",
+"`j c #2C2C63",
+"`k c #2A2A61",
+"`l c #33334C",
+"`m c #353579",
+"`n c #272754",
+"`o c #20202C",
+"`p c #2E2E3D",
+"`q c #1C1C28",
+"`r c #2E2E68",
+"`s c #242447",
+"`t c #2C2C66",
+"`u c #222245",
+"`v c #181824",
+"`w c #25253E",
+"`x c #161622",
+"`y c #B9B9ED",
+"`z c #3E3E67",
+"a` c #1C1C3F",
+"aa c #6767A3",
+"ab c #2B2B47",
+"ac c #272743",
+"ad c #292931",
+"ae c #29295C",
+"af c #1D1D39",
+"ag c #252544",
+"ah c #1E1E47",
+"ai c #2B2B61",
+"aj c #29295F",
+"ak c #1F1F3E",
+"al c #2F2F68",
+"am c #2D2D66",
+"an c #30305F",
+"ao c #2C2C5B",
+"ap c #11111C",
+"aq c #262655",
+"ar c #31316D",
+"as c #4C4C6D",
+"at c #222251",
+"au c #323264",
+"av c #2D2D69",
+"aw c #33335B",
+"ax c #43436E",
+"ay c #2B2B67",
+"az c #212146",
+"b` c #37374B",
+"ba c #22223D",
+"bb c #252536",
+"bc c #1D1D42",
+"bd c #28285A",
+"be c #2B2B53",
+"bf c #333372",
+"bg c #2F2F6E",
+"bh c #2C2C36",
+"bi c #424266",
+"bj c #232337",
+"bk c #2F2FB0",
+"bl c #34346C",
+"bm c #525265",
+"bn c #32326A",
+"bo c #1B1B2F",
+"bp c #3B3B55",
+"bq c #303068",
+"br c #21214C",
+"bs c #2C2C64",
+"bt c #292957",
+"bu c #232351",
+"bv c #26264A",
+"bw c #2F2F60",
+"bx c #202044",
+"by c #5D5D97",
+"bz c #2B2B5C",
+"c` c #363674",
+"ca c #3C3C66",
+"cb c #252556",
+"cc c #30306E",
+"cd c #3E3E54",
+"ce c #414178",
+"cf c #2C2C6A",
+"cg c #2F2F4F",
+"ch c #25252E",
+"ci c #27275B",
+"cj c #363663",
+"ck c #4C4C68",
+"cl c #20204A",
+"cm c #2E2E5B",
+"cn c #29294C",
+"co c #242451",
+"cp c #27274A",
+"cq c #343464",
+"cr c #4F4F64",
+"cs c #252548",
+"ct c #16162C",
+"cu c #292938",
+"cv c #333384",
+"cw c #3C3C6F",
+"cx c #353572",
+"cy c #1E1E37",
+"cz c #38386B",
+"d` c #414156",
+"da c #242454",
+"db c #31316E",
+"dc c #181831",
+"dd c #232349",
+"de c #272739",
+"df c #393979",
+"dg c #4C4C85",
+"dh c #2F2F83",
+"di c #28285B",
+"dj c #292952",
+"dk c #36366C",
+"dl c #48486D",
+"dm c #23234C",
+"dn c #37377A",
+"do c #20203F",
+"dp c #1E1E3D",
+"dq c #26265C",
+"dr c #313174",
+"ds c #4C4C60",
+"dt c #27273F",
+"du c #3C3C78",
+"dv c #48485C",
+"dw c white",
+"dx c #383874",
+"dy c #333379",
+"dz c #444458",
+"e` c #272756",
+"ea c #47477C",
+"eb c #32326E",
+"ec c #1E1E2C",
+"ed c #30306C",
+"ee c #40407F",
+"ef c #292944",
+"eg c #212150",
+"eh c #23233E",
+"ei c #141422",
+"ej c #343473",
+"ek c #323271",
+"el c #2D2D76",
+"em c #2E2E6D",
+"en c #40406E",
+"eo c #21213F",
+"ep c #272731",
+"eq c #8080BA",
+"er c #23232D",
+"es c #25255A",
+"et c #1B1B39",
+"eu c #35356D",
+"ev c #191937",
+"ew c #262651",
+"ex c #313169",
+"ey c #2C2C6E",
+"ez c #22224D",
+"f` c #18182C",
+"fa c #373786",
+"fb c #2D2D65",
+"fc c #232344",
+"fd c #2B2B63",
+"fe c #292961",
+"ff c #27275F",
+"fg c #202037",
+"fh c #1C1C33",
+"fi c #242452",
+"fj c #45456F",
+"fk c #484868",
+"fl c #535380",
+"fm c #1F1F43",
+"fn c #2C2C5D",
+"fo c #353573",
+"fp c #262657",
+"fq c #393963",
+"fr c #242455",
+/* pixels */
+"````````````````````````bmbmbmbmbmbmbm``````````````````````",
+"``````````````````dscrasasascrckasasasfkckbm````````````````",
+"````````````````dsdsdzbifjfjfjfjaxaxfjfjckdzdv``````````````",
+"````````````d`dvfqdzenfkfjencaendlaxaxcabibi`zdvb```````````",
+"``````````cd`zaw`cfqcacaceflczbydg`zencjcwca`cbpbpcd````````",
+"````````d`cdb``cawcqczdkeubycwbyczdwcwczcqaucaawb`b`b```````",
+"````````b``lcmcqaoczaublbndgeqdfeqczdgbn`jcmanfnawcg`l``````",
+"``````cu`w`wcmcmcqblardxeu`yceareqdueualbleuexdjcmbeba`p````",
+"````chabcg`acmbwbqczaiebcfdfdgekeqdudxebcxblbncmcm`ababjer``",
+"`````o`aeodmaobdalbn`rcfdf`mdhdrdyeaejdubscxffbwbwdd`b`w`q``",
+"````fhbadjcmbq`jcxcxekemeydr`gdy`geeekek`t`rexe`e``ndjdcdc``",
+"```q`veocnbtdialbleb`rfo`medfadnelbkc`bffeedeufn`jcmfmbvfg`x",
+"``ecbo`sbze`feaeayexavbgej`gbkdyeydhdudnemdbfdal`kfna``udc`v",
+"```xeieodjbtfpexfbc`avekbg`gbkelfa`g`gdxcxcfdxamfpbtcpfcdoap",
+"```vcya`btegex`kbldqdncfeycvdyelcv`gdycvfefeebaedianfmfcdc`q",
+"``fhcyetahfncobdbs`tbncfdybgcf`gdhcfavavav`tfraifnbtbteteoei",
+"```xdpaz`bbtcl`fesfbedfdekelbkdhaaavbgcf`jfe`fesbwez`bbxdcei",
+"```xfhdcbx`hfratbresfdedcfee`meedffded`t`tbqdiaee``nazazdcap",
+"`````vdp`sew`bbqaifpfpdbbsccdxdfekbyee`j`jdialbzfidmazafct``",
+"`````vbodpevbcaqbdatcb`tfdamar`ydg`taicbaje`dadaahaketevbo``",
+"`````qf`bjakdobdezegfbaidacibncxdgbddiajalatfibz`ubccyfh`q``",
+"``````chbjbcbcfmbdaediatcbfpfpajfpdaesfpbudmco`h`eewfhf`````",
+"`````````ocydp`waz`e`baqfiesfpdjfpfiaidacpewah`wafdpbb``````",
+"````````chfgfgfmddcofibdfi`bfi`ada`hegbu`h`seodtbafhec``````",
+"``````````cuepdo`wefdmfidd`b`hdae``bbvcn`dagakbabj`o````````",
+"````````````erbbdeefcsefcpabezcp`habef`sbx`wehbber``````````",
+"````````````````chbbba`ief`iacagabef`i`wba`wcu``````````````",
+"``````````````````chbb`p`p`w`w`pcu`p`icucuch````````````````",
+"````````````````````````adadcudeepadbh``````````````````````",
+"````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass7[] = {
+/* width height ncolors chars_per_pixel */
+"36 36 187 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #272751",
+"`j c #23234D",
+"`k c #29293F",
+"`l c #2C2C63",
+"`m c #2A2A61",
+"`n c #33334C",
+"`o c #353579",
+"`p c #272754",
+"`q c #414188",
+"`r c #20202C",
+"`s c #2E2E3D",
+"`t c #1C1C28",
+"`u c #2E2E68",
+"`v c #242447",
+"`w c #2C2C66",
+"`x c #222245",
+"`y c #181824",
+"`z c #25253E",
+"a` c #161622",
+"aa c #B9B9ED",
+"ab c #3E3E67",
+"ac c #1C1C3F",
+"ad c #6767A3",
+"ae c #2B2B47",
+"af c #272743",
+"ag c #222248",
+"ah c #292931",
+"ai c #29295C",
+"aj c #1D1D39",
+"ak c #252544",
+"al c #1E1E47",
+"am c #2B2B61",
+"an c #29295F",
+"ao c #1F1F3E",
+"ap c #2F2F68",
+"aq c #2D2D66",
+"ar c #30305F",
+"as c #2C2C5B",
+"at c #11111C",
+"au c #262655",
+"av c #31316D",
+"aw c #4C4C6D",
+"ax c #222251",
+"ay c #323264",
+"az c #2D2D69",
+"b` c #33335B",
+"ba c #43436E",
+"bb c #2B2B67",
+"bc c #212146",
+"bd c #37374B",
+"be c #22223D",
+"bf c #252536",
+"bg c #1D1D42",
+"bh c #2A2A5C",
+"bi c #28285A",
+"bj c #2B2B53",
+"bk c #333372",
+"bl c #2F2F6E",
+"bm c #2B2B3F",
+"bn c #2C2C36",
+"bo c #424266",
+"bp c #232337",
+"bq c #2F2FB0",
+"br c #34346C",
+"bs c #525265",
+"bt c #32326A",
+"bu c #1B1B2F",
+"bv c #3B3B55",
+"bw c #303068",
+"bx c #21214C",
+"by c #2C2C64",
+"bz c #292957",
+"c` c #232351",
+"ca c #26264A",
+"cb c #2F2F60",
+"cc c #202044",
+"cd c #5D5D97",
+"ce c #2B2B5C",
+"cf c #363674",
+"cg c #3C3C66",
+"ch c #252556",
+"ci c #30306E",
+"cj c #3E3E54",
+"ck c #414178",
+"cl c #2C2C6A",
+"cm c #2F2F4F",
+"cn c #25252E",
+"co c #27275B",
+"cp c #363663",
+"cq c #4C4C68",
+"cr c #20204A",
+"cs c #2E2E5B",
+"ct c #29294C",
+"cu c #242451",
+"cv c #27274A",
+"cw c #343464",
+"cx c #4F4F64",
+"cy c #252548",
+"cz c #16162C",
+"d` c #292938",
+"da c #333384",
+"db c #3C3C6F",
+"dc c #353572",
+"dd c #1E1E37",
+"de c #38386B",
+"df c #414156",
+"dg c #242454",
+"dh c #31316E",
+"di c #181831",
+"dj c #232349",
+"dk c #272739",
+"dl c #393979",
+"dm c #4C4C85",
+"dn c #2F2F83",
+"do c #28285B",
+"dp c #292952",
+"dq c #48486D",
+"dr c #23234C",
+"ds c #37377A",
+"dt c #1E1E3D",
+"du c #26265C",
+"dv c #313174",
+"dw c #4C4C60",
+"dx c #27273F",
+"dy c #3C3C78",
+"dz c #48485C",
+"e` c white",
+"ea c #383874",
+"eb c #333379",
+"ec c #444458",
+"ed c #272756",
+"ee c #47477C",
+"ef c #32326E",
+"eg c #1B1B33",
+"eh c #1E1E2C",
+"ei c #30306C",
+"ej c #40407F",
+"ek c #292944",
+"el c #212150",
+"em c #23233E",
+"en c #141422",
+"eo c #343473",
+"ep c #323271",
+"eq c #2D2D76",
+"er c #2E2E6D",
+"es c #40406E",
+"et c #21213F",
+"eu c #272731",
+"ev c #8080BA",
+"ew c #23232D",
+"ex c #25255A",
+"ey c #1B1B39",
+"ez c #35356D",
+"f` c #191937",
+"fa c #262651",
+"fb c #313169",
+"fc c #2C2C6E",
+"fd c #22224D",
+"fe c #18182C",
+"ff c #373786",
+"fg c #2D2D65",
+"fh c #232344",
+"fi c #2B2B63",
+"fj c #292961",
+"fk c #27275F",
+"fl c #202037",
+"fm c #1C1C33",
+"fn c #242452",
+"fo c #45456F",
+"fp c #484868",
+"fq c #535380",
+"fr c #1F1F43",
+"fs c #2C2C5D",
+"ft c #3535DD",
+"fu c #353573",
+"fv c #262657",
+"fw c #393963",
+"fx c #242455",
+/* pixels */
+"````````````````````````````````bsbsbsdwbs``````````````````````````````",
+"````````````````````````dwbsdwcqcxbscqdwcqcxdzcxbs``````````````````````",
+"````````````````````fpcxawcqawcqawawcqawfocqcqawfpcqcx``````````````````",
+"``````````````````ececfpfpbofodqdqdqesbababadqfobafpeccj````````````````",
+"``````````````dfeccjabcgesbobaabadcgabbaeefobaesbob`cgdfcjcj````````````",
+"````````````cjdfbvcgfwfwcgcgesbrevdbcdeeesdedbfwdbcgcpbvbvdfcj``````````",
+"``````````bdbvbvcg`ccpcwdecwayckcdeecddydcbrezdecpayfwb`ar`ncjbd````````",
+"```````````saecmcscpcscwbwaqayeaevfqdyckbtdefbcpeicscbcscpb`cmae````````",
+"`````````scvbjcmar`pcsfb`fbt`fcidmdecdcdefdyezaqbraz`farasasarek`s``````",
+"``````bnaecmdjayb`fscsbwaqfbbwdyaacddheacdfudbfbbrbtfbaqbzcsdpafcmcn````",
+"```````s`zbj`basfs`fbr`f`wdcepeqcfcdfue`dmdvcdbkbkbrfb`fbwbjcaaect`z````",
+"`````taeaoccdrcsfdfgbwbr`ubb`oadebdndvebe`eadsejbyavfgcwbtcsdjbjaeddbf``",
+"````eudidjbzdp`pbzbwbbefeperfjdabldadada`qcfdveofi`wfb`fay`ped`aeteg`k``",
+"`````yflfadpcsfs`lbrdcav`wcfeoepdsda`qbqebdydsepfiaveabwbz`maybc`abufe``",
+"````fmek`aararaiambwbyefcfcfbqfkeqejds`gft`qeofuclfkbw`ubibtcs`bcv`vfe``",
+"```ydi`v`xdpbzamaxaqfkavererbkfffcfc`hdaeqdscffudcclbkfgapanayaodpczeg`t",
+"``atbpao`adpbzdo`mfgbtepereperfcbqft`g`hffbqbkdlfucleiaqfbdg`bctfrfmfea`",
+"```yetfh`xdpelfbfsfbaz`mdsci`gblffdneqftebda`hdafjfjfgbybwdgardr`xdia`at",
+"``ateheycccredfsaxfgcibbeffjejdafc`g`heqblfjepclazazap`wfscbbz`jacfrflat",
+"``atczey`v`afsacfsdgco`lbb`gebffereqft`qffdaer`wfgfifififjbzcu`i`adda`at",
+"````a`dtcy`xdrcrexfxfvfgeabkbbdhffadejdndnblclepapdubhaqfvcefn`xdtegfe``",
+"````a`dieybxfnbx`jfsfxfkfgfgdheoev`qdncdfcdlfjfi`wfiapcuchaubzaceydiat``",
+"````atdifr`abz`bbzbranaifneifufidyckejepckffepfibyaianancu`bbgbgagegen``",
+"````atczegeyf`bgascrcrelchanefdyfieaaa`qaq`uexduanbhfxaicecraoemajfea```",
+"```````tfebedtccaled`dcoaqdoamdeaiandydyaifi`mfbaqfdfnbh`pagfrddfmfe````",
+"```````t`reydidjagbzaxchanfnaianchch`lbhcoaichauc`chdoelbgbgbcegfm`r````",
+"`````````reyaoacetcrfn`afd`ffvchc`fvbjaianfvco`bdrdgbz`e`vbe`zeyeg``````",
+"```````````regacem`vccfnbxc`cu`jbifnfvcoc`bi`ich`adjac`xflajemew````````",
+"``````````ewbpbpdtaobcbc`jchbic``ac``afafafnfd`jfncybcdxdkbedd`r````````",
+"````````````d`ddbeakfh`kdrfd`b`b`jcudged`bcacvct`dcyccddewd``r``````````",
+"``````````````eubndddxdxakaecvcaae`ecaagaecvafcabcfhbp`keucn````````````",
+"``````````````````d`flem`z`s`v`kbc`bekaeagaeetafekd`bmbf````````````````",
+"`````````````````````s`zdk`zae`kdxakaeekek`zekbfdkd`bn``````````````````",
+"````````````````````````bnbmd`dkdk`sbndxd`bmbfbnah``````````````````````",
+"````````````````````````````````cnbneu`sah``````````````````````````````",
+"````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass8[] = {
+/* width height ncolors chars_per_pixel */
+"44 44 189 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #272751",
+"`j c #23234D",
+"`k c #29293F",
+"`l c #2C2C63",
+"`m c #2A2A61",
+"`n c #33334C",
+"`o c #353579",
+"`p c #272754",
+"`q c #414188",
+"`r c #20202C",
+"`s c #2E2E3D",
+"`t c #1C1C28",
+"`u c #2E2E68",
+"`v c #242447",
+"`w c #2C2C66",
+"`x c #222245",
+"`y c #181824",
+"`z c #25253E",
+"a` c #161622",
+"aa c #B9B9ED",
+"ab c #3E3E67",
+"ac c #1C1C3F",
+"ad c #6767A3",
+"ae c #2B2B47",
+"af c #272743",
+"ag c #222248",
+"ah c #292931",
+"ai c #29295C",
+"aj c #1D1D39",
+"ak c #252544",
+"al c #1E1E47",
+"am c #2B2B61",
+"an c #29295F",
+"ao c #1F1F3E",
+"ap c #2F2F68",
+"aq c #2D2D66",
+"ar c #30305F",
+"as c #2C2C5B",
+"at c #11111C",
+"au c #262655",
+"av c #31316D",
+"aw c #4C4C6D",
+"ax c #222251",
+"ay c #323264",
+"az c #2D2D69",
+"b` c #33335B",
+"ba c #43436E",
+"bb c #2B2B67",
+"bc c #212146",
+"bd c #37374B",
+"be c #22223D",
+"bf c #252536",
+"bg c #1D1D42",
+"bh c #2A2A5C",
+"bi c #28285A",
+"bj c #2B2B53",
+"bk c #333372",
+"bl c #2F2F6E",
+"bm c #2B2B3F",
+"bn c #2C2C36",
+"bo c #424266",
+"bp c #232337",
+"bq c #2F2FB0",
+"br c #34346C",
+"bs c #525265",
+"bt c #32326A",
+"bu c #1B1B2F",
+"bv c #3B3B55",
+"bw c #303068",
+"bx c #21214C",
+"by c #2C2C64",
+"bz c #292957",
+"c` c #232351",
+"ca c #26264A",
+"cb c #2F2F60",
+"cc c #202044",
+"cd c #5D5D97",
+"ce c #2B2B5C",
+"cf c #363674",
+"cg c #3C3C66",
+"ch c #252556",
+"ci c #30306E",
+"cj c #3E3E54",
+"ck c #414178",
+"cl c #2C2C6A",
+"cm c #2F2F4F",
+"cn c #25252E",
+"co c #27275B",
+"cp c #363663",
+"cq c #4C4C68",
+"cr c #20204A",
+"cs c #2E2E5B",
+"ct c #29294C",
+"cu c #242451",
+"cv c #27274A",
+"cw c #343464",
+"cx c #4F4F64",
+"cy c #252548",
+"cz c #16162C",
+"d` c #292938",
+"da c #333384",
+"db c #3C3C6F",
+"dc c #353572",
+"dd c #1E1E37",
+"de c #38386B",
+"df c #414156",
+"dg c #242454",
+"dh c #31316E",
+"di c #181831",
+"dj c #232349",
+"dk c #272739",
+"dl c #393979",
+"dm c #4C4C85",
+"dn c #2F2F83",
+"do c #28285B",
+"dp c #292952",
+"dq c #36366C",
+"dr c #48486D",
+"ds c #23234C",
+"dt c #37377A",
+"du c #20203F",
+"dv c #1E1E3D",
+"dw c #26265C",
+"dx c #313174",
+"dy c #4C4C60",
+"dz c #27273F",
+"e` c #3C3C78",
+"ea c #48485C",
+"eb c white",
+"ec c #383874",
+"ed c #333379",
+"ee c #444458",
+"ef c #272756",
+"eg c #47477C",
+"eh c #32326E",
+"ei c #1B1B33",
+"ej c #1E1E2C",
+"ek c #30306C",
+"el c #40407F",
+"em c #292944",
+"en c #212150",
+"eo c #23233E",
+"ep c #141422",
+"eq c #343473",
+"er c #323271",
+"es c #2D2D76",
+"et c #2E2E6D",
+"eu c #40406E",
+"ev c #21213F",
+"ew c #272731",
+"ex c #8080BA",
+"ey c #23232D",
+"ez c #25255A",
+"f` c #1B1B39",
+"fa c #35356D",
+"fb c #191937",
+"fc c #262651",
+"fd c #313169",
+"fe c #2C2C6E",
+"ff c #22224D",
+"fg c #18182C",
+"fh c #373786",
+"fi c #2D2D65",
+"fj c #232344",
+"fk c #2B2B63",
+"fl c #292961",
+"fm c #27275F",
+"fn c #202037",
+"fo c #1C1C33",
+"fp c #242452",
+"fq c #45456F",
+"fr c #484868",
+"fs c #535380",
+"ft c #1F1F43",
+"fu c #2C2C5D",
+"fv c #3535DD",
+"fw c #353573",
+"fx c #262657",
+"fy c #393963",
+"fz c #242455",
+/* pixels */
+"````````````````````````````````````````````bs``````````````````````````````````````````",
+"````````````````````````````````dybseabsawbsbscxawcxbsdybs``````````````````````````````",
+"````````````````````````````eedycqcqcqdrcxawcqawawawawfrfrcxcq``````````````````````````",
+"````````````````````````eadyfrdybafrfqawawfqdrawawfrfrdrawcqeaeeee``````````````````````",
+"````````````````````eeeebofrboawbofqdrbadrfqeufqfqbababafqfrbobobocjee``````````````````",
+"``````````````````dfeebvfybvcgbaboeueueueuababfqdefqegeuabeufybocgdfeacj````````````````",
+"````````````````bvbo`nfydffybocgcgdedbegfsfqeuegexeudbdqdedbdeabfybvcjdfcj``````````````",
+"``````````````bdcjbvfyfyb`defyfydedbckexexebckdmaqdbdbdbayaydeaycpbvab`ccjbd````````````",
+"`````````````s`ccjb`b`b`b`ardededeaydcexadckaddbdbaadqdqbrbtbrayb`cpb``c`ccm`n``````````",
+"```````````n`n`ncmcsb`cpascpegfi`ucwbrcdcdebehaddbbrdmfaayaqcbb`arcscs`ccmb`ae`s````````",
+"``````````aeafcmaeasfu`paraycbbtfd`lavecckegcdcdaaec`qfa`ufa`f`ubwarbzb`cscs`kbm````````",
+"````````ewaectfjbzcsb`arcwbtdcapec`fdcaadmcd`ueqaddmekecav`fapbtecbwdparbjcmaoct`n``````",
+"````````bddzcmbjdparcscb`fdbfdfidcdlcieqbbdlciebexeletegbwbk`ubtbwfufucsdpcm`zctbm``````",
+"```````ycmdjdpctauaramefcsbwapehekereddleledcfdmdmdmerelecaqaqbrehcbbzarfc`vbjcyem`r````",
+"``````bpaobefjccbzasenbw`ufafdblcl`oeldldnbqededdtcdbkdldlet`lekamcbbw`fbjauctdp`zfn````",
+"`````yfoaj`bbzeodsfibhbrekavcfcletfldneddxeddadtdadmbkerercleh`ubwbwcbbzarbhdpfjdiei`t``",
+"````atfoemfcdpbzasfi`ffadcekbkazeqerbkerdadtdmfhbqdldleddxfkfdapdcfdfcam`pbz`e`ifoepa```",
+"````a`dd`v`bbzbjefdw`lbwbtehdceccf`hfeerbqfhedesbqfvdlcifwcifldhbrficbficsefcc`v`xajbp``",
+"````fnfgeo`vfubzbwdwco`ufm`m`ucfbler`ofh`hfveddndnbqdldldtcffmbkbwapbwaiefaybgctczfgei``",
+"`````yczacaodpbjayfxcobwapbkehdhblerdtdnfe`hbqfhbqfedtcfeqecaqeqbwfiapanbhbr`zdjbcaofo``",
+"````atczf``bbzbzbhax`laqbwaqdhciblfeclfhfhdafmbqdabqdacidldtdhflcf`wby`fauef`vccakev`y``",
+"``ata`fnagccbzenbhfiaifdehezdhdlet`geteddnbqesfvedbqesdndabbfmfmbtbyamfufuasbcccdidiepat",
+"````fgfgao`dbg`e`falcobwfkfmdh`o`gcidnesdn`gdabqed`geteretblekazfk`u`fdocb`j`abgf`ev`y``",
+"`````yeicv`v`b`pamfcbhfxfidwetazazdx`q`heted`qfveder`get`wciekehchcodgbhffefeffcczbu`y``",
+"````epdvfjfj`acubzenanbifxbyaqci`w`gereleddnesehdnazdxbkcl`wfmfm`f`lfmayenau`bfceidia```",
+"`````ybuev`xcc`j`pfzaxau`jezekcferblcifhfhdmdmdldtfmblekdhekaq`fbififzbzftbidudvdifgbu``",
+"````atfgfoaobgal`pc`auamaxcoekapdcfwaqe`edeldnele`ekelfm`manapaqficubi`pdjfcacf`bgdvep``",
+"`````ya`f`ag`bdpasbcfubraibifmfmdhcfanekdcdmdtdhflexblcifkbyfiaifian`pau`pagbgbceicza```",
+"``````epdif`dubcefbgauenaxfmco`f`mecekfied`uavexfkbbaqfmdwanapcubifxffbgacftbef`di`y````",
+"``````a`czbuf`ddddbcfffcfcdgdoancofdezbwecfkap`wehaifmbtfiandwaxenbibzagf`ccbpaj`t`y````",
+"`````````yfoeyaceoevenfpffbx`mam`mbifpdwchapehaicocoamaibibtezfxdgfxeffjccfpeiddfg``````",
+"````````ej`rdidvaobzalbzfp`mauchfpfkezfkau`f`fdechchchfzbic`axbxfpauff`ebg`pejej`t``````",
+"```````````tf`f`ajal`zcrfpendsffaycochfzdgfzbjcoancofpdo`ben`affce`edjbcbebef`di````````",
+"```````````t`rf`dvaoeobcdu`ece`bfpencucofxbic`auc`dgficuef`bbxffbg`ebedddvaobfew````````",
+"````````````cnejbpaodvftdj`jcr`pcoen`j`jcu`ifcbifx`jc``jen`bbx`vccbe`z`zddddcn``````````",
+"``````````````ewbpddfbddaccycr`dfp`jfpca`jcu`dc`cacv`dff`d`d`x`dft`z`zbeejcn````````````",
+"````````````````fgfneoduembmfj`vag`act`bds`ac``j`j`acv`bbcagak`xdudvbpcn`t``````````````",
+"``````````````````ewd`fnaeakemcyaecvdjaeaecrcvdsakaeakafcy`jao`zfnd`cn`t````````````````",
+"````````````````````d`dkfndzd``zbm`v`k`b`ecvemaeca`vaedudz`zafew`kbfey``````````````````",
+"````````````````````````bfdkd`dz`kafdzae`vemcyafakakaedzdzbed`dkcn``````````````````````",
+"````````````````````````````ahdkbnbnbm`z`sdk`s`zd`bm`safd`bn`s``````````````````````````",
+"````````````````````````````````bnbn`sd`d`dk`sbmbnah`s`sah``````````````````````````````",
+"````````````````````````````````````````````cn``````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *glass9[] = {
+/* width height ncolors chars_per_pixel */
+"50 50 188 2",
+/* colors */
+"`` c None",
+"`a c #27274E",
+"`b c #25254C",
+"`c c #383858",
+"`d c #23234A",
+"`e c #212148",
+"`f c #2E2E62",
+"`g c #292967",
+"`h c #3535A1",
+"`i c #272751",
+"`j c #23234D",
+"`k c #29293F",
+"`l c #2C2C63",
+"`m c #2A2A61",
+"`n c #33334C",
+"`o c #353579",
+"`p c #272754",
+"`q c #414188",
+"`r c #20202C",
+"`s c #2E2E3D",
+"`t c #1C1C28",
+"`u c #2E2E68",
+"`v c #242447",
+"`w c #2C2C66",
+"`x c #222245",
+"`y c #181824",
+"`z c #25253E",
+"a` c #161622",
+"aa c #B9B9ED",
+"ab c #3E3E67",
+"ac c #1C1C3F",
+"ad c #6767A3",
+"ae c #2B2B47",
+"af c #272743",
+"ag c #222248",
+"ah c #292931",
+"ai c #29295C",
+"aj c #1D1D39",
+"ak c #252544",
+"al c #1E1E47",
+"am c #2B2B61",
+"an c #29295F",
+"ao c #1F1F3E",
+"ap c #2F2F68",
+"aq c #2D2D66",
+"ar c #30305F",
+"as c #2C2C5B",
+"at c #11111C",
+"au c #262655",
+"av c #31316D",
+"aw c #4C4C6D",
+"ax c #222251",
+"ay c #323264",
+"az c #2D2D69",
+"b` c #33335B",
+"ba c #43436E",
+"bb c #2B2B67",
+"bc c #212146",
+"bd c #37374B",
+"be c #22223D",
+"bf c #252536",
+"bg c #1D1D42",
+"bh c #2A2A5C",
+"bi c #28285A",
+"bj c #2B2B53",
+"bk c #333372",
+"bl c #2F2F6E",
+"bm c #2B2B3F",
+"bn c #2C2C36",
+"bo c #424266",
+"bp c #232337",
+"bq c #2F2FB0",
+"br c #34346C",
+"bs c #525265",
+"bt c #32326A",
+"bu c #1B1B2F",
+"bv c #3B3B55",
+"bw c #303068",
+"bx c #21214C",
+"by c #292957",
+"bz c #232351",
+"c` c #26264A",
+"ca c #2F2F60",
+"cb c #202044",
+"cc c #5D5D97",
+"cd c #2B2B5C",
+"ce c #363674",
+"cf c #3C3C66",
+"cg c #252556",
+"ch c #30306E",
+"ci c #3E3E54",
+"cj c #414178",
+"ck c #2C2C6A",
+"cl c #2F2F4F",
+"cm c #25252E",
+"cn c #27275B",
+"co c #363663",
+"cp c #4C4C68",
+"cq c #20204A",
+"cr c #2E2E5B",
+"cs c #29294C",
+"ct c #242451",
+"cu c #27274A",
+"cv c #343464",
+"cw c #4F4F64",
+"cx c #252548",
+"cy c #16162C",
+"cz c #292938",
+"d` c #333384",
+"da c #3C3C6F",
+"db c #353572",
+"dc c #1E1E37",
+"dd c #38386B",
+"de c #414156",
+"df c #242454",
+"dg c #31316E",
+"dh c #181831",
+"di c #232349",
+"dj c #272739",
+"dk c #393979",
+"dl c #4C4C85",
+"dm c #2F2F83",
+"dn c #28285B",
+"do c #292952",
+"dp c #36366C",
+"dq c #48486D",
+"dr c #23234C",
+"ds c #37377A",
+"dt c #20203F",
+"du c #1E1E3D",
+"dv c #26265C",
+"dw c #313174",
+"dx c #4C4C60",
+"dy c #27273F",
+"dz c #3C3C78",
+"e` c #48485C",
+"ea c white",
+"eb c #383874",
+"ec c #333379",
+"ed c #444458",
+"ee c #272756",
+"ef c #47477C",
+"eg c #32326E",
+"eh c #1B1B33",
+"ei c #1E1E2C",
+"ej c #30306C",
+"ek c #40407F",
+"el c #292944",
+"em c #212150",
+"en c #23233E",
+"eo c #141422",
+"ep c #343473",
+"eq c #323271",
+"er c #2D2D76",
+"es c #2E2E6D",
+"et c #40406E",
+"eu c #21213F",
+"ev c #272731",
+"ew c #8080BA",
+"ex c #23232D",
+"ey c #25255A",
+"ez c #1B1B39",
+"f` c #35356D",
+"fa c #191937",
+"fb c #262651",
+"fc c #313169",
+"fd c #2C2C6E",
+"fe c #22224D",
+"ff c #18182C",
+"fg c #373786",
+"fh c #2D2D65",
+"fi c #232344",
+"fj c #2B2B63",
+"fk c #292961",
+"fl c #27275F",
+"fm c #202037",
+"fn c #1C1C33",
+"fo c #242452",
+"fp c #45456F",
+"fq c #484868",
+"fr c #535380",
+"fs c #1F1F43",
+"ft c #2C2C5D",
+"fu c #3535DD",
+"fv c #353573",
+"fw c #262657",
+"fx c #393963",
+"fy c #242455",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````e`bscwbscwbsbsbsbsbsbsbscw````````````````````````````````````",
+"````````````````````````````````bse`bscpbse`awawcwbsbsdqawawbsdxdxcwcw``````````````````````````````",
+"````````````````````````````e`eddxfqcwcpfqfqawawdqawdqawawfqcwawawfqfqe`cw``````````````````````````",
+"````````````````````````cie`e`dxfqboboawfpfpdqfpbafpawfpdqbofpabdqfqfqedcfdee```````````````````````",
+"``````````````````````edede`cifqbodqabfpfpbabobaccbabafpbaddbaetfpfqabbobobodee`````````````````````",
+"````````````````````deedbvbvfxfxcfetboetfpcfewetddetetdaefetbaetabetbofxabcfedcici``````````````````",
+"``````````````````bdedbd`cabdefxababfxddetddcccjefbacjeaetddddcfdpdaddababb``cdeedde````````````````",
+"````````````````bvbdbvfx`cb`fxcfcffxdddaddefccaaeaefewbwdldadaddcoayddcvcfb``cbvbdbvci``````````````",
+"```````````````s`cbvbdb`b`b`cocvdddaddayf`braadlfrccdldzewdddaebddfcbwayfxcfb``cbd`cbd`s````````````",
+"````````````bd`sclclbjb`crb`arcofr`ubtbtfcdkaaewewdlcjdabtdabtcvddebayaycadoarb``c`n`ncl`s``````````",
+"``````````bdbv`c`ccub`b`b`ascrdp`fcadzaqbwfjebcjeaccewaaccdlfrdlegbw`f`lcab`crcrcrclclelbpbd````````",
+"``````````bnbmcuclclcrb``pararcv`ff`fcegf`dzewcjcjeqdleabkavf`fc`mbrcaegfcaycabjararcrae`sbm````````",
+"````````evaedycragcacvb`apcrasbwf``faybtavekewaddleqdkccccdkbrdzfcavapbrfhf`biascac`bjcuel`kbf``````",
+"````````aeae`vcldo`acrcacr`fbtddaqapebceckbleqdzdseqaaadekdwebdkavceapbrbt`fftamcrbybjaeclbpbp``````",
+"```````rfnbeakdocubzarfw`faiarbraqegejbkcheqeqekd``oefekewdzchekbkaqfhbtbkapcrcacr`j`vdocbbpfn`t````",
+"``````cz`zdoakbccbbyasdr`fap`uf`fcejck`obkdl`odmfudwecdwaadzbkdzdbaz`legaqftar`fcadofbdobjafdccm````",
+"``````bfehdc`aeefifbftaiambw`gavbkblck`gckd`eqecec`hfgd`addsepbkfvfkapazavf`fw`fbycrcd`a`vehbubp````",
+"`````tbuehdyfbasdocaapayayebebbteq`geqchfvdwecbqdkaddsfudwdzbkckdwfjbrapf`bwf`byfwbyasdr`iezbucy`t``",
+"`````yfnfieu`bdi`abydn`mfcf`f`egdbavdbec`odwcefgecdsd`dmbqepceeqf`az`wejdbbrambi`lcdft`bcbc``va`ei``",
+"````a`eoenfifsaycrbyfl`mfc`uan`webceebdmer`gdwbqdsdsdmdmbqekdkeccechckfkejegfhbiftarby`a`v`vfiffbu``",
+"````fmcycxdidt`iardpdnemanavflejazeqesepcefgblerfud`fgfderfgdkdsdkdzfkeqbkapapbt`lctfceuas`vcydhfn``",
+"````ehdheudtagbybjcabidnapapfcebejblchcheqer`hbqbqerbqfufgecdsebcedkbkbleqf`fjambicaaycu`vcxa`du`y``",
+"````fnfndhdtbgdobybifocnbwameqckdgeqeqfdesfdfgfgdwflfddmfufudwch`odschflejebdvayby`pee`vcbacfndcbu``",
+"````bube`vacfe`iembyfc`f`ufc`wdveqdkeqflfddwfudm`her`hd`fgbqecd`ecbbflfkfjapdvbwdnftas`jfifieh`yeo``",
+"````ffehdhdhdrcqalft`jembtai`wfkdg`obbesbldmfddm`gecfud`dmbbdw`ochbl`ufkap`weganaiar`j`j`ddu`adhff``",
+"````ffdcdrdtbj`a`pfhfebibh`legfkesapaqeq`obqbqfddkfu`hd`dwfkchdw`wcheq`ufjemfyaucdby`peectduezdhbu``",
+"`````tfadhag`v`iee`fcqfweefleyanaqfjazazebfg`g`qfu`hadcher`q`h`gazdwaibbap`lfw`waybxct`aagcbeueofn``",
+"````eoa`ffcbfididr`eaxeybzbhcgaqepdlbkckazeqds`qfueqfdblefeqdzchdg`wfheyamey`laibyalbiagdraodheheo``",
+"````at`ydhdh`dfsal`pfyalfyemeyey`waqdgazckepbkdw`qekepecfjdmejflazfj`ubw`lbiftaxee`beecbcbbcdu`ta```",
+"````a`a`a`ficbalcqeeauct`fcgdffyflejapds`wefdleradewegaaegeseqbr`lfl`u`megamamctfb`vfebc`deudceoat``",
+"``````eofffacb`abyftcbbybtfcanfwaidvapepap`wegazdzdlek`uerfgepdgfj`laqdncn`mbyfoct`p`vbgacezdhbu````",
+"```````yffdhfsficbeealbybxbiemcncnamflch`u`uccew`udgdlf``wdldbcgflanbweefycnaxeeacezfsdyfmdh`y`t````",
+"```````teoeiezajdcdc`ealeeai`jaxaiamcgavaiew`ucc`w`mandzanebflfcamfldvbiemdffw`pfeezcbdcbpeh`yeo````",
+"`````````tfffffmaoakdtalamfbdremfjamaiaidffraiddegdbfhancnbrdn`mamegfwaxfocgftct`x`efeezeifn`t``````",
+"````````ex`tehbeezdubydialcdaxcnbidndfbhfwbweydf`mandfcgdvananfyfofycncgcnaxfoacbg`e`pfadueiex``````",
+"```````````rbufndcajacfscbbycqfofodnaifhfyai`paxcnfweyddcg`pcgfwfofedifeaxbyalfs`j`kduehfmfm````````",
+"```````````yeifndhbefsao`vaxbxbxcsfebyfwbzfybidfcgbjfwaidnambibybzbx`afocdbc`vfidtezajbueha`````````",
+"`````````````y`r`rezduaocxficb`jfw`abz`jct`jdnfwbzfwdnaufofofw`afo`i`ddiducb`zdudcezdu`rex``````````",
+"``````````````evbudjfmajcbagbcctbcfwcgaufoct`afofb`afodf`jbzemfobx`dfe`val`xczdjbebpdccm````````````",
+"````````````````evcmezfneufsaoelcqcxctfeaufecsfectbxbzfeae`b`jdrc``b`x`ecb`zbpfmfmeiev``````````````",
+"``````````````````ffbubpfiafafbmbc`vag`bc`csdr`j`bct`jfefbcxcx`j`xdificxacbeenbfev`t````````````````",
+"````````````````````cmczczdy`zak`kcucucudrcuaecxc`cxdrcxaeelak`vc``jajakbpafbfbf`r``````````````````",
+"``````````````````````cmczbpdjdc`kcxelaoelakagbc`aaeel`bbxakakeu`zdtbm`zdjbpevbf````````````````````",
+"````````````````````````cmbfeibfbmeuel`kelelafelelakaeelaf`k`k`zdjbebm`zbncmah``````````````````````",
+"````````````````````````````czbnczbp`zafbmaedyafelbmdy`zdybeczdjczbf`kbpex``````````````````````````",
+"`````````````````````````````````sevdjbncz`zdj`sczcz`k`k`s`sdjbfahevbn``````````````````````````````",
+"``````````````````````````````````````evah`sbncz`kev`sbnczbnczah````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+#include "colors.inc"
+#include "shapes.inc"
+#include "textures.inc"
+
+/* The following make the field of view as wide as it is high
+ * Thus, you should have the -W and -H command line options
+ * equal to each other. */
+camera {
+ location <5.8, 0, 0>
+ up <0, 1, 0>
+ right <1, 0, 0>
+ look_at <0, 0, 0>
+}
+
+sphere {
+ <0,0,0>, 2.5
+ texture { Jade
+ scale <0.7, 0.7, 0.7>
+ rotate y*clock }
+ finish { phong 0.4 }
+}
+
+light_source {<6, 1, 0> color White}
+light_source {<6.1, 1, 0> color White}
--- /dev/null
+/* XPM */
+static char *jade1[] = {
+/* width height ncolors chars_per_pixel */
+"10 10 58 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #149914",
+"`d c #179317",
+"`e c #158B15",
+"`f c #148914",
+"`g c #148514",
+"`h c #0F890F",
+"`i c #0D830D",
+"`j c #0F730F",
+"`k c #0F6F0F",
+"`l c #0E6B0E",
+"`m c #077307",
+"`n c #0E630E",
+"`o c #0B630B",
+"`p c #026502",
+"`q c #046104",
+"`r c #0A550A",
+"`s c #0B530B",
+"`t c #065306",
+"`u c #054F05",
+"`v c #074B07",
+"`w c #064706",
+"`x c #003700",
+"`y c #042B04",
+"`z c #011901",
+"a` c #21B621",
+"aa c #1AAC1A",
+"ab c #18A818",
+"ac c #17A217",
+"ad c #189E18",
+"ae c #127C12",
+"af c #107C10",
+"ag c #0F7A0F",
+"ah c #0B800B",
+"ai c #0E720E",
+"aj c #0A760A",
+"ak c #106A10",
+"al c #0F6A0F",
+"am c #0A6E0A",
+"an c #0B620B",
+"ao c #0D580D",
+"ap c #076007",
+"aq c #045E04",
+"ar c #015E01",
+"as c #015201",
+"at c #034803",
+"au c #044604",
+"av c #083E08",
+"aw c #014601",
+"ax c #044004",
+"ay c #063606",
+"az c #052E05",
+"b` c #013401",
+"ba c #042404",
+"bb c #002600",
+"bc c #022002",
+/* pixels */
+"```````v`l`g`k`v````",
+"````an`gad`cajaqal``",
+"``az`f`hahah`parapao",
+"```wagac`m`aa`aa`o`x",
+"``ak`d`qai`babau`e`w",
+"``b`aeafat`u`ias`j`s",
+"``bc`n`kafam`jaw`xay",
+"````avaxau`t`r`n`z``",
+"```````ybbavazba````",
+"````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade10[] = {
+/* width height ncolors chars_per_pixel */
+"60 60 192 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #139713",
+"`k c #149514",
+"`l c #1A8B1A",
+"`m c #159315",
+"`n c #129312",
+"`o c #158B15",
+"`p c #128D12",
+"`q c #148914",
+"`r c #158715",
+"`s c #148514",
+"`t c #0F890F",
+"`u c #128312",
+"`v c #0F870F",
+"`w c #0E850E",
+"`x c #108110",
+"`y c #0D830D",
+"`z c #0F7F0F",
+"a` c #127912",
+"aa c #137513",
+"ab c #107710",
+"ac c #0C7D0C",
+"ad c #0E750E",
+"ae c #0F730F",
+"af c #0F6F0F",
+"ag c #0F6D0F",
+"ah c #0E6B0E",
+"ai c #0E690E",
+"aj c #077307",
+"ak c #0F650F",
+"al c #0E630E",
+"am c #0B630B",
+"an c #0D5B0D",
+"ao c #0A5F0A",
+"ap c #036703",
+"aq c #0B570B",
+"ar c #075D07",
+"as c #026502",
+"at c #046104",
+"au c #0A550A",
+"av c #0B530B",
+"aw c #016101",
+"ax c #0C4F0C",
+"ay c #0A510A",
+"az c #025B02",
+"b` c #094F09",
+"ba c #045704",
+"bb c #0A4D0A",
+"bc c #065306",
+"bd c #0A4B0A",
+"be c #065106",
+"bf c #015901",
+"bg c #074D07",
+"bh c #054F05",
+"bi c #074B07",
+"bj c #084908",
+"bk c #094709",
+"bl c #084508",
+"bm c #064706",
+"bn c #014F01",
+"bo c #004B00",
+"bp c #063D06",
+"bq c #063B06",
+"br c #073907",
+"bs c #033D03",
+"bt c #004100",
+"bu c #013F01",
+"bv c #033B03",
+"bw c #053505",
+"bx c #003D00",
+"by c #063306",
+"bz c #053105",
+"c` c #023502",
+"ca c #003700",
+"cb c #042B04",
+"cc c #042904",
+"cd c #012301",
+"ce c #022102",
+"cf c #011D01",
+"cg c #021B02",
+"ch c #011901",
+"ci c #011701",
+"cj c #011501",
+"ck c #011301",
+"cl c #010D01",
+"cm c #21B621",
+"cn c #1CB41C",
+"co c #22AA22",
+"cp c #1AAC1A",
+"cq c #18A818",
+"cr c #1F9C1F",
+"cs c white",
+"ct c #18A418",
+"cu c #17A217",
+"cv c #189E18",
+"cw c #189A18",
+"cx c #149C14",
+"cy c #149014",
+"cz c #119011",
+"d` c #128A12",
+"da c #0F8C0F",
+"db c #128612",
+"dc c #148214",
+"dd c #138013",
+"de c #127E12",
+"df c #127C12",
+"dg c #107C10",
+"dh c #0F7A0F",
+"di c #0B800B",
+"dj c #0E780E",
+"dk c #0B7C0B",
+"dl c #117211",
+"dm c #0A7A0A",
+"dn c #0E720E",
+"do c #0A780A",
+"dp c #0A760A",
+"dq c #106A10",
+"dr c #0B720B",
+"ds c #0F6A0F",
+"dt c #0A700A",
+"du c #0A6E0A",
+"dv c #0B6C0B",
+"dw c #0A6A0A",
+"dx c #0B680B",
+"dy c #067006",
+"dz c #0C660C",
+"e` c #0A660A",
+"ea c #056E05",
+"eb c #056C05",
+"ec c #0B620B",
+"ed c #0C600C",
+"ee c #0D5E0D",
+"ef c #056A05",
+"eg c #066806",
+"eh c #076407",
+"ei c #0D580D",
+"ej c #0A5C0A",
+"ek c #076007",
+"el c #046404",
+"em c #0A5A0A",
+"en c #075A07",
+"eo c #085808",
+"ep c #045E04",
+"eq c #095409",
+"er c #015E01",
+"es c #055605",
+"et c #055405",
+"eu c #015601",
+"ev c #015401",
+"ew c #035003",
+"ex c #015201",
+"ey c #034C03",
+"ez c #034A03",
+"f` c #B1FFB1",
+"fa c #074207",
+"fb c #034803",
+"fc c #044604",
+"fd c #074007",
+"fe c #083E08",
+"ff c #014601",
+"fg c #024402",
+"fh c #034203",
+"fi c #044004",
+"fj c #053805",
+"fk c #063606",
+"fl c #013A01",
+"fm c #023802",
+"fn c #052E05",
+"fo c #013401",
+"fp c #013201",
+"fq c #042C04",
+"fr c #013001",
+"fs c #012E01",
+"ft c #012C01",
+"fu c #042604",
+"fv c #012A01",
+"fw c #022802",
+"fx c #042404",
+"fy c #002600",
+"fz c #022002",
+"g` c #011E01",
+"ga c #001000",
+"gb c #000A00",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````fwbdftaxbdbqavfjc`bkfvfycc``````````````````````````````````````````````",
+"``````````````````````````````````````````fnfjbpfaeefofrftaqbubifhbdbmfibkanfdfj````````````````````````````````````````",
+"````````````````````````````````````byfvfofidqaldqdqafa`a`bcfraoagafbubcbianeifafdfrce``````````````````````````````````",
+"````````````````````````````````byfraybjalfrbxfga`aidlenenffbsb`fffbeyddecaqbedlcafpbpbdby``````````````````````````````",
+"``````````````````````````````feeianbiezagbtakeyah`rdedge`bo`sfobndfffenafesffembsbubib`fofk````````````````````````````",
+"``````````````````````````bybqbjbmbxeqejenendde`addh`oadafbibobnbmboekbabne`dxffeyeybeagdqaqbkfq````````````````````````",
+"````````````````````````fwftaneebuedamaoenabdhdb`q`qdr`q`iaiejagbf`qcabaflbaekdgdceteoejbeayavfabz``````````````````````",
+"``````````````````````fkbqfialdsbtetdv`uduad`qdrdpcw`o`zazafcwcy`qdnevdpekcyahaeenar`rfrakakfdfifafw````````````````````",
+"````````````````````brbpb`emaafia``rdg`i`o`zcw`zdjcwct`w`oe`dodpaodnduelegexbfamaoaubaemakfgeyfybibqfv``````````````````",
+"``````````````````fec`bbaledfma`af`saddj`uehdbcv`ed`aj`fcpdp`madegerbx`oeldpd`d`dt`sev`rboa`dlafcacabkfw````````````````",
+"````````````````fwbkaydqecb`dcdv`rdc`scwexdp`g`ecvawdxdber`y`hctdiawdgfbdpduegcy`pdwepbodfenemaldsbmbmbqfn``````````````",
+"``````````````cffafralfjc`dnecaqaddb`x`zevatdp`vacfgeyerelfgetda`fdyaw`u`n`pdmd`cwdbexeqboa`ffeta`affhfmbzfn````````````",
+"``````````````fwfmeeemedaadca`eoepdrcvcvegeuebdoajefdhcncmeyetdicndocye`as`tcp`f`vcw`eeuaiflewaiffdldlayeife````````````",
+"````````````feavfieeaaeyfr`sdeexdwcvcu`meldk`fct`dcudidyamcyar`ycuct`tesdvea`eefdodp`e`peubearbobibhageeb`fvcd``````````",
+"``````````fxcdbdandlffesboek`xemdb`pdkbfel`k`dcncpajcmefewdjapdmefea`f`jcz`h`hdycydtd`cwegepfcfmdfaragemalbdbkch````````",
+"``````````fwbqbjakagenewencyad`gdrazeraccucpcpcncu`zdharap`kasdo`ndiap`k`dcuajcncpcwepdkcycydtdgdwafdlbcedeeblcc````````",
+"````````fxfrfnayeqbceyes`qekatexfldu`tcpdo`y`hcudiades`hewdmdicp`ccn`wapasaw`ges`xbherbxdbcy`idbekdlesa`dqaleibwcg``````",
+"````````fnfpeefhfbafalbodeehdwdder`p`e`yaddodicndkefcqcxdacq`c`d`ccz`h`eescme`drene`eaelfhegegdwedalewagauemavaxcc``````",
+"````````brbzakeebceyfcek`o`odhbief`k`ediapajcncx`fdict`ccucqcncm`ccx`tdr`ed`ardyebdpazegdgcvateoekaeenagedakeifdg```````",
+"``````cebdeieeala`alewekdrdrdbegeg`k`fcpdacmctdid`czczcn`ddacucm`c`cajasdmdmawdyea`fczacazcvexfgbnaraba`ameoeiblfech````",
+"``````byfjfadqfgauej`redaebnex`m`f`vczcxcpdadaawea`neadp`e`r`lcrcmcvdyefcncxajcydydyczdicwepcacabsbaabdea`ezb`bbbwfw````",
+"``````cdfebdakfgezet`s`u`z`uepeg`fcpctcpcqcq`teydmczdpa`coco`b`baacm`rdicmcn`jef`majascpdjbf`o`gemfhdddfddeobibsfefw````",
+"````cjbwfsbmbmbubh`rbodhdh`iegctefcwcucucncpcpdhaj`yabco`b`a`a`a`a`lcodpcmcqczdicp`ecpcvdb`efgehambmabdxaiemcabkbqfqga``",
+"````g`blblfifhdqbcfiba`qdhcw`xfbcwefacdydacncqeacmd`co`b`af`f`f``acocrcwcq`ccxeaef`merajegbxe`a``iba`renecemdqeibrchcc``",
+"````fxbqbdaneefgecffeydu`q`i`iepcpame`awdkcpcpar`ycm`b`a`af`f`f``a`b`l`e`ccn`jasdieady`pacatahcabuai`rewecfgdlcabqbqby``",
+"````cibkaxfianfafgffaie`cycwcvefelajdbbtawcz`jaw`t`e`b`a`af`csf``a`b`ldh`w`nasap`yczdpcw`kacahbcboba`odnbhbualalc`brg```",
+"````g`bkavbvb`bceebvetewekdh`xd`dp`kaccycydocncvdacvco`b`af`f`f``a`bcralapef`fcy`w`ycz`gcw`zazdb`qe``r`rfgfcdqakcdfefn``",
+"````fnfybqanfhbebhafenew`ibadu`wdp`k`wfbapdacparczcm`c`b`b`a`a`acocraed`cucpcpdoer`ydpdp`m`mcy`xbadca`dfdfecauavfafycc``",
+"````fzfvfdaudqbgecbcenbo`iaeeueheuelatefczcncuacdncu`cco`lcr`b`b`l`lcrczcq`wdkcpdpdhfcflducweh`i`oabdcdlemeqbmaqeichfn``",
+"````cbfrfjblfcagbxbha`dnarbobnehdxfbaz`kcv`fda`een`jcn`ddvdldlaecrdraoczcq`f`y`d`ndoac`eelcydhadardv`rdlejeqavbjbbbyfu``",
+"````fxbrbqbsfifhaifbah`oddduehdgcyeoeg`gcucvajdv`t`e`hcpdmcm`d`vajeo`ddy`n`ecx`dcv`f`meu`e`g`z`g`qdcahaheyedb`fmbdcdfx``",
+"````fncdfkbdb`bmafezdn`rdedn`xdueubu`o`ycw`fdidj`hcpct`deaen`udk`j`yefelebcz`dcpd``fac`edcbnex`i`sa`aea`beemaufpbwfuch``",
+"````cjfnfteib`c`ejecaoa`ad`idbbaeuaideazdkcv`pazdp`d`d`tdyasefcucn`fdibfbfcwdoct`p`wdpeuexameh`o`sendcaialakalc`bkfecf``",
+"````ckceftaxbsaqaldlejagde`uehepepbgexeg`e`wacerbfdmdi`dasapdpcvcpcueben`tdpfcdtdpdwdtekbcfidcada`aeabagakakaqbqfwbyfz``",
+"````clg`bzfafoblemdldzdfdfecfiexbnfcdg`icvegd`eufbat`ierct`ubhat`wdydvcp`y`kacfbelegexfibgexbodxaeabaabhfcayavfdcgfzck``",
+"``````fxfwbdfdfjfceedldzamboeqbebmbebhcvducy`gdregeuegdkaccyer`eaceladdgel`x`zevazcveoezboboe``raiddaibgfdfdbvbdcjfx````",
+"``````fxcdblfafofjbgdlbcbcaufrbsfidlexeu`q`icv`g`kcwcw`gcwegcwdeeodedhfgbu`iexatdudrbnbobadddgaeffbhaoeeakbdbrbdcjfz````",
+"``````ckfzfqfabpbjcaedakemakeya`abewdjardjcydbehdwdreg`ictdbdrdebu`gcteldwabepdu`i`xdgdr`re`dveyalb`anaubzfofwfyfnck````",
+"````````g`cccfbpbjfmbiaifceeakfieddcekdg`q`s`gdgdudrdrcwcvcvcweuflembudh`udtdv`gdwendne`ekesbtedaqavflflbdblbdcdch``````",
+"````````fzcecfbpcbfiaveeaufbeebheyetewdddn`u`q`i`odb`i`gcwcvdjehdgbgepdudwep`udjbafffhagedaaedafbmdqflc`fjfncdcfcg``````",
+"````````clcffzblcdbvfobsaldlbsecabddaf`odne`esbadgdr`x`o`ocwdudbdgekehbaaeeqdj`rdga`ffafbheoaadlcaftbdfmbkfzfkfxgb``````",
+"``````````fxcbfkfsc`frbmeibic`bedlabdzdcaeareyfiardvdnduaddge`dg`sduehboa`eje``r`rendleoaiaaaiakavfifnftfkfkcecj````````",
+"``````````gbfxfnfebpeibveiakflanfgejafdldxetbob`ardvdedv`o`oabene`dxekbnboaodfaebebibca`eqeqakdqeebsfqfvfwfwfxcl````````",
+"````````````clfxcdfkbwfwanbjavflfaafeya`agafeyddarah`se`aedeababdxenaoewdn`samdldsbcafejaibgdqalaqc`fqbrg`ceci``````````",
+"``````````````fxfubybkfsfjanayaubibubxdldsaidzaodfabafaoe`a`dddxe`fbewe`aea`anbcaodzagdqeedqaqeiaxftbwfwcech````````````",
+"``````````````gbfucgbzfebybpeieeaqfhdqeeakeqaiemdsdzeoaidcezecbhaidzeoemafecb`aaakagaqayaqb`blbkbdblfkcffzgb````````````",
+"````````````````gbcgfxbyfefjaxeieeayfiflfrbjeebxfcdsbxezagbxbcememeyaobhaubcbeakedaqalb`eiblavfrchccfzfzcj``````````````",
+"``````````````````clcgcjccbwaxavfaaqeeeib`fiblaybiemfgfhblblbdfcfhembeemdlbbdqaueianfableibdfrfvcbcccccj````````````````",
+"````````````````````gbfubzfnbrbkbpc`fpbpbvfjcafhakayavakflbmakbdbidqeefccabiakavbvfrbqblblfefqcbbzfxcj``````````````````",
+"``````````````````````gbcgcgg`fwfefvbkbdaxfmanfpalaycafaaudqalfob`bifmaxaqaneibdfrbqbkbkfeccbybyfxck````````````````````",
+"````````````````````````clcgcgfnfwfqfvfabwc`bqeiblbsfeavbvbsfrbvanbbfabzeiblc`bwbwbpfafeccg`fxfxcl``````````````````````",
+"``````````````````````````gbckchcfccbrbyfkbdfjbkfabpbrfkcdbveiaxaxbbfafdbwfefvfvfwbrfefkcffzcgcl````````````````````````",
+"``````````````````````````````gagafzcbfnbrfkfkfyfybzfebkbdbdfefefvbkfubzfnfnbzfebrfqfxfxcgck````````````````````````````",
+"````````````````````````````````gbclckfxfnbyfnfwfwbzfqfkfqcdfnfqchfucgbrccfnfwfncccjcgcjgb``````````````````````````````",
+"````````````````````````````````````clclcjcjcjckgaccfxcdcdcecicfcgfzcgcefufncefzckclgb``````````````````````````````````",
+"``````````````````````````````````````````clgacjcjcgcjcjcjgachcjfzcgfzfxfzckgacl````````````````````````````````````````",
+"````````````````````````````````````````````````clgbclckckcjcigackgaclgbgb``````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade11[] = {
+/* width height ncolors chars_per_pixel */
+"72 72 192 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #139713",
+"`k c #149514",
+"`l c #1A8B1A",
+"`m c #159315",
+"`n c #129312",
+"`o c #158B15",
+"`p c #128D12",
+"`q c #148914",
+"`r c #158715",
+"`s c #148514",
+"`t c #0F890F",
+"`u c #128312",
+"`v c #0F870F",
+"`w c #0E850E",
+"`x c #108110",
+"`y c #0D830D",
+"`z c #0F7F0F",
+"a` c #127912",
+"aa c #137513",
+"ab c #107710",
+"ac c #0C7D0C",
+"ad c #0E750E",
+"ae c #0F730F",
+"af c #0F6F0F",
+"ag c #0F6D0F",
+"ah c #0E6B0E",
+"ai c #0E690E",
+"aj c #077307",
+"ak c #0F650F",
+"al c #0E630E",
+"am c #0B630B",
+"an c #0D5B0D",
+"ao c #0A5F0A",
+"ap c #036703",
+"aq c #0B570B",
+"ar c #075D07",
+"as c #026502",
+"at c #046104",
+"au c #0A550A",
+"av c #0B530B",
+"aw c #016101",
+"ax c #0C4F0C",
+"ay c #0A510A",
+"az c #025B02",
+"b` c #094F09",
+"ba c #045704",
+"bb c #0A4D0A",
+"bc c #065306",
+"bd c #0A4B0A",
+"be c #065106",
+"bf c #015901",
+"bg c #074D07",
+"bh c #054F05",
+"bi c #074B07",
+"bj c #084908",
+"bk c #094709",
+"bl c #084508",
+"bm c #064706",
+"bn c #014F01",
+"bo c #004B00",
+"bp c #063D06",
+"bq c #063B06",
+"br c #073907",
+"bs c #033D03",
+"bt c #004100",
+"bu c #013F01",
+"bv c #033B03",
+"bw c #053505",
+"bx c #003D00",
+"by c #063306",
+"bz c #053105",
+"c` c #023502",
+"ca c #003700",
+"cb c #042B04",
+"cc c #042904",
+"cd c #012301",
+"ce c #022102",
+"cf c #011D01",
+"cg c #021B02",
+"ch c #011901",
+"ci c #011701",
+"cj c #011501",
+"ck c #011301",
+"cl c #010D01",
+"cm c #21B621",
+"cn c #1CB41C",
+"co c #22AA22",
+"cp c #1AAC1A",
+"cq c #18A818",
+"cr c #1F9C1F",
+"cs c white",
+"ct c #18A418",
+"cu c #17A217",
+"cv c #189E18",
+"cw c #189A18",
+"cx c #149C14",
+"cy c #149014",
+"cz c #119011",
+"d` c #128A12",
+"da c #0F8C0F",
+"db c #128612",
+"dc c #148214",
+"dd c #138013",
+"de c #127E12",
+"df c #127C12",
+"dg c #107C10",
+"dh c #0F7A0F",
+"di c #0B800B",
+"dj c #0E780E",
+"dk c #0B7C0B",
+"dl c #117211",
+"dm c #0A7A0A",
+"dn c #0E720E",
+"do c #0A780A",
+"dp c #0A760A",
+"dq c #106A10",
+"dr c #0B720B",
+"ds c #0F6A0F",
+"dt c #0A700A",
+"du c #0A6E0A",
+"dv c #0B6C0B",
+"dw c #0A6A0A",
+"dx c #0B680B",
+"dy c #067006",
+"dz c #0C660C",
+"e` c #0A660A",
+"ea c #056E05",
+"eb c #056C05",
+"ec c #0B620B",
+"ed c #0C600C",
+"ee c #0D5E0D",
+"ef c #056A05",
+"eg c #066806",
+"eh c #076407",
+"ei c #0D580D",
+"ej c #0A5C0A",
+"ek c #076007",
+"el c #046404",
+"em c #0A5A0A",
+"en c #075A07",
+"eo c #085808",
+"ep c #045E04",
+"eq c #095409",
+"er c #015E01",
+"es c #055605",
+"et c #055405",
+"eu c #015601",
+"ev c #015401",
+"ew c #035003",
+"ex c #015201",
+"ey c #034C03",
+"ez c #034A03",
+"f` c #B1FFB1",
+"fa c #074207",
+"fb c #034803",
+"fc c #044604",
+"fd c #074007",
+"fe c #083E08",
+"ff c #014601",
+"fg c #024402",
+"fh c #034203",
+"fi c #044004",
+"fj c #053805",
+"fk c #063606",
+"fl c #013A01",
+"fm c #023802",
+"fn c #052E05",
+"fo c #013401",
+"fp c #013201",
+"fq c #042C04",
+"fr c #013001",
+"fs c #012E01",
+"ft c #012C01",
+"fu c #042604",
+"fv c #012A01",
+"fw c #022802",
+"fx c #042404",
+"fy c #002600",
+"fz c #022002",
+"g` c #011E01",
+"ga c #001000",
+"gb c #000A00",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````brfebwfabdfafvbwbqfqbr````````````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````feblaxfnfofjbkfaaqeibmfiavblavblbdbwfk````````````````````````````````````````````````````",
+"````````````````````````````````````````````````fnfrftfpbjalavfcdqfjbmakedagafakbmfcaqbsfyanavaxbz``````````````````````````````````````````````",
+"````````````````````````````````````````````ftbqfmbjanakalaldldlaaafemaqbtfbafagdlfhflbufvalbpfwc`frft``````````````````````````````````````````",
+"````````````````````````````````````````fvbdbdbmalfyb`bhfgdqaianeydzesa`bsbvdlbheyesddafbjezaufhcaakbwbbbl``````````````````````````````````````",
+"````````````````````````````````````cebkanalbgbmedfbfsfbbeah`rdcdf`samdlbncaewbofh`raraeaeaveoejfdfcbmavanfkcb``````````````````````````````````",
+"``````````````````````````````````bravayfcbialaaeoa`eyesecdvdedxdnen`oedfcaieobedle`ekabarambjemfmbifbdqdqanfabz````````````````````````````````",
+"``````````````````````````````fwfaaxfmeefyejemaoamenewardv`qcydbdbadafafepexemfhex`oca`oenad`odndcddddaaafdqeefafvfk````````````````````````````",
+"````````````````````````````fqftayfidqb`eoecetarde`i`i`g`o`u`idb`idpdgdgdzejexatepafeudfbhddevdnabaoc`anbcfgbubdaycdfk``````````````````````````",
+"``````````````````````````fkbdcabldqaiafece`dg`idrad`q`uegdr`id``xegad`qategfgfh`ieudtdu`gflaoahewbafi`sftaybxbubbfifqfy````````````````````````",
+"````````````````````````brbdbsaueqdlfiaeddaedg`i`o`x`o`mdudpcwcwcyege``xdodperdnbfegelegevbfbnejaobibaekfffffgeyfhanbvfjfv``````````````````````",
+"``````````````````````fefacaakeqalaudcah`r`idg`q`xdudrcv`m`e`tdk`k`ed`erarcyeneabfameudteg`wdbdbdudeedevaoewfibtbxfleeavaxfe````````````````````",
+"````````````````````ccblfadqaqeoeedcecewbofoa`ddbiegac`ecpcydpbfatap`yctcpdkefdp`dbce`ategeg`v`i`iduekbaaien`rbiauejbgfab`fjfn``````````````````",
+"``````````````````ccbkavfiembeaiaedfbnbndtdu`zdoeueldpcw`n`h`xeren`z`derelda`ddkd`erbx`y`pacac`gctdjepfcafba`saqffecaabgfvbqbwci````````````````",
+"``````````````````fxeifmakbxalbtahffbodj`u`xcycyazbfebdpajapdgaodhapcnaddvapcpcucnasaodk`k`pcycp`kctdtbffhfobnfretendlafbmfefwbr````````````````",
+"````````````````fwblfoanakdzeyaoekboemeudjcyct`gdycwebacdmacdpcn`uascwekdrajcpczdy`edxd``wct`dd`dk`gctdhdeaedlba`oaibtdldqakbkfvfy``````````````",
+"``````````````ccfyfdeiemaabhejekdudgexatcycv`gd`eldpcv`jcpcqcudidyawe``uardmczcp`f`wesdhcn`nczegdodtcw`wdjexbebabnflfraoagedakbzfjfn````````````",
+"``````````````fefdbmaldlbhbtfme`dgdjbidrcy`mdo`ibf`n`dcncn`daj`z`eetd`ezapdmajeadkcndadi`w`e`tbferaj`wcwd`dubafcdc`rdvaoaieqdqbbfdfe````````````",
+"````````````cebzblayakdsbcbcboardhdjexd`docvfger`h`dcncpcn`fas`kapasaw`p`dehapasawad`w`d`d`f`tap`ecpajdk`mdj`zbaendgabdedlbcdqanayblg```````````",
+"````````````brbpavauedamdzeye``oadepadatcweb`pcu`f`hcq`fcm`yeydjcue`cvas`m`ycucncxdoawasea`wapad`ueycyesdrcwcw`o`q`iesdxafecauananfafe``````````",
+"``````````cfbwfjeebmbeeoagff`se`ehexep`sdpcy`dcxerajdmdacpeaeyapead``ddacxcq`c`c`j`yasdrasd`ffdv`ddjer`oendp`z`xadddboaiesdlafdqanbdfece````````",
+"``````````fefaanfceqeoaiaia``odrehegdxafac`f`ddp`qdoeacpcueaefcxcpcqcxcp`c`d`ccu`j`jcyewdvenffdrbtaoeldybfeyepegbabaembseya`ememakavaxfq````````",
+"````````fzccbzeeeqeebhbtfcba`rcyd`djbieucy`ecvajapdo`f`ndabtdicx`ccn`jcqcncn`ccn`w`wdr`fcmd``udyebdobfajeffccvepeuepbobnendcejemalavfdcech``````",
+"````````fnfabdanakbefgbteybadhdh`x`geueu`tcu`e`hdkcp`dcudyasdacxcu`c`j`p`fcp`ccmcqebaseaajeaad`wajcx`kdodmahaz`odzbnboehdnabahecdqbmbkfvfz``````",
+"````````ccbdfaaledfbaqdcbnbna`bueoegct`pcy`y`fcpcq`f`hczenaj`tdida`d`i`r`r`e`ccm`feb`k`ncqdaaraserdoda`ydyddeladeccafoe`a`dddfedbmdqeifdfn``````",
+"``````fxfvfrfaakbmfbauezfmboekdrepeodr`ecv`hcxctcncudiea`mdm`fdicmcrcrcr`bcrcr`r`z`rea`dcncxdo`eapebaj`yazeyelamde`ibiboa``ra`dlflbiaybqfyg`````",
+"``````fxfac`bbakbxfbbheneodedb`z`zexbfd`cv`ectcncncqcueaasaj`wdj`bcoco`bcr`a`a`l`raadicm`ccnczaw`zapapctdveoazfgeuafeoejdgabaea`bmfcbzfqfvch````",
+"``````cbbqbjfib`bubiejbmetdv`zdjcvepcyeaacct`d`ncncncndmareaaca`cr`b`a`a`a`a`bcr`leiaccmcpcqdidk`ednbfey`eeueubuatepezaiabaedzembgfpbdbrfvcd````",
+"``````fnbweifibgbufaeyagba`q`u`icwdrfbdjerdy`tajdacmcqcxawapd`co`b`a`af`f`f``a`bcrcocwcu`ccn`yefefcucnerdyegbxahfhem`iev`rendzemfbbkeiblccfw````",
+"````cgg`bdbdalb`ezfgamffewdh`i`g`od`euazbeafbfapdicqcn`wbh`wcm`b`b`af`f`csf`f``a`b`bcocn`ccp`tcndmapajdy`wdpazfl`ubueoae`sesecaobheeeifrbqfyck``",
+"````fzbybkanbmeeflbtejffewen`gcw`i`idpelbfe`ad`meaczcmeaaj`jco`b`a`af`f`f`f`f``a`acrdbcvcpczdyasdi`ydy`tcv`pdpflbhexddekdddxeoemeqeqaufwaxfecg``",
+"````cgbrfjanbseqbuftftemffendu`ucw`o`zebacd`efcpenajcqdyaj`pcv`c`a`af`f`f`f``a`a`ldq`celawardhefdk`k`f`k`md`dudcbnehenardc`sbhfgejaleefaaxfqfx``",
+"````cgbzftbdfobdembeaieqekbaexdjepdhcyacd``edpbt`mdm`najdo`j`eco`b`b`a`af``a`a`bcocrdudy`naccpd``wdo`h`gcvcvdpegdhdb`ie`dddcaheyfcakaqfdfjfqch``",
+"````g`cbfqfwfmbueqbcbhfaenaragbobaduacdudk`kelardydacx`j`p`hcm`c`b`bco`a`a`a`b`b`ldj`p`ncq`f`j`ycydpdpazeg`pcw`g`zbnekdcdeabdlagakayavayfafefz``",
+"````ccbzftbpauakaueyaoeyenewboam`iepehbfeuegafdycz`dcu`najascu`c`ccr`lcr`b`bcr`lcrducz`fcxdi`tcndp`dbxenecdocwduepa`badddcaiaiagfhfhaqanfkfecc``",
+"````fxbrfrfdbdbiakbcbcetabafbaboageuepdzeodnat`h`hcu`kdias`q`ncn`cdbafa`aa`ccobdegeb`n`fcpdmcz`d`jdpaceadnegcvdhduekesdx`sabaiecfcbkavaxfkfqfx``",
+"````cibzftfdfofibiafa`eydd`rdvdvepepdu`iev`odk`e`e`ncxefaodk`hctcucvegcmegdbdw`o`idwajczcq`kcp`dcv`n`vcyezazehcy`qdb`uaddxaheoaub`bsfmbkbzbyfx``",
+"````cjfqbrc`fabmbseebhfgaodc`sdhdv`zdhbf`iazel`e`e`d`perdmctcp`hcpctdpcmejdk`pdycnelapdi`hcp`e`dcvcv`pdtdxamfbex`q`oddaeafafeoemalbmbvfrbwfkci``",
+"````gaccfwfneibjfcauamfgag`rad`o`odjdwbfezdbbfac`k`k`e`ycwcu`dcpctcz`dfgdbdp`n`ndaapefcvapcpcpcp`pcw`vdpen`gdc`r`o`s`oahaga`aieqakeiavfrfwbrcj``",
+"````gag`fefeaxaybmfcaiecaoa`a``o`idebabaeqdgeobfdp`k`fdpffdicvcp`yapdpaseacu`d`ecxajctercvcv`y`e`v`xdodw`i`oejba`s`sabamdfaidlakdqb`bvaxcebzga``",
+"``````fzfnaxaxb`cdbxema`ejaeab`rdnekepepaheuepat`edk`felcweldm`yer`uefefdp`jcn`dczapendi`tbfdh`zdpatdudtcwdnfieoen`rabdfabdlageealbjbqfrcfce````",
+"``````fufeg`fafacafieeaaecdedc`rbo`rbabnah`gexazafep`eegbfflebaterbfcwbfeneldi`kaze`cv`y`n`pepbhdududwbu`sbgevdden`saba`a`ecbgbgayanfdfycjg`````",
+"``````cgbyfeaxfdbqblbgdlaaama`dfafafedbgflcafcaiat`xcwaceg`gfgctatatazcwerbhdkacbfdbcyegd`cyegbxfbaeflbebuboboewdxdeaeaidlbicafjbmblaxfwg`cg````",
+"``````clfxbyfjbdfmfyfhalafeoenbtb`ffbgfmfobmexba`z`icv`vdodod``mdk`vdpateuddeleuerejafadazdoduexehekbndfdebodvafdeahbcafalalakbbavfsbdccfuga````",
+"````````fucbfnaxaxcabdfcdleoeoa`bmb`fofodlbababadgcv`gcycycvd`ac`ect`gdt`e`qbcdvae`iamcyemfh`regdr`ue`arbadw`r`ra`fbfbfcakalakcabqbdbkfxcf``````",
+"````````fxcbfnc`bbfpbscaemdsalbtfgffddagboe`duekdg`gcwdhepdwdrep`pcv`ed`doexeoaoeufbegdreheodudrcyad`o`sdg`ramaobhbpb`bbaqaqfwfrbrcfbrfqfz``````",
+"````````cichccfkaxfsavfdbidlbcbxdsb`fieddcbodnde`q`z`idbaddrdrdrcycvcwcvcwatbufgecemdhdbdre``x`odwexdve`afenesfaemeyc`faflbsbjeifvfecdccga``````",
+"``````````cgcdfkbkbkfrbsanaleeezdqbteyeyewffe`deab`s`icwdb`xdh`i`icwcvcwdhdr`ueqbeekduehe`ducyehen`oeyb`ewfmaybhaaeoakcacafveibvbyfncfch````````",
+"``````````ckcig`fefrccbsalfidqfgdqaqeoaiafaoaf`rdnehdvdwdj`qdhdbcw`i`g`gdjdrdrbabaepexaieqex`udedvewa`bsc`fgbhdldlaibpflfrfmfjbkg`brgacg````````",
+"````````````fzcdfeblg`bvfrbsbieqflb`ema`dfabdcdcahamarbsaiepdwdjdg`u`i`odr`q`o`xe`ehexahafen`o`o`saoaabmeyejaoafafeqfcbseic`fvbyfncccg``````````",
+"````````````gafubybrbrfjc`caayakbgfrfbaiaadlecdcafenboafffbaekduekdv`s`udvehadadeke`bodlfhesab`rdeetagbhecaaakejeeanb`fpfrbdfsbkbrfzcg``````````",
+"``````````````fxcefqfebqfvaveiaqaleeauavfbaidla`dzeneyfiffendx`rdnab`q`idharekdndnenenewecdn`recbtbjbhdfaieqaualdqakaqfmfqfebzfqcjfz````````````",
+"``````````````cjchfxbzfjbwblbjavbgb`fleebjdqemdeagaebca`ffarah`sdne`dea`abdedvamararewafdeaeeobvdsbhaaamemakbgeeeialavftfqbzfwchcjga````````````",
+"````````````````cifubybybdfsfteieibjb`bsfhfyezafdsedemejamdlababdxecaedf`rahafar`rbhecafaedzbmeybcaadldldldqakakaneifdfvfqfkcffxcg``````````````",
+"``````````````````fxcccdfefefwfjeieialaqb`avbgdldlafaaagafdeafaoafamaresameyesafbceoaoamagbheyaaaidsalemauakeibmbjblfabqfefzcecj````````````````",
+"``````````````````gbcegaccfefvcdfaeianavanflbqcafhbueqbgeyemaibcbhfgfmdeaoaiaiamaiedbcejemfabeakededdqaqbvaqbjaxbdfjfjfkcecccgcl````````````````",
+"````````````````````clfzfxfwfefvfaavavbkavauavfidqbxfabkc`ejembgfbafc`bteybhfbdlbcecfbakejbqdlananayb`alb`eifaaxbwfyfycig`fxcj``````````````````",
+"``````````````````````clcjfzfwbzfkbdaxfdbkayeeavayfob`bqbpeeejfcbufhfabxbqbxbueqemb`eddqalauemaueianbsbdfaaxaxbzfvcbfnfnfuci````````````````````",
+"````````````````````````gbcgfzfkfebrbkfabqfrc`fibvbdfofibiakaydqbqfcbxbiakfsfheqakaqfcflfhanakb`bvfrbyfmaxbkfecdfqbyccfxcj``````````````````````",
+"``````````````````````````ckcjcccifqcbfwfjfvfrc`g`bvfdfrbsakbgfmfjfheedqdqfhfldqb`bvcdbianeeanblblfofdbdfdfefzbybycccgcl````````````````````````",
+"````````````````````````````clfxcicccefnfwchfrfrftc`blfmeiavblbsfvbsbbayfabdfaanavbseebjbsblfabdaxaxblbkfeccfucffxfzgb``````````````````````````",
+"``````````````````````````````gbcicicbfqcdbyblbqbdfdfebdavfofrbdaxfrfwbzaxblaneiaxfafrfjfsftfrfvfvbwfefeccfzccfxcgcl````````````````````````````",
+"``````````````````````````````````gackcgcgfxbrbybrfafkbwbqaxaxfabrfwfpbdbkbqbkbkblbqfafvcffyfyfnbyfkfececfcjfzcj````````````````````````````````",
+"````````````````````````````````````gbgacjfxbyccbzfebzfvccfvfwbqbkblbqblbqbqfsfkfybrbzfwfyfqbrfebrfucjchcgcjcl``````````````````````````````````",
+"````````````````````````````````````````clgbcgfxfnbyfqfqfwccbzcbbybyfyfwfnbzbzcfchfxbrfwbzcdfncccccjcjcjcl``````````````````````````````````````",
+"````````````````````````````````````````````clcifzcichckcgcbccfuccfwcbg`cecfbrfncefzfubybzcbchchgagacl``````````````````````````````````````````",
+"````````````````````````````````````````````````gbclcgchckfxcjchchcccifxckgachcicjchfzfufxcjgaclgb``````````````````````````````````````````````",
+"``````````````````````````````````````````````````````clclckcggacicicjcgcgcjcgcgcgcgckcjclgb````````````````````````````````````````````````````",
+"``````````````````````````````````````````````````````````````clgbgbgbgbgbclgbgbclgb````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade2[] = {
+/* width height ncolors chars_per_pixel */
+"12 12 76 2",
+/* colors */
+"`` c None",
+"`a c #35CB35",
+"`b c #1AA71A",
+"`c c #158B15",
+"`d c #148914",
+"`e c #158715",
+"`f c #137513",
+"`g c #107710",
+"`h c #0F6D0F",
+"`i c #0E6B0E",
+"`j c #0E690E",
+"`k c #0F650F",
+"`l c #0E630E",
+"`m c #0A5F0A",
+"`n c #036703",
+"`o c #0B570B",
+"`p c #075D07",
+"`q c #0A550A",
+"`r c #0C4F0C",
+"`s c #0A510A",
+"`t c #045704",
+"`u c #065106",
+"`v c #074D07",
+"`w c #074B07",
+"`x c #094709",
+"`y c #063B06",
+"`z c #073907",
+"a` c #033D03",
+"aa c #033B03",
+"ab c #053505",
+"ac c #003D00",
+"ad c #053105",
+"ae c #003700",
+"af c #042904",
+"ag c #012301",
+"ah c #011501",
+"ai c #1CB41C",
+"aj c #17A217",
+"ak c #189E18",
+"al c #189A18",
+"am c #119011",
+"an c #128A12",
+"ao c #0F8C0F",
+"ap c #148214",
+"aq c #138013",
+"ar c #0F7A0F",
+"as c #0B800B",
+"at c #0A7A0A",
+"au c #0A780A",
+"av c #0A760A",
+"aw c #0B720B",
+"ax c #0F6A0F",
+"ay c #0A6A0A",
+"az c #056C05",
+"b` c #056A05",
+"ba c #076407",
+"bb c #0D580D",
+"bc c #0A5C0A",
+"bd c #046404",
+"be c #075A07",
+"bf c #045E04",
+"bg c #055605",
+"bh c #035003",
+"bi c #015201",
+"bj c #B1FFB1",
+"bk c #034803",
+"bl c #044604",
+"bm c #074007",
+"bn c #083E08",
+"bo c #024402",
+"bp c #044004",
+"bq c #013A01",
+"br c #052E05",
+"bs c #042C04",
+"bt c #012A01",
+"bu c #000A00",
+/* pixels */
+"`````````l`ja`aqae``````",
+"`````zbp`calaubd`mbobt``",
+"`````fbibdaj`pbgau`u`h``",
+"``adbl`w`nasaiawazakbebm",
+"``bp`tbkaoanbjalb`ac`ebb",
+"```qbebaamaj`aamavalap`o",
+"```rbcbf`batavbeavbp`g`y",
+"``af`wbp`dawalaraybgbqag",
+"````abbq`h`i`gbhax`vbs``",
+"````bu`xaa`s`kblaabnah``",
+"````````bradbr`zaf``````",
+"````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade3[] = {
+/* width height ncolors chars_per_pixel */
+"14 14 93 2",
+/* colors */
+"`` c None",
+"`a c #35CB35",
+"`b c #1CB11C",
+"`c c #1AA71A",
+"`d c #169D16",
+"`e c #179717",
+"`f c #179317",
+"`g c #158B15",
+"`h c #148914",
+"`i c #158715",
+"`j c #0F890F",
+"`k c #128312",
+"`l c #0D830D",
+"`m c #127912",
+"`n c #137513",
+"`o c #0C7D0C",
+"`p c #0E750E",
+"`q c #0F730F",
+"`r c #0F6F0F",
+"`s c #0F6D0F",
+"`t c #0E6B0E",
+"`u c #077307",
+"`v c #0E630E",
+"`w c #0B630B",
+"`x c #0A5F0A",
+"`y c #0A550A",
+"`z c #0B530B",
+"a` c #0C4F0C",
+"aa c #094F09",
+"ab c #045704",
+"ac c #0A4D0A",
+"ad c #065306",
+"ae c #0A4B0A",
+"af c #065106",
+"ag c #015901",
+"ah c #054F05",
+"ai c #074B07",
+"aj c #084908",
+"ak c #084508",
+"al c #064706",
+"am c #073907",
+"an c #033D03",
+"ao c #053505",
+"ap c #063306",
+"aq c #042B04",
+"ar c #042904",
+"as c #011D01",
+"at c #011901",
+"au c #21B621",
+"av c #1CB41C",
+"aw c white",
+"ax c #18A418",
+"ay c #189A18",
+"az c #149C14",
+"b` c #149014",
+"ba c #0F8C0F",
+"bb c #128612",
+"bc c #148214",
+"bd c #138013",
+"be c #107C10",
+"bf c #0A760A",
+"bg c #0F6A0F",
+"bh c #0A6A0A",
+"bi c #0C660C",
+"bj c #0A660A",
+"bk c #0B620B",
+"bl c #0C600C",
+"bm c #056A05",
+"bn c #066806",
+"bo c #076407",
+"bp c #0D580D",
+"bq c #0A5C0A",
+"br c #076007",
+"bs c #046404",
+"bt c #0A5A0A",
+"bu c #075A07",
+"bv c #095409",
+"bw c #035003",
+"bx c #034C03",
+"by c #074207",
+"bz c #034803",
+"c` c #044604",
+"ca c #074007",
+"cb c #083E08",
+"cc c #024402",
+"cd c #053805",
+"ce c #023802",
+"cf c #012E01",
+"cg c #042604",
+"ch c #022802",
+"ci c #042404",
+"cj c #022002",
+"ck c #011E01",
+/* pixels */
+"``````````aa`rbdahbp````````",
+"``````akbi`gay`hal`qbgce````",
+"````aebu`kbnayah`c`o`xahcf``",
+"`````sb`cc`bbj`eaubmbfbbai``",
+"``ambd`q`o`dba`f`cbxbfbkbcae",
+"``aebk`fbeav`aawbc`j`obqadae",
+"``ca`wbvbsaxau`abfazcc`t`mbp",
+"``a``s`f`xax`d`ubm`lbo`i`nae",
+"``aqaaajab`ebhagbzagbwafc`cb",
+"````cjai`rbj`pbhbr`gafblam``",
+"````asaoanbtadbiad`v`yaecg``",
+"``````cichcdby`zceacaeci````",
+"``````````arcgckapat````````",
+"````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade4[] = {
+/* width height ncolors chars_per_pixel */
+"20 20 143 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #1A8B1A",
+"`k c #158B15",
+"`l c #148914",
+"`m c #158715",
+"`n c #148514",
+"`o c #0F890F",
+"`p c #128312",
+"`q c #0E850E",
+"`r c #0D830D",
+"`s c #0F7F0F",
+"`t c #127912",
+"`u c #107710",
+"`v c #0C7D0C",
+"`w c #0E750E",
+"`x c #0F730F",
+"`y c #0F6F0F",
+"`z c #0E6B0E",
+"a` c #077307",
+"aa c #0F650F",
+"ab c #0E630E",
+"ac c #0B630B",
+"ad c #0D5B0D",
+"ae c #036703",
+"af c #0B570B",
+"ag c #075D07",
+"ah c #026502",
+"ai c #046104",
+"aj c #0A550A",
+"ak c #0B530B",
+"al c #016101",
+"am c #094F09",
+"an c #065306",
+"ao c #0A4B0A",
+"ap c #065106",
+"aq c #074D07",
+"ar c #054F05",
+"as c #074B07",
+"at c #084908",
+"au c #094709",
+"av c #084508",
+"aw c #064706",
+"ax c #014F01",
+"ay c #004B00",
+"az c #063B06",
+"b` c #073907",
+"ba c #004100",
+"bb c #013F01",
+"bc c #033B03",
+"bd c #053505",
+"be c #003700",
+"bf c #042B04",
+"bg c #042904",
+"bh c #012301",
+"bi c #022102",
+"bj c #021B02",
+"bk c #011901",
+"bl c #011701",
+"bm c #011501",
+"bn c #011301",
+"bo c #010D01",
+"bp c #21B621",
+"bq c #1CB41C",
+"br c #22AA22",
+"bs c #1AAC1A",
+"bt c #18A818",
+"bu c white",
+"bv c #18A418",
+"bw c #17A217",
+"bx c #189E18",
+"by c #189A18",
+"bz c #149014",
+"c` c #119011",
+"ca c #128A12",
+"cb c #128612",
+"cc c #127E12",
+"cd c #127C12",
+"ce c #107C10",
+"cf c #0F7A0F",
+"cg c #0B800B",
+"ch c #0E780E",
+"ci c #0B7C0B",
+"cj c #117211",
+"ck c #0A7A0A",
+"cl c #0E720E",
+"cm c #0A760A",
+"cn c #106A10",
+"co c #0B720B",
+"cp c #0F6A0F",
+"cq c #0A6E0A",
+"cr c #0B6C0B",
+"cs c #0A6A0A",
+"ct c #0B680B",
+"cu c #067006",
+"cv c #0A660A",
+"cw c #056C05",
+"cx c #0B620B",
+"cy c #0D5E0D",
+"cz c #056A05",
+"d` c #066806",
+"da c #076407",
+"db c #0D580D",
+"dc c #076007",
+"dd c #0A5A0A",
+"de c #075A07",
+"df c #085808",
+"dg c #045E04",
+"dh c #015E01",
+"di c #055605",
+"dj c #015201",
+"dk c #034C03",
+"dl c #034A03",
+"dm c #074207",
+"dn c #034803",
+"do c #044604",
+"dp c #083E08",
+"dq c #014601",
+"dr c #044004",
+"ds c #053805",
+"dt c #063606",
+"du c #013A01",
+"dv c #023802",
+"dw c #052E05",
+"dx c #013401",
+"dy c #042C04",
+"dz c #013001",
+"e` c #042604",
+"ea c #012A01",
+"eb c #022802",
+"ec c #042404",
+"ed c #002600",
+"ee c #022002",
+"ef c #011E01",
+"eg c #001000",
+/* pixels */
+"``````````````dwdmdzbbaoauds````````````",
+"``````````dpasba`zce`ncd`yddasdt````````",
+"````````azcpcr`wcm`sbycldc`x`maadm``````",
+"``````aucxcr`ncmbxcb`halcmbzdgdecpaz````",
+"````dpcydzdjbwci`dcuagbvcrcz`eapascybh``",
+"````dwan`ldj`o`rcg`hcgbqahdidhbzdc`tdb``",
+"``bicyabcod``fbpcabqbw`cckcuc`bxax`tdbbk",
+"``bdaw`mcfbvbwbsa`br`a`jbpcgbs`eacctbedy",
+"``auaddqbzczcbc``o`abu`b`qaecm`vayclabb`",
+"``eacnan`idaaibqclbr`b`jbtbsdoby`kcjawbk",
+"``bhamdlcccq`k`f`h`d`p`rcwbs`vax`n`taje`",
+"``efdxcjcddjced`dndharcu`rdndjdj`xarakee",
+"``bndmbedd`tchbzcs`ico`gcscqcecvabajebbn",
+"````eebcabcx`ycvce`kcqdc`x`mdqdfbedvdt``",
+"````bodtaddudk`yagcv`udeclcj`yaqafb`bl``",
+"``````bjdpdbdratdodlandkajaaabavbkee````",
+"````````bjebaudvabdmabasafaoaubgec``````",
+"``````````egbfdtedaudpaudwdpecbn````````",
+"``````````````bobmbmbkbjeebo````````````",
+"````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade5[] = {
+/* width height ncolors chars_per_pixel */
+"24 24 169 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #149914",
+"`h c #179317",
+"`i c #139713",
+"`j c #149514",
+"`k c #1A8B1A",
+"`l c #159315",
+"`m c #129312",
+"`n c #158B15",
+"`o c #148914",
+"`p c #158715",
+"`q c #148514",
+"`r c #128312",
+"`s c #0F870F",
+"`t c #0E850E",
+"`u c #108110",
+"`v c #0D830D",
+"`w c #0F7F0F",
+"`x c #127912",
+"`y c #137513",
+"`z c #107710",
+"a` c #0C7D0C",
+"aa c #0E750E",
+"ab c #0F730F",
+"ac c #0F6F0F",
+"ad c #0F6D0F",
+"ae c #0E6B0E",
+"af c #0E690E",
+"ag c #077307",
+"ah c #0F650F",
+"ai c #0E630E",
+"aj c #0B630B",
+"ak c #0D5B0D",
+"al c #0A5F0A",
+"am c #036703",
+"an c #0B570B",
+"ao c #075D07",
+"ap c #0A550A",
+"aq c #0B530B",
+"ar c #016101",
+"as c #0C4F0C",
+"at c #0A510A",
+"au c #025B02",
+"av c #045704",
+"aw c #0A4D0A",
+"ax c #065306",
+"ay c #0A4B0A",
+"az c #065106",
+"b` c #015901",
+"ba c #074D07",
+"bb c #054F05",
+"bc c #074B07",
+"bd c #084908",
+"be c #094709",
+"bf c #084508",
+"bg c #064706",
+"bh c #014F01",
+"bi c #004B00",
+"bj c #063B06",
+"bk c #073907",
+"bl c #033D03",
+"bm c #004100",
+"bn c #033B03",
+"bo c #053505",
+"bp c #003D00",
+"bq c #063306",
+"br c #053105",
+"bs c #003700",
+"bt c #042B04",
+"bu c #042904",
+"bv c #012301",
+"bw c #022102",
+"bx c #011D01",
+"by c #021B02",
+"bz c #011901",
+"c` c #011701",
+"ca c #011501",
+"cb c #011301",
+"cc c #010D01",
+"cd c #1CB41C",
+"ce c #1AAC1A",
+"cf c #1F9C1F",
+"cg c #18A418",
+"ch c #17A217",
+"ci c #189E18",
+"cj c #189A18",
+"ck c #149C14",
+"cl c #149014",
+"cm c #119011",
+"cn c #128A12",
+"co c #0F8C0F",
+"cp c #128612",
+"cq c #148214",
+"cr c #138013",
+"cs c #127C12",
+"ct c #0F7A0F",
+"cu c #0B800B",
+"cv c #0B7C0B",
+"cw c #117211",
+"cx c #0A7A0A",
+"cy c #0E720E",
+"cz c #0A780A",
+"d` c #0A760A",
+"da c #106A10",
+"db c #0B720B",
+"dc c #0F6A0F",
+"dd c #0A700A",
+"de c #0A6E0A",
+"df c #0B6C0B",
+"dg c #0A6A0A",
+"dh c #067006",
+"di c #0C660C",
+"dj c #0A660A",
+"dk c #056E05",
+"dl c #056C05",
+"dm c #0B620B",
+"dn c #0C600C",
+"do c #0D5E0D",
+"dp c #056A05",
+"dq c #066806",
+"dr c #076407",
+"ds c #0D580D",
+"dt c #0A5C0A",
+"du c #076007",
+"dv c #046404",
+"dw c #0A5A0A",
+"dx c #075A07",
+"dy c #045E04",
+"dz c #095409",
+"e` c #015E01",
+"ea c #055605",
+"eb c #015601",
+"ec c #035003",
+"ed c #015201",
+"ee c #034C03",
+"ef c #034A03",
+"eg c #B1FFB1",
+"eh c #074207",
+"ei c #034803",
+"ej c #044604",
+"ek c #074007",
+"el c #083E08",
+"em c #014601",
+"en c #024402",
+"eo c #034203",
+"ep c #044004",
+"eq c #053805",
+"er c #063606",
+"es c #013A01",
+"et c #023802",
+"eu c #052E05",
+"ev c #042C04",
+"ew c #013001",
+"ex c #012E01",
+"ey c #012C01",
+"ez c #012A01",
+"f` c #022802",
+"fa c #042404",
+"fb c #002600",
+"fc c #022002",
+"fd c #011E01",
+"fe c #001000",
+"ff c #000A00",
+/* pixels */
+"``````````````````eleubedsaqbfer````````````````",
+"``````````````ayaibbafdiblbbcrefbsaw````````````",
+"``````````f`etdtajaoclaadyeobsaacq`ydoer````````",
+"````````bkapepab`n`lcjdqczcydvb`alduenakez``````",
+"``````buepafbhdeebcj`u`wdvcvbpa`cgej`qdmezc`````",
+"``````ek`yduedcidv`icharaoceea`mcz`tazesadbr````",
+"````bkapdi`naadl`f`feedj`lcdar`t`reacj`hacakel``",
+"````brdoejclbc`eam`mcucdcdcddbcndlagcidydxdwek``",
+"``faeheietdbdb`gcddk`fcf`b`pdkckam`vdv`h`xcwatfd",
+"``euepehav`heidhcockcn`aeg`bcjcddpe`bpdw`pdwdsf`",
+"``bkbleyem`r`wcndxdhci`aeg`a`caocv`jdedrcqendoev",
+"``brapeedxajdrdqcm`mchcf`b`kcmcud`dxcj`xcqadanel",
+"``evehdoalctctau`ee`cecgdtdhamceciddei`nacdwbner",
+"``fcasbpdt`pdyeb`edvcx`rd``ddxb`d`ddep`p`zdobjbw",
+"``cceqfbacbmbabg`w`scn`sebebacczdrcsdfaeaiawayfe",
+"````buexbcbpepbi`ocpdbcicjenctdjdgdjeaeeesdsbv``",
+"````fcbfewdzdw`zaebldg`rdb`ueddx`qbgaldzdsbqby``",
+"``````faboaqesdaad`xaedj`zajecabdcajbaaievbz````",
+"``````ffbubvakeseobaafenalajaxehdnanbdeqbwcc````",
+"````````fferbeewbnepatejahdzejakbnetelbqca``````",
+"``````````ffbtbqayayewewasdseweyezelbucc````````",
+"``````````````ffeuevbrbqeubxbkbvbuca````````````",
+"``````````````````ccbyc`bybycbff````````````````",
+"````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade6[] = {
+/* width height ncolors chars_per_pixel */
+"30 30 185 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #139713",
+"`k c #149514",
+"`l c #1A8B1A",
+"`m c #159315",
+"`n c #129312",
+"`o c #158B15",
+"`p c #128D12",
+"`q c #148914",
+"`r c #158715",
+"`s c #148514",
+"`t c #0F890F",
+"`u c #128312",
+"`v c #0F870F",
+"`w c #0E850E",
+"`x c #108110",
+"`y c #0D830D",
+"`z c #0F7F0F",
+"a` c #127912",
+"aa c #137513",
+"ab c #107710",
+"ac c #0C7D0C",
+"ad c #0E750E",
+"ae c #0F730F",
+"af c #0F6F0F",
+"ag c #0F6D0F",
+"ah c #0E6B0E",
+"ai c #0E690E",
+"aj c #077307",
+"ak c #0F650F",
+"al c #0E630E",
+"am c #0B630B",
+"an c #0D5B0D",
+"ao c #0A5F0A",
+"ap c #036703",
+"aq c #0B570B",
+"ar c #075D07",
+"as c #026502",
+"at c #046104",
+"au c #0A550A",
+"av c #0B530B",
+"aw c #0C4F0C",
+"ax c #0A510A",
+"ay c #025B02",
+"az c #094F09",
+"b` c #045704",
+"ba c #065306",
+"bb c #0A4B0A",
+"bc c #065106",
+"bd c #015901",
+"be c #074D07",
+"bf c #054F05",
+"bg c #074B07",
+"bh c #084908",
+"bi c #094709",
+"bj c #084508",
+"bk c #064706",
+"bl c #014F01",
+"bm c #004B00",
+"bn c #063D06",
+"bo c #063B06",
+"bp c #073907",
+"bq c #033D03",
+"br c #004100",
+"bs c #013F01",
+"bt c #033B03",
+"bu c #053505",
+"bv c #003D00",
+"bw c #063306",
+"bx c #053105",
+"by c #023502",
+"bz c #003700",
+"c` c #042B04",
+"ca c #042904",
+"cb c #012301",
+"cc c #022102",
+"cd c #011D01",
+"ce c #021B02",
+"cf c #011901",
+"cg c #011701",
+"ch c #011501",
+"ci c #011301",
+"cj c #010D01",
+"ck c #21B621",
+"cl c #1CB41C",
+"cm c #22AA22",
+"cn c #1AAC1A",
+"co c #18A818",
+"cp c #1F9C1F",
+"cq c #18A418",
+"cr c #17A217",
+"cs c #189E18",
+"ct c #189A18",
+"cu c #149C14",
+"cv c #149014",
+"cw c #119011",
+"cx c #128A12",
+"cy c #0F8C0F",
+"cz c #128612",
+"d` c #148214",
+"da c #138013",
+"db c #127E12",
+"dc c #127C12",
+"dd c #107C10",
+"de c #0F7A0F",
+"df c #0B800B",
+"dg c #0E780E",
+"dh c #0B7C0B",
+"di c #117211",
+"dj c #0A7A0A",
+"dk c #0E720E",
+"dl c #0A780A",
+"dm c #0A760A",
+"dn c #106A10",
+"do c #0B720B",
+"dp c #0F6A0F",
+"dq c #0A6E0A",
+"dr c #0B6C0B",
+"ds c #0A6A0A",
+"dt c #0B680B",
+"du c #067006",
+"dv c #0C660C",
+"dw c #0A660A",
+"dx c #056E05",
+"dy c #056C05",
+"dz c #0B620B",
+"e` c #0C600C",
+"ea c #0D5E0D",
+"eb c #056A05",
+"ec c #066806",
+"ed c #076407",
+"ee c #0D580D",
+"ef c #0A5C0A",
+"eg c #076007",
+"eh c #046404",
+"ei c #0A5A0A",
+"ej c #075A07",
+"ek c #085808",
+"el c #045E04",
+"em c #095409",
+"en c #015E01",
+"eo c #055605",
+"ep c #055405",
+"eq c #015601",
+"er c #035003",
+"es c #015201",
+"et c #034C03",
+"eu c #B1FFB1",
+"ev c #074207",
+"ew c #034803",
+"ex c #044604",
+"ey c #074007",
+"ez c #083E08",
+"f` c #014601",
+"fa c #024402",
+"fb c #044004",
+"fc c #053805",
+"fd c #063606",
+"fe c #013A01",
+"ff c #023802",
+"fg c #052E05",
+"fh c #013401",
+"fi c #013201",
+"fj c #042C04",
+"fk c #013001",
+"fl c #012E01",
+"fm c #012C01",
+"fn c #042604",
+"fo c #012A01",
+"fp c #022802",
+"fq c #042404",
+"fr c #002600",
+"fs c #022002",
+"ft c #011E01",
+"fu c #001000",
+"fv c #000A00",
+/* pixels */
+"````````````````````````fpfmbbavbyfoca``````````````````````",
+"``````````````````bwfhdndnafa`fkagbsbgeeeycc````````````````",
+"````````````````eebgagakahdbdw`sblf`aff`bqbgfh``````````````",
+"````````````fpanbsamejde`qdo`iefbdbzfeegd`ekbcavbx``````````",
+"``````````bpazaaa`dd`octdgcq`odlaodqecbdaob`aketbgfo````````",
+"````````fpaxdzd``r`ses`gcsdten`hdfdddmec`peldceidpbkfg``````",
+"````````ffeiaaa`elcsecdyajdeckepclcvascn`v`eaierf`diee``````",
+"``````cbanf`bm`xczdheh`dcnckerapeb`fcw`hcvcxecexdcagalbi````",
+"````fqfgemet`qatfe`tdl`hdfeoerdf`c`was`g`xencz`iegeodneece``",
+"````bpakbaex`odeeb`eapcl`fcqcrcl`c`t`eardyayddategeje`eeft``",
+"````fcdnau`raees`fcwcncydxdx`e`lckduclajducwctbzbqaba`azbu``",
+"``chflbkbfbmdeecebcrclcnajab`b`a`acmckcwcncnczfaamabaibzbofu",
+"``fqbbeadzet`q`icndwdhcn`y`b`aeu`a`l`c`jdfduacahbs`rdzdibobw",
+"``ftavazeaepeg`xdmaccvclcycm`aeu`acpap`f`wcwctay`q`rfadncbfg",
+"``fseydndzej`ieqeqatcwcrdk`c`l`b`lcpcodhdmexdqed`od`eibkeefg",
+"``fqbofbaiahdaedcveccraj`t`hdj`daj`d`ncucs`m`e`z`qahetazbbfq",
+"``chfmazefaoadczeqdbdh`pdm`dduebcldfbddl`pdmesed`sd`alalbicd",
+"``cjbxfheidvdcfbblddcscxew`icqbf`wdr`yacehesbebmaeaaexavceci",
+"````cbevfcdibafkfbes`qcs`kctctctekdebsesdqblb`ddf`aoakbpch``",
+"````ftcdbhbgexake`eg`q`gdqdocsctfebs`udrdsdkegbraqfebbbbcf``",
+"````cjfscbfhalbqabafdkeodd`x`odqddedaedgddf`bfaabzbbbifdfv``",
+"``````fqezeeeefefaafdtbmardb`oabdwegbmdcbcbaemakeafjfpfq````",
+"````````fnbifcaxbgbvdpdvdcafdwdadweraeanaoageaaqawbucc``````",
+"````````fvfqezaweafbfkeaexbvagbaeiaoaubce`aleeavcffsch``````",
+"``````````fvbxbpbnfibtbzakavfeakbgeabzakbtbobjfjbxch````````",
+"````````````cjcefpfobubobjezbtfkaneveebybuevcafqcj``````````",
+"````````````````fuc`bpfdfrezbbezfofnfgbxbpfqce``````````````",
+"``````````````````cjchchfufqcbcgcecefncccifv````````````````",
+"````````````````````````cjcjcicgcicjfv``````````````````````",
+"````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade7[] = {
+/* width height ncolors chars_per_pixel */
+"36 36 189 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #139713",
+"`k c #149514",
+"`l c #1A8B1A",
+"`m c #159315",
+"`n c #129312",
+"`o c #158B15",
+"`p c #128D12",
+"`q c #148914",
+"`r c #158715",
+"`s c #148514",
+"`t c #0F890F",
+"`u c #128312",
+"`v c #0F870F",
+"`w c #0E850E",
+"`x c #108110",
+"`y c #0D830D",
+"`z c #0F7F0F",
+"a` c #127912",
+"aa c #137513",
+"ab c #107710",
+"ac c #0C7D0C",
+"ad c #0E750E",
+"ae c #0F730F",
+"af c #0F6F0F",
+"ag c #0F6D0F",
+"ah c #0E6B0E",
+"ai c #0E690E",
+"aj c #077307",
+"ak c #0F650F",
+"al c #0E630E",
+"am c #0B630B",
+"an c #0D5B0D",
+"ao c #0A5F0A",
+"ap c #036703",
+"aq c #0B570B",
+"ar c #075D07",
+"as c #026502",
+"at c #046104",
+"au c #0A550A",
+"av c #0B530B",
+"aw c #016101",
+"ax c #0C4F0C",
+"ay c #0A510A",
+"az c #025B02",
+"b` c #094F09",
+"ba c #045704",
+"bb c #0A4D0A",
+"bc c #065306",
+"bd c #0A4B0A",
+"be c #065106",
+"bf c #015901",
+"bg c #074D07",
+"bh c #054F05",
+"bi c #074B07",
+"bj c #084908",
+"bk c #094709",
+"bl c #084508",
+"bm c #064706",
+"bn c #014F01",
+"bo c #004B00",
+"bp c #063D06",
+"bq c #063B06",
+"br c #073907",
+"bs c #033D03",
+"bt c #013F01",
+"bu c #033B03",
+"bv c #053505",
+"bw c #003D00",
+"bx c #063306",
+"by c #053105",
+"bz c #023502",
+"c` c #003700",
+"ca c #042904",
+"cb c #012301",
+"cc c #022102",
+"cd c #011D01",
+"ce c #021B02",
+"cf c #011901",
+"cg c #011701",
+"ch c #011501",
+"ci c #011301",
+"cj c #010D01",
+"ck c #21B621",
+"cl c #1CB41C",
+"cm c #22AA22",
+"cn c #1AAC1A",
+"co c #18A818",
+"cp c #1F9C1F",
+"cq c #18A418",
+"cr c #17A217",
+"cs c #189E18",
+"ct c #189A18",
+"cu c #149C14",
+"cv c #149014",
+"cw c #119011",
+"cx c #128A12",
+"cy c #0F8C0F",
+"cz c #128612",
+"d` c #148214",
+"da c #138013",
+"db c #127E12",
+"dc c #127C12",
+"dd c #107C10",
+"de c #0F7A0F",
+"df c #0B800B",
+"dg c #0E780E",
+"dh c #0B7C0B",
+"di c #117211",
+"dj c #0A7A0A",
+"dk c #0E720E",
+"dl c #0A780A",
+"dm c #0A760A",
+"dn c #106A10",
+"do c #0B720B",
+"dp c #0F6A0F",
+"dq c #0A700A",
+"dr c #0A6E0A",
+"ds c #0B6C0B",
+"dt c #0A6A0A",
+"du c #0B680B",
+"dv c #067006",
+"dw c #0C660C",
+"dx c #0A660A",
+"dy c #056E05",
+"dz c #056C05",
+"e` c #0B620B",
+"ea c #0C600C",
+"eb c #0D5E0D",
+"ec c #056A05",
+"ed c #066806",
+"ee c #076407",
+"ef c #0D580D",
+"eg c #0A5C0A",
+"eh c #076007",
+"ei c #046404",
+"ej c #0A5A0A",
+"ek c #075A07",
+"el c #085808",
+"em c #045E04",
+"en c #095409",
+"eo c #015E01",
+"ep c #055605",
+"eq c #055405",
+"er c #015601",
+"es c #015401",
+"et c #035003",
+"eu c #015201",
+"ev c #034C03",
+"ew c #034A03",
+"ex c #B1FFB1",
+"ey c #074207",
+"ez c #034803",
+"f` c #044604",
+"fa c #074007",
+"fb c #083E08",
+"fc c #014601",
+"fd c #024402",
+"fe c #034203",
+"ff c #044004",
+"fg c #053805",
+"fh c #063606",
+"fi c #013A01",
+"fj c #023802",
+"fk c #052E05",
+"fl c #013401",
+"fm c #013201",
+"fn c #042C04",
+"fo c #013001",
+"fp c #012E01",
+"fq c #012C01",
+"fr c #042604",
+"fs c #012A01",
+"ft c #022802",
+"fu c #042404",
+"fv c #002600",
+"fw c #022002",
+"fx c #011E01",
+"fy c #001000",
+"fz c #000A00",
+/* pixels */
+"````````````````````````````````fbeyeybvfn``````````````````````````````",
+"````````````````````````fkfqbjavdnbmeaafbmaqfvavby``````````````````````",
+"````````````````````fsbdalb`fdaievepbsdievdabjauc`bvbl``````````````````",
+"``````````````````avf`aleleve`dbdk`of`eldieharbjfjezdney````````````````",
+"``````````````fnaydneleqdb`i`o`i`idddweuemerbhesabbzbcbtayfh````````````",
+"````````````brbsenffdadd`o`odrctcvdxdleobfeiesbnaobafcfdfebufs``````````",
+"``````````caeyaqebe`boa`biaccndmat`ycnec`ddxed`v`iehai`raubgb`fk````````",
+"``````````efakalahbo`ucvazdzajdddecldscnclao`kcv`kdqfebneqdibmft````````",
+"````````fvefaaegdreucv`geicscncrdvdxarcw`fepclcwdlctdgbebnfoagakfg``````",
+"``````ccblakbcbodeeudlfd`hclclasapaw`dapaw`w`d`t`eaj`m`zekabdidnayfx````",
+"``````bvebbeag`seeemdm`deodjcnevdy`dcu`c`jasasfc`deoek`zadboepafanfb````",
+"````fwbyenbhf``rcxbicvcsap`fcydf`c`jcl`c`wdock`udzbfeccserboekegalfacf``",
+"````caeyeaaqbna`elcqcv`fco`hek`tcy`i`r`c`f`kcoareocydveie`fla`dcbmeffk``",
+"````eybbbwbhelcz`zbfcscqclcras`w`bcmcp`a`rdf`ccw`zapdsazerelddaebmbyfs``",
+"````bvffbtevba`uctezeo`tcycoawcx`b`aex`acpct`c`yeccldvbwfe`i`rdwezefca``",
+"``fwbkbmfieget`g`idmbfaddyckajcm`aexexex`aczcndvdfdvcsdmbhdadaelenauaxce",
+"``cefqflejaieheuemcvcxdm`m`ndl`e`b`aex`acmdr`ncn`w`hcsdmde`idaahf`aqfgcf",
+"``cafqauauaoekbo`ieeerafcwcrajcr`c`l`bcpcpcwcu`tdmbwe`ctembad`aifeaqfhca",
+"``cgfqflbia`dadsemdresdh`ecuao`hcrededdt`iajcocncs`vewee`q`uduelb`fjbyfu",
+"``fyfteff`amagad`odtewbf`k`ect`dcq`dcz`ncyecapcn`p`vekd``o`oagaiakavftch",
+"````fkaxcbejegabdkemahem`e`fctdjeoecdmclcwek`tdedmdrctffekababagalbqcd``",
+"````bxaxbqbgaaa`afeafif`atctedfdatazeodhbfcvcxedezfibtboduaedic`bmaxfx``",
+"````frfkaxbddielbmfldibadd`gcvcx`e`g`ebcaeamej`rdodxba`ra`ezakakbqbkcd``",
+"````cgcaaxavbibcdpffd`dk`q`iaddocvctctbte`dedo`xdtdsafepejbzfibjfscbfy``",
+"``````cgfbcaaldndnelafafdkdsdgdect`gdgdobaeuen`udsa`bzbhdibpfofgfxfy````",
+"``````fybxbrbzaybgezaae`afbofceheh`sdsadehbofeabdbage`akebb`fofpbrce````",
+"````````cfbybvbjbgfibjejagbcfcahdkdbabdsaretdbeldpaaejbgefavfnftch``````",
+"``````````cafbftefalb`bgdiaaafafafaramepbcaoagevaialauefbjeyfbcc````````",
+"``````````cjfufbeyavavavdneybzejezbzevezbcezegdianb`b`eybvfvfxch````````",
+"````````````fzfwfbbkbqbzbuflbiaybqbwakfeakf`feakbubxaxfbfncach``````````",
+"``````````````cjcgccftfofqblefblfsbbeyeyavebbseyaxblfbfrfufz````````````",
+"``````````````````cicebrbrfhbqaxbrfmbkbkbleycdfvbxfbcdfw````````````````",
+"````````````````````cjcefkfnftbybxfvfkbycfbrbyfkcachcj``````````````````",
+"````````````````````````fzcecichcfcgcicfchfwfufyfz``````````````````````",
+"````````````````````````````````fzfzfzfzcj``````````````````````````````",
+"````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade8[] = {
+/* width height ncolors chars_per_pixel */
+"44 44 189 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #139713",
+"`k c #149514",
+"`l c #1A8B1A",
+"`m c #159315",
+"`n c #129312",
+"`o c #158B15",
+"`p c #128D12",
+"`q c #148914",
+"`r c #158715",
+"`s c #148514",
+"`t c #0F890F",
+"`u c #128312",
+"`v c #0F870F",
+"`w c #0E850E",
+"`x c #108110",
+"`y c #0D830D",
+"`z c #0F7F0F",
+"a` c #127912",
+"aa c #137513",
+"ab c #107710",
+"ac c #0C7D0C",
+"ad c #0E750E",
+"ae c #0F730F",
+"af c #0F6F0F",
+"ag c #0F6D0F",
+"ah c #0E6B0E",
+"ai c #0E690E",
+"aj c #077307",
+"ak c #0F650F",
+"al c #0E630E",
+"am c #0B630B",
+"an c #0D5B0D",
+"ao c #0A5F0A",
+"ap c #036703",
+"aq c #0B570B",
+"ar c #075D07",
+"as c #026502",
+"at c #046104",
+"au c #0A550A",
+"av c #0B530B",
+"aw c #016101",
+"ax c #0C4F0C",
+"ay c #0A510A",
+"az c #025B02",
+"b` c #094F09",
+"ba c #045704",
+"bb c #0A4D0A",
+"bc c #065306",
+"bd c #0A4B0A",
+"be c #065106",
+"bf c #015901",
+"bg c #074D07",
+"bh c #054F05",
+"bi c #074B07",
+"bj c #084908",
+"bk c #094709",
+"bl c #084508",
+"bm c #064706",
+"bn c #014F01",
+"bo c #004B00",
+"bp c #063D06",
+"bq c #063B06",
+"br c #073907",
+"bs c #033D03",
+"bt c #004100",
+"bu c #013F01",
+"bv c #033B03",
+"bw c #053505",
+"bx c #003D00",
+"by c #063306",
+"bz c #053105",
+"c` c #023502",
+"ca c #003700",
+"cb c #042B04",
+"cc c #042904",
+"cd c #012301",
+"ce c #022102",
+"cf c #011D01",
+"cg c #021B02",
+"ch c #011901",
+"ci c #011701",
+"cj c #011501",
+"ck c #011301",
+"cl c #010D01",
+"cm c #21B621",
+"cn c #1CB41C",
+"co c #22AA22",
+"cp c #1AAC1A",
+"cq c #18A818",
+"cr c #1F9C1F",
+"cs c #18A418",
+"ct c #17A217",
+"cu c #189E18",
+"cv c #189A18",
+"cw c #149C14",
+"cx c #149014",
+"cy c #119011",
+"cz c #128A12",
+"d` c #0F8C0F",
+"da c #128612",
+"db c #148214",
+"dc c #138013",
+"dd c #127E12",
+"de c #127C12",
+"df c #107C10",
+"dg c #0F7A0F",
+"dh c #0B800B",
+"di c #0E780E",
+"dj c #0B7C0B",
+"dk c #117211",
+"dl c #0A7A0A",
+"dm c #0E720E",
+"dn c #0A780A",
+"do c #0A760A",
+"dp c #106A10",
+"dq c #0B720B",
+"dr c #0F6A0F",
+"ds c #0A6E0A",
+"dt c #0B6C0B",
+"du c #0A6A0A",
+"dv c #0B680B",
+"dw c #067006",
+"dx c #0C660C",
+"dy c #0A660A",
+"dz c #056E05",
+"e` c #056C05",
+"ea c #0B620B",
+"eb c #0C600C",
+"ec c #0D5E0D",
+"ed c #056A05",
+"ee c #066806",
+"ef c #076407",
+"eg c #0D580D",
+"eh c #0A5C0A",
+"ei c #076007",
+"ej c #046404",
+"ek c #0A5A0A",
+"el c #075A07",
+"em c #085808",
+"en c #045E04",
+"eo c #095409",
+"ep c #015E01",
+"eq c #055605",
+"er c #055405",
+"es c #015601",
+"et c #015401",
+"eu c #035003",
+"ev c #015201",
+"ew c #034C03",
+"ex c #034A03",
+"ey c #B1FFB1",
+"ez c #074207",
+"f` c #034803",
+"fa c #044604",
+"fb c #074007",
+"fc c #083E08",
+"fd c #014601",
+"fe c #024402",
+"ff c #034203",
+"fg c #044004",
+"fh c #053805",
+"fi c #063606",
+"fj c #013A01",
+"fk c #023802",
+"fl c #052E05",
+"fm c #013401",
+"fn c #013201",
+"fo c #042C04",
+"fp c #013001",
+"fq c #012E01",
+"fr c #012C01",
+"fs c #042604",
+"ft c #012A01",
+"fu c #022802",
+"fv c #042404",
+"fw c #002600",
+"fx c #022002",
+"fy c #011E01",
+"fz c #001000",
+/* pixels */
+"````````````````````````````````````````````br``````````````````````````````````````````",
+"````````````````````````````````bzftfkbvavakbsavb`aqbwfbfc``````````````````````````````",
+"````````````````````````````bwfgalaldpafafbcecebdkbubic`bpfmfq``````````````````````````",
+"````````````````````````fhavaubgbldkerahdbaoauekdeewaof`eadpfffmbw``````````````````````",
+"````````````````````fobbfaemdrewdrardfdfduekama`eoelamdydbfdbjaiakbbch``````````````````",
+"``````````````````fravakexamam`q`scx`odidiaoffdxenfaevdddyabeqfdembgaqbl````````````````",
+"````````````````bpbmekbeabdbdg`z`ods`z`mdqafeeatew`u`zemffba`rfdfdbubxbmft``````````````",
+"``````````````fbfkaufe`sdd`q`zdqdn`gcxdo`e`ydtfaedfeejdqczdg`qeuboecf`fjfmby````````````",
+"````````````fcecakbha`eaeuesefescz`f`yawdme`d`cpdzcsbf`ydocvdiekdebnfkaibiaybr``````````",
+"``````````fybjb`exbtei`odgdacxaoeddodydiapcucs`dd`asep`y`f`mcsdqdc`oabemaaecbzcd````````",
+"``````````bqayagbhewdtev`zcs`pdmctcp`fdhaj`eard`cp`wewas`jedaj`pefbeelb`emecanfh````````",
+"````````blegdpdxeleq`idd`xeebucscncncyepawewfeeierajcpcn`nbfepcz`pefabdddyekdpavfc``````",
+"````````c`egekeheu`udufjdm`z`edj`fcmapdiczapascq`cdjdtawapelbceadjcu`gdgeidcecalbw``````",
+"``````fobrffbedd`rdqdyabdscudlasdncpfe`fcq`h`ccn`j`jeicsdy`mdvdz`uejenbob`afemecegfo````",
+"``````bqegdpfeafba`ocudvdncpcy`tcnd`dzct`c`jcq`ccndncndnaraj`ke`dzesevdueqdvekdpblfl````",
+"````fvfpanaqbpddbobhaecu`fdhctcq`h`m`tdjct`o`rcm`eaj`ycqcpdwaj`nedatbhexefdbddbgakbqch``",
+"````fuftegbuembo`s`xdsencvcscncncycsdjdi`l`b`b`b`ldkcq`cd`eiedbf`gbfffahbe`rdkexezbrfi``",
+"````cdbkakbuemfddgdgcvemaj`hac`dcmcme``l`b`a`aey`aeccu`d`yedbuea`u`qcababo`raoembzfuce``",
+"````fcbdbmbuamfmdm`i`gbfeaarap`t`dfecu`b`aeyeyey`aco`dcmcy`eeddw`pencxfmdxafdxexfac`fc``",
+"````bravalbifkbmei`xcvdqatdwcpawcndwcx`b`aeyeyey`bdpdodo`das`j`w`pdsbuazel`rfdbeakfpfl``",
+"````fcblbwehbe`rarbadu`mdncsbtdncqedcpco`b`a`a`acrcodnctajcsacdjcu`xdidqdsa`dkbealbjbr``",
+"``cgflfkb`bgamfdbndxazef`eeedzcsctdldh`ccocr`b`b`lef`hcyac`h`gfecscvendddgddehffanegbzfz",
+"````bzbqfmaqbtam`sarahds`uazcuct`nbudhcqcmcr`cdi`demd``fcwcs`p`p`edi`xdqdmdbeheobqegfy``",
+"````flfpblffaoeldd`o`xadabes`kcu`tepcq`fcnapdm`pajedej`f`d`fctdobfdddy`rababemecfgc`cc``",
+"````fuftegfgaiela``s`ibacxevaz`w`ndfctcndwaje`cpctdl`zbx`ycu`xdsdxebdm`raoahagdpbdaxfl``",
+"````fxbkayfmebaidbdeeuaret`iefcu`m`oazedawdzepd`cybfajczbfdseeaz`sdberafdca`aqakblfufx``",
+"````ccfwezfbbmaaamahfpehfmbc`sdg`eeebxazdw`gazajdwfeaz`vdncaehbseo`sdvdedkaialbsaxfvfx``",
+"````fzccblbjayaubcf`alfkeoeles`g`gcs`e`pcu`wcuf`el`idfaoabdydgbabo`o`sfeewakcdfpfrcfcj``",
+"``````flfwbjbdffaffedbauffdydy`o`gdqefef`icu`xdccxfa`xeeef`gdy`ua`aobiakbjbgecfpbybz````",
+"``````cecdbdbybvebbgbmewew`rddadcx`o`u`icvcvdicvahatdyei`oefbob`eualdkewdpblblfibyce````",
+"````````cefcfxc`fjekftekdedddcdyetafefdfda`gdq`qdgeiafbe`r`seuafbcekaibgfmfnaxfuby``````",
+"````````fvbzezc`fmaybgbuamafddaofdbobaaddmdcdsdydteiboeoabdcagbcaaemdpaqfkfyfpbycj``````",
+"``````````chfibdfiavegfjfwbudeabbhfdei`sdy`rabdtameiardbaofkbeamecbgecanfqfwcdch````````",
+"``````````clflfcfpbqanecauaudkdka`a`a`dxagdxaheqeabhdxagbtdkdralauakfgaxfhbrfxcj````````",
+"````````````cjfxbrfrbkanalfgbkbbbibudrf`exfpemdxemehbhemexalecalbibjbkfqfucech``````````",
+"``````````````fzcffobzaxbdanauffblezdkfafec`ftfeekb`alfralaqanblayavbrcbflfx````````````",
+"````````````````cjflccfcfcc`c`fgfmbjavavbsaub`fqdpb`bwegecfmccbqezbzbzflci``````````````",
+"``````````````````chcjcccdbkfcfhfregbkaxc`bjbsfkavfgc`c`bpbkbdbdfccffvfz````````````````",
+"````````````````````clcjbzbzfifcbrezbkfnbzbpaxbkbkfbfhbzfcftfiflcffxcl``````````````````",
+"````````````````````````clfsflfoficbbzflbqftbqftchfublfofuflcgcgcj``````````````````````",
+"````````````````````````````cjckchckcefvfsfufsfychciflflcgckfz``````````````````````````",
+"````````````````````````````````clclfzcjchcgcicgfxfvcgcjcl``````````````````````````````",
+"````````````````````````````````````````````cl``````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+/* XPM */
+static char *jade9[] = {
+/* width height ncolors chars_per_pixel */
+"50 50 191 2",
+/* colors */
+"`` c None",
+"`a c #69E169",
+"`b c #35CB35",
+"`c c #23BD23",
+"`d c #1CB11C",
+"`e c #1AA71A",
+"`f c #169D16",
+"`g c #179717",
+"`h c #149914",
+"`i c #179317",
+"`j c #139713",
+"`k c #149514",
+"`l c #1A8B1A",
+"`m c #159315",
+"`n c #129312",
+"`o c #158B15",
+"`p c #128D12",
+"`q c #148914",
+"`r c #158715",
+"`s c #148514",
+"`t c #0F890F",
+"`u c #128312",
+"`v c #0F870F",
+"`w c #0E850E",
+"`x c #108110",
+"`y c #0D830D",
+"`z c #0F7F0F",
+"a` c #127912",
+"aa c #137513",
+"ab c #107710",
+"ac c #0C7D0C",
+"ad c #0E750E",
+"ae c #0F730F",
+"af c #0F6F0F",
+"ag c #0F6D0F",
+"ah c #0E6B0E",
+"ai c #0E690E",
+"aj c #077307",
+"ak c #0F650F",
+"al c #0E630E",
+"am c #0B630B",
+"an c #0D5B0D",
+"ao c #0A5F0A",
+"ap c #036703",
+"aq c #0B570B",
+"ar c #075D07",
+"as c #026502",
+"at c #046104",
+"au c #0A550A",
+"av c #0B530B",
+"aw c #016101",
+"ax c #0C4F0C",
+"ay c #0A510A",
+"az c #025B02",
+"b` c #094F09",
+"ba c #045704",
+"bb c #0A4D0A",
+"bc c #065306",
+"bd c #0A4B0A",
+"be c #065106",
+"bf c #015901",
+"bg c #074D07",
+"bh c #054F05",
+"bi c #074B07",
+"bj c #084908",
+"bk c #094709",
+"bl c #084508",
+"bm c #064706",
+"bn c #014F01",
+"bo c #004B00",
+"bp c #063D06",
+"bq c #063B06",
+"br c #073907",
+"bs c #033D03",
+"bt c #004100",
+"bu c #013F01",
+"bv c #033B03",
+"bw c #053505",
+"bx c #003D00",
+"by c #063306",
+"bz c #053105",
+"c` c #023502",
+"ca c #003700",
+"cb c #042B04",
+"cc c #042904",
+"cd c #012301",
+"ce c #022102",
+"cf c #011D01",
+"cg c #021B02",
+"ch c #011901",
+"ci c #011701",
+"cj c #011501",
+"ck c #011301",
+"cl c #010D01",
+"cm c #21B621",
+"cn c #1CB41C",
+"co c #22AA22",
+"cp c #1AAC1A",
+"cq c #18A818",
+"cr c #1F9C1F",
+"cs c #18A418",
+"ct c #17A217",
+"cu c #189E18",
+"cv c #189A18",
+"cw c #149C14",
+"cx c #149014",
+"cy c #119011",
+"cz c #128A12",
+"d` c #0F8C0F",
+"da c #128612",
+"db c #148214",
+"dc c #138013",
+"dd c #127E12",
+"de c #127C12",
+"df c #107C10",
+"dg c #0F7A0F",
+"dh c #0B800B",
+"di c #0E780E",
+"dj c #0B7C0B",
+"dk c #117211",
+"dl c #0A7A0A",
+"dm c #0E720E",
+"dn c #0A780A",
+"do c #0A760A",
+"dp c #106A10",
+"dq c #0B720B",
+"dr c #0F6A0F",
+"ds c #0A700A",
+"dt c #0A6E0A",
+"du c #0B6C0B",
+"dv c #0A6A0A",
+"dw c #0B680B",
+"dx c #067006",
+"dy c #0C660C",
+"dz c #0A660A",
+"e` c #056E05",
+"ea c #056C05",
+"eb c #0B620B",
+"ec c #0C600C",
+"ed c #0D5E0D",
+"ee c #056A05",
+"ef c #066806",
+"eg c #076407",
+"eh c #0D580D",
+"ei c #0A5C0A",
+"ej c #076007",
+"ek c #046404",
+"el c #0A5A0A",
+"em c #075A07",
+"en c #085808",
+"eo c #045E04",
+"ep c #095409",
+"eq c #015E01",
+"er c #055605",
+"es c #055405",
+"et c #015601",
+"eu c #015401",
+"ev c #035003",
+"ew c #015201",
+"ex c #034C03",
+"ey c #034A03",
+"ez c #B1FFB1",
+"f` c #074207",
+"fa c #034803",
+"fb c #044604",
+"fc c #074007",
+"fd c #083E08",
+"fe c #014601",
+"ff c #024402",
+"fg c #034203",
+"fh c #044004",
+"fi c #053805",
+"fj c #063606",
+"fk c #013A01",
+"fl c #023802",
+"fm c #052E05",
+"fn c #013401",
+"fo c #013201",
+"fp c #042C04",
+"fq c #013001",
+"fr c #012E01",
+"fs c #012C01",
+"ft c #042604",
+"fu c #012A01",
+"fv c #022802",
+"fw c #042404",
+"fx c #002600",
+"fy c #022002",
+"fz c #011E01",
+"g` c #001000",
+"ga c #000A00",
+/* pixels */
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"``````````````````````````````````````fvcdfsbwbsehehfqbdblbkbqfm````````````````````````````````````",
+"````````````````````````````````fvfvc`ayakalepauaabcakdkfgb`aufnbjbkfp``````````````````````````````",
+"````````````````````````````cdehbmaqanelbeexfeexdragfraobedebcfobbayedbqbl``````````````````````````",
+"````````````````````````fmbdedbiecelbmfeah`rafdc`o`sfba`ecemaffeenbufkbiedfdfj``````````````````````",
+"``````````````````````fpehfhaqenebema`ejdm`i`gdvfhbadcfhba`oevdmdwahaoaodkakblcd````````````````````",
+"````````````````````fsbbbmeyelemaodb`i`i`u`icudqbeaha`ateu`g`rahbnabdzflenbudpbjbz``````````````````",
+"``````````````````fdfobidkfeab`rad`xdf`zdt`mcxekbheadsbxetatdvfaamewbodbfea`fgbpbvfr````````````````",
+"````````````````brfndpakbcdz`r`q`odids`ecuczcycueeenbfeeeq`eefac`xdiaebabiesfabxbkbdcf``````````````",
+"``````````````fdbdedebfea`ahab`saeel`v`ecucxffcpdj`h`fdobxaododtaccxdqeoewdbexc`drbsbkfj````````````",
+"````````````ftehfnanfla`bseg`u`x`peme``yeacpdzeeerdv`f`fcu`x`t`t`p`pcsatfkewbgexagdkcacdfw``````````",
+"``````````cjfifhagaiexdz`ibn`zcv`mdadn`yd``vapeqemdq`t`nap`odqcycsdjcxcuazbgejbobmdkecfnfuce````````",
+"``````````brbbdpaffeec`rdueo`iczeke``dcpcnapff`gdfasdjdjcs`wdndh`weqdx`g`patecevemameialbvbq````````",
+"````````chbqb`akaoeserdfeg`xdtbedxcpcncqcqdzasapdqaseedncme`cnctdjeq`ods`zdgaddvdf`saiepalbbcd``````",
+"````````brfmb`enbefe`qbaetbeef`t`ee`d``jdhem`mczdjdhcn`c`fdxasas`madbceq`uda`i`uejfea`dkakehbr``````",
+"``````cefpedbmelaiabdcegetfa`vcpajeqee`cdlaj`dcqcs`ccncq`jasev`zex`uemdxat`idteoaifnaheiedavblfw````",
+"``````bzfvalakfaafev`ucv`zfa`pcp`t`ycmctev`ncq`ccwcp`c`cd`btawas`gdxcyekdnddeo`uejbadwaiaiayf`ch````",
+"``````fpanakffakfebn`gca`z`w`taccncn`jdje`d``y`dda`qcmcm`jej`j`hfaajdl`kdxdgdmcafbdzdddebcakehby````",
+"````chblavakbifebiegdidtbhcxcp`fcpcmcycndh`jdqcrco`b`ba`die``cct`ydze`dxbfdddybudmbo`ra`aibmf`fuce``",
+"````cjfuaybmffeieladdgcuduaj`pct`fcmcpemaj`z`l`b`a`a`acoa`cmcmcpd`e``icp`eazbcefamah`rafdycafifscd``",
+"````byfdbvfbavfaep`o`ucvekffcvajajcq`fcyas`e`b`aezezez`a`b`ictcmd`eqeqekdoekenendybnabdyenbxfobdcc``",
+"````cdfqbjedbudyfhdz`ucx`zdodudwcp`ycmdw`kcm`b`aezezez`acr`i`dcndxasacdxcsdn`ofbbmemdfexfaakfhbdbr``",
+"````fmbpbsbmfffqfhemdt`i`pac`zdn`e`dcwebcyco`b`aezezez`a`lcodufaardocy`hcxczeoeuegej`oesfaakavblfp``",
+"````cbbqbkakepfeboarbneo`x`w`p`naddo`jcpcy`c`c`b`a`a`acrcrcz`ncnaj`u`v`w`pcx`x`gdzdmaedebgecaybyby``",
+"````fdfqaldpbiaoboev`idfeoeobfatdx`f`f`wdm`d`c`lcr`bcocrdp`pcq`ycy`kbffbfgcxdiba`o`sdcafdrbmavf`fd``",
+"````fmbzbdfhalffdudcejboazcvduekcucpcteq`d`e`e`icr`bdgaacpdjcq`h`kct`p`zdcefcvaddudwdbececanfhfqby``",
+"````fzfdbjfgepeybe`r`oeg`uegamekcpcp`kdz`kcncp`hekel`wdx`iap`v`d`e`ncu`vbcaf`i`idcabdeenecayc`bkfm``",
+"````fmfsaxb`ehaibh`rdm`i`zbnenbudt`wctdnd`cpcqdhctcu`jcy`tasexdn`ecv`m`zeienfn`o`oaoa`dkededaxfuby``",
+"````fmfxavf`edelebaedbddaretbcetazefcvekeqdhee`easdo`dcp`wda`vateqczegdqejbnamdmdda`ahdkdpaqbpcdfy``",
+"````fwfxbkfnfieddkabdebna`ewendf`icucubffaefdu`odabhea`pbcdf`y`metetdvewamfl`oaraea`a`fbanavbdfpcg``",
+"````g`fzfrf`bzfgakelemelb`bsbvdceucz`g`zdtdodj`peqatateeazarazacdsetazddamboam`rardedpfkavfqbdcdck``",
+"``````fwbzavbdbkelenbcfsbvfhbodzeo`g`gcz`i`z`gcsczetbxadcxeb`rab`gdt`qejbaaedcaffabtalfkbdaxfdfy````",
+"``````ftcdfqfvb`fgafexagfefhdkdudv`ocvdgejdv`zcucu`wcuffeteg`xewdt`ieg`qdcdweybtbvalbiedbjcccgfy````",
+"``````cjcfchc`c`fkecbibtbtesevexdcdg`i`oda`u`gcu`gdgewey`idtdqegcxeg`s`obofsbtaafgfkfcanfufdftcj````",
+"````````cgfyf`cdbvfkalaaexabdbafdbdmdzewdfdmda`o`idt`xduejbaaeai`qddbnfebtbhebafcafrbqfqfjfjcc``````",
+"````````cjchfubwflfkaubgakebdedy`sduevb`erdvdzdtdfdzdidfejevdkbodf`rendkendkalalayfnc`fxbrbyci``````",
+"``````````fwccbqfibpalakbjc`bxaiabambhfneradabdm`odfdzdvdmarardcaba`alaienauauakalfqcdbwfyfw````````",
+"``````````gafwfzblfqbjavaqfhdkbxafaoenbeaiaeabam`r`rabaoeyenafabaaexafdkdkelededehbzbwcccega````````",
+"````````````cjfwfmfdblbdalanbibuafakafeca`ebdyarexebexdkenbcaheibcaadrelauakbjavbdfdccfwcj``````````",
+"``````````````g`fzbzfdfiavbbaqfhedfuf`fkfbelffbtanbcenexeibeauffafecelalb`avbkbqchcdfwcg````````````",
+"````````````````g`fybzfjbdbkblehayfbbdalbgaqfgbuanblfbepauedakfgauaqehbsbpaxbwfmcbfmcg``````````````",
+"``````````````````cjccfzfdfcbqflbvfhcafhedb`aybib`bibpanedbsakalalfnfjfoaxf`fvcccccj````````````````",
+"````````````````````cjcgfmcecdfufufnbqbpanbmbqf`ehbmehedbdfvbbblblaxaxbkblcdfmfwg```````````````````",
+"``````````````````````cjclfwftbrbzbkfiaxfifqbdbkfqf`ehavavbpc`fzfrfxfjfdfycfceck````````````````````",
+"````````````````````````gacgfycbccbrbrfxfxbzbdbdbdfdfdcffzfqfmbzfdbrbyfwchcgcl``````````````````````",
+"````````````````````````````gag`fyfwcececcfpbybzcbfucbcbcfcdbyfmfmcicjcgga``````````````````````````",
+"````````````````````````````````gackcgcifychchcccfchcjckcgchccfycjg`ga``````````````````````````````",
+"``````````````````````````````````````gagagackcjchfycjchcgg`clga````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````",
+"````````````````````````````````````````````````````````````````````````````````````````````````````"
+};
--- /dev/null
+#define nose_f1_width 64
+#define nose_f1_height 64
+static unsigned char nose_f1_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
+ 0x08,0x00,0xc0,0x1f,0x00,0x20,0x00,0x00,0x08,0x00,0x30,0x60,0x00,0x20,0x00,
+ 0x00,0xf8,0xff,0x0f,0x80,0xff,0x3f,0x00,0x00,0x00,0x02,0x02,0x00,0x82,0x00,
+ 0x00,0x00,0x00,0x03,0x01,0x00,0x84,0x01,0x00,0x00,0x00,0x81,0x00,0x00,0x08,
+ 0x01,0x00,0x00,0x80,0x80,0x00,0x00,0x08,0x02,0x00,0x00,0x80,0x40,0x00,0x00,
+ 0x10,0x02,0x00,0x00,0x40,0x40,0x00,0x00,0x10,0x04,0x00,0x00,0x40,0x20,0x00,
+ 0x00,0x20,0x04,0x00,0x00,0x60,0x20,0x00,0x00,0x20,0x0c,0x00,0x00,0x20,0x20,
+ 0x00,0x00,0x20,0x08,0x00,0x00,0x20,0x20,0x00,0x00,0x20,0x08,0x00,0x00,0x10,
+ 0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,
+ 0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,
+ 0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,
+ 0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,0x00,0x00,0x30,0x00,0x01,0x00,0x04,
+ 0x18,0x00,0x00,0x20,0x00,0x02,0x00,0x02,0x08,0x00,0x00,0x20,0x00,0x0c,0x80,
+ 0x01,0x08,0x00,0x00,0x60,0x00,0x30,0x60,0x00,0x0c,0x00,0x00,0x40,0x00,0xc0,
+ 0x1f,0x00,0x04,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0xc0,0x0f,0x00,0x00,0x00,
+ 0x00,0x40,0x10,0x20,0x10,0x00,0x00,0x00,0x00,0x20,0x60,0x30,0x20,0x00,0x00,
+ 0x00,0x00,0x20,0xc0,0x18,0x20,0x00,0x00,0xc0,0x7f,0x10,0x80,0x0d,0x40,0xe0,
+ 0x01,0x70,0xc0,0x18,0x00,0x05,0x40,0x1c,0x06,0x10,0x00,0x0f,0x00,0x05,0x80,
+ 0x07,0x08,0x08,0x00,0x06,0x00,0x05,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x05,
+ 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80,
+ 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00,
+ 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00,
+ 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84,
+ 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08,
+ 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_f1_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXX. ",
+" .................ooooooooooo............... ",
+" .OOOOOOO.ooooooooooooooo.OOOOO. ",
+" ..OOOOOO.ooooooooooooooooo.OOOO.. ",
+" .OOOOOO.ooooooooooooooooooo.OOOO. ",
+" .OOOOOOO.ooooooooooooooooooo.OOOOO. ",
+" .OOOOOO.ooooooooooooooooooooo.OOOO. ",
+" .OOOOOOO.ooooooooooooooooooooo.OOOOO. ",
+" .OOOOOO.ooooooooooooooooooooooo.OOOO. ",
+" ..OOOOOO.ooooooooooooooooooooooo.OOOO.. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
+" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ",
+" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ",
+" ..OOOOOOOOOO.ooooooooooooooooo.OOOOOOOO.. ",
+" .OOOOOOOOOOO.ooooooooooooooo.OOOOOOOOO. ",
+" .OOOOOOOOOOOO..ooooooooooo..OOOOOOOOOO. ",
+" ..OOOOOOOOOOOOO..ooooooo..OOOOOOOOOOO.. ",
+" .OOOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" ................................ ",
+" ",
+" ..... ...... ",
+" .+++++. .++++++. ",
+" .+++++++.. ..+++++++. ",
+" .++++++++.. ..++++++++. ",
+" ......... .++++++++++.. ..++++++++++. .... ",
+" ...+++++++.. ..+++++++++++. .+++++++++++. ...++++.. ",
+" .+++++++++++....@+++++++++++. .+++++++++++@....++++++++. ",
+" .+++++++++++++..@@+++++++++++. .++++++++++@@..++++++++++. ",
+" .+++++++++++++++..@++++++++++. .+++++++++@@..++++++++++++. ",
+" .+++++++++++++++++..@+++++++++. .++++++++@..++++++++++++++. ",
+" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ",
+" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ",
+" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ",
+" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ",
+" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.@++. ",
+" .+@@.+++++++++++++++++++++++. .+++++++++++++++++++.@@+. ",
+" .++@@..+++++++++++++++++++++.. ..+++++++++++++++++..@@++. ",
+" .++@@++++++++++++++++++++++@. .@++++++++++++++++++@@++. ",
+" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ",
+" ........................... ....................... ",
+" ",
+" "};
--- /dev/null
+#define nose_f2_width 64
+#define nose_f2_height 64
+static unsigned char nose_f2_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
+ 0x08,0x00,0xe0,0x0f,0x00,0x20,0x00,0x00,0x08,0x00,0x18,0x30,0x00,0x20,0x00,
+ 0x00,0xf8,0xff,0x07,0xc0,0xff,0x3f,0x00,0x00,0x00,0x02,0x01,0x00,0x81,0x00,
+ 0x00,0x00,0x00,0x83,0x00,0x00,0x82,0x01,0x00,0x00,0x00,0x41,0x00,0x00,0x04,
+ 0x01,0x00,0x00,0x80,0x40,0x00,0x00,0x04,0x02,0x00,0x00,0x80,0x20,0x00,0x00,
+ 0x08,0x02,0x00,0x00,0x40,0x20,0x00,0x00,0x08,0x04,0x00,0x00,0x40,0x10,0x00,
+ 0x00,0x10,0x04,0x00,0x00,0x60,0x10,0x00,0x00,0x10,0x0c,0x00,0x00,0x20,0x10,
+ 0x00,0x00,0x10,0x08,0x00,0x00,0x30,0x10,0x00,0x00,0x10,0x08,0x00,0x00,0x10,
+ 0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,
+ 0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,
+ 0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x04,0x10,
+ 0x00,0x00,0x30,0x40,0x00,0x00,0x04,0x10,0x00,0x00,0x20,0x80,0x00,0x00,0x02,
+ 0x18,0x00,0x00,0x20,0x00,0x01,0x00,0x01,0x08,0x00,0x00,0x60,0x00,0x06,0xc0,
+ 0x00,0x08,0x00,0x00,0x80,0x00,0x18,0x30,0x00,0x0c,0x00,0x00,0x80,0x00,0xe0,
+ 0x0f,0x00,0x04,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,
+ 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xe0,0x00,0x07,0x02,0x10,0x00,0x00,
+ 0x00,0x30,0x00,0x8c,0x01,0x20,0x00,0x00,0x00,0x0c,0x00,0x90,0x00,0x20,0x00,
+ 0x00,0x00,0x04,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20,
+ 0x00,0x00,0x00,0x42,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x02,
+ 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x06,0x20,0x00,0x00,0x00,0x21,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x03,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_f2_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ",
+" ................ooooooooooo................ ",
+" .OOOOOO.ooooooooooooooo.OOOOOO. ",
+" ..OOOOO.ooooooooooooooooo.OOOOO.. ",
+" .OOOOO.ooooooooooooooooooo.OOOOO. ",
+" .OOOOOO.ooooooooooooooooooo.OOOOOO. ",
+" .OOOOO.ooooooooooooooooooooo.OOOOO. ",
+" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ",
+" .OOOOO.ooooooooooooooooooooooo.OOOOO. ",
+" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ",
+" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
+" ..OOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
+" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ",
+" ..OOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ",
+" .OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO.. ",
+" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ",
+" ..OOOOOOOOOO..ooooooooooo..OOOOOOOOOOO. ",
+" .OOOOOOOOOOO..ooooooo..OOOOOOOOOOOO.. ",
+" .OOOOOOOOOOOOO.......OOOOOOOOOOOOOO. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" ................................ ",
+" ",
+" ......... ",
+" ........ .+++++++++. ",
+" ...++++++++... .++++++++++. ",
+" ..++++++++++++.. ..++++++++++++. ",
+" ..++++++++++++++++. .@++++++++++++. ",
+" .++++@..+++++++++++..@@++++++++++++. ",
+" .++++..++++++++++++++..@++++++++++++. ",
+" .+++@.+++++++++++++++++.@+++++++++++. ",
+" .+++@.+++++++++++++++++++.@++++++++++. ",
+" .+++@.+++++++++++++++++++..++++++++++. ",
+" .+++@.+++++++++++++++++++++++++++++++. ",
+" .++++++++++++++++++++++++++++++++++++@. ",
+" ..@++++++++++++++++++++++++++++++++++@. ",
+" .@@+++++++++++++++++++++++++++++++++@. ",
+" .@@++++++++++++++++++++++++++++++++@@. ",
+" .@@@++++++++++++++++++++++++++++++@. ",
+" ..@@@++++++++++++++++++++@@@++++@@. ",
+" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ",
+" .............................. ",
+" ",
+" ",
+" "};
--- /dev/null
+#define nose_f3_width 64
+#define nose_f3_height 64
+static unsigned char nose_f3_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
+ 0x04,0x00,0xf0,0x07,0x00,0x10,0x00,0x00,0x04,0x00,0x0c,0x18,0x00,0x10,0x00,
+ 0x00,0xfc,0xff,0x03,0xe0,0xff,0x1f,0x00,0x00,0x00,0x81,0x00,0x80,0x40,0x00,
+ 0x00,0x00,0x80,0x41,0x00,0x00,0xc1,0x00,0x00,0x00,0x80,0x20,0x00,0x00,0x82,
+ 0x00,0x00,0x00,0x40,0x20,0x00,0x00,0x02,0x01,0x00,0x00,0x40,0x10,0x00,0x00,
+ 0x04,0x01,0x00,0x00,0x20,0x10,0x00,0x00,0x04,0x02,0x00,0x00,0x20,0x08,0x00,
+ 0x00,0x08,0x02,0x00,0x00,0x30,0x08,0x00,0x00,0x08,0x06,0x00,0x00,0x10,0x08,
+ 0x00,0x00,0x08,0x04,0x00,0x00,0x10,0x08,0x00,0x00,0x08,0x0c,0x00,0x00,0x08,
+ 0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,
+ 0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,
+ 0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x08,
+ 0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x0c,0x00,0x00,0x18,0x40,0x00,0x00,0x01,
+ 0x04,0x00,0x00,0x10,0x80,0x00,0x80,0x00,0x04,0x00,0x00,0x10,0x00,0x03,0x60,
+ 0x00,0x06,0x00,0x00,0x30,0x00,0x0c,0x18,0x00,0x01,0x00,0x00,0x20,0x00,0xf0,
+ 0x07,0x00,0x01,0x00,0x00,0x60,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0x40,0xe0,0x00,0x07,0x00,
+ 0x00,0x00,0x04,0x80,0x31,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x09,0x00,0x30,
+ 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x20,0x00,0x00,0x00,0x04,0x00,0x03,0x00,
+ 0x43,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x42,0x00,0x00,0x00,0x04,0x40,0x00,
+ 0x00,0x84,0x00,0x00,0x00,0x04,0x60,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00,
+ 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0xc0,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_f3_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ",
+" ................ooooooooooo................ ",
+" .OOOOOO.ooooooooooooooo.OOOOOO. ",
+" ..OOOOO.ooooooooooooooooo.OOOOO.. ",
+" .OOOOO.ooooooooooooooooooo.OOOOO. ",
+" .OOOOOO.ooooooooooooooooooo.OOOOOO. ",
+" .OOOOO.ooooooooooooooooooooo.OOOOO. ",
+" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ",
+" .OOOOO.ooooooooooooooooooooooo.OOOOO. ",
+" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ",
+" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
+" .OOOOOO.ooooooooooooooooooooooo.OOOOOO.. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
+" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
+" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ",
+" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOO.. ",
+" ..OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO. ",
+" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ",
+" .OOOOOOOOOOO..ooooooooooo..OOOOOOOOOO.. ",
+" ..OOOOOOOOOOOO..ooooooo..OOOOOOOOOOO. ",
+" .OOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" ................................ ",
+" ",
+" ......... ",
+" .+++++++++. ........ ",
+" .++++++++++. ...++++++++... ",
+" .++++++++++++.. ..++++++++++++.. ",
+" .++++++++++++@. .++++++++++++++++.. ",
+" .++++++++++++@@..+++++++++++..@++++. ",
+" .++++++++++++@..++++++++++++++..++++. ",
+" .+++++++++++@.+++++++++++++++++.@+++. ",
+" .++++++++++@.+++++++++++++++++++.@+++. ",
+" .++++++++++..+++++++++++++++++++.@+++. ",
+" .+++++++++++++++++++++++++++++++.@+++. ",
+" .@++++++++++++++++++++++++++++++++++++. ",
+" .@++++++++++++++++++++++++++++++++++@.. ",
+" .@+++++++++++++++++++++++++++++++++@@. ",
+" .@@++++++++++++++++++++++++++++++++@@. ",
+" .@++++++++++++++++++++++++++++++@@@. ",
+" .@@++++@@@++++++++++++++++++++@@@.. ",
+" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ",
+" .............................. ",
+" ",
+" ",
+" "};
--- /dev/null
+#define nose_f4_width 64
+#define nose_f4_height 64
+static unsigned char nose_f4_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x1e,0x00,
+ 0x00,0x00,0x00,0x38,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,
+ 0x03,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x04,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x08,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x10,0x00,0x80,
+ 0x1f,0x00,0x40,0x00,0x00,0x08,0x00,0x60,0x60,0x00,0x80,0x00,0x00,0x08,0x00,
+ 0x10,0x80,0x00,0x80,0x00,0x00,0x04,0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x04,
+ 0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x02,0x00,0x18,0x80,0x01,0x00,0x02,0x00,
+ 0x02,0x00,0x68,0x60,0x01,0x00,0x02,0x00,0x02,0x00,0x88,0x1f,0x01,0x00,0x02,
+ 0x00,0x02,0x00,0x08,0x00,0x01,0x00,0x02,0x00,0x02,0x00,0x10,0x80,0x00,0x00,
+ 0x03,0x00,0x06,0x00,0x60,0x60,0x00,0x80,0x02,0x00,0x0c,0x00,0x80,0x1f,0x00,
+ 0x40,0x01,0x00,0x14,0x00,0x00,0x00,0x00,0x20,0x01,0x00,0x28,0x00,0x00,0x00,
+ 0x00,0x90,0x00,0x00,0x50,0x00,0x00,0x00,0x00,0x48,0x00,0x00,0xa0,0x01,0x00,
+ 0x00,0x00,0x26,0x00,0x00,0x40,0x1e,0x00,0x00,0xc0,0x11,0x00,0x00,0x80,0xe1,
+ 0x03,0x00,0x3c,0x0c,0x00,0x00,0x00,0x0e,0xfc,0xff,0x83,0x03,0x00,0x00,0x00,
+ 0xf0,0x01,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,
+ 0x00,0x80,0x03,0x00,0x0c,0x00,0x00,0x00,0x00,0x80,0x02,0x00,0x14,0x00,0x00,
+ 0x00,0x00,0x60,0x04,0x00,0x12,0x00,0x00,0xc0,0x7f,0x10,0x04,0x00,0x22,0xe0,
+ 0x01,0x70,0xc0,0x18,0x08,0x00,0x61,0x1c,0x06,0x10,0x00,0x0f,0x30,0xc0,0x80,
+ 0x07,0x08,0x08,0x00,0x06,0xc0,0x3f,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x02,
+ 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80,
+ 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00,
+ 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00,
+ 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84,
+ 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08,
+ 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_f4_xpm[] = {
+"64 64 6 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ............... ",
+" ....XXXXXXXXXXXXXXX.... ",
+" ...XXXXXXXXXXXXXXXXXXXXXXX... ",
+" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ",
+" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ",
+" .XXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXX..XXXXXXXXXX..XXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXX.X..XXXXXX..X.XXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXX.XXX......XXX.XXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXXX.. ",
+" ..XXXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. . ",
+" ..XXXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX.X. ",
+" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ",
+" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ",
+" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ",
+" .X..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..XX. ",
+" .XX....XXXXXXXXXXXXXXXXXXXXXXXXX...XXX. ",
+" ..XXXX.....XXXXXXXXXXXXXXXX....XXXX.. ",
+" ...XXXXXX................XXXXX... ",
+" .....XXXXXXXXXXXXXXXXXX.... ",
+" ................... ",
+" ...oooooooooooooooo.. ",
+" .+.oooooooooooooooo.+. ",
+" ..+++.oooooooooooooo.++. ",
+" ......... .+++++.oooooooooooooo.+++. .... ",
+" ...+++++++.. ..++++++.oooooooooooo.++++.. ...++++.. ",
+" .+++++++++++....@+++++++..oooooooo..++++++@....++++++++. ",
+" .+++++++++++++..@@+++++++++........+++++++@@..++++++++++. ",
+" .+++++++++++++++..@+++++++++++.++++++++++@@..++++++++++++. ",
+" .+++++++++++++++++..++++++++++. .+++++++++..++++++++++++++. ",
+" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ",
+" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ",
+" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ",
+" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ",
+" .++.++++++++++++++++++++++++. .++++++++++++++++++++.@+@. ",
+" .@+@.+++++++++++++++++++++++. .+++++++++++++++++++.@+@. ",
+" .@@+@..++++++++++++++++++++@.. ..@++++++++++++++++..@++@. ",
+" .@@+++++++++++++++++++++++@@. .@@+++++++++++++++++++@@. ",
+" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ",
+" ........................... ....................... ",
+" ",
+" "};
--- /dev/null
+#define nose_l1_width 64
+#define nose_l1_height 64
+static unsigned char nose_l1_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00,
+ 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00,
+ 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00,
+ 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00,
+ 0x18,0x00,0x20,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x40,0x00,0x80,0x00,0x00,
+ 0x00,0x08,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x00,0x01,0x20,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x06,0x18,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x07,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,
+ 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xc0,0x00,0x03,0x03,0x10,0x00,0x00,
+ 0x00,0x30,0x00,0x0c,0x01,0x20,0x00,0x00,0x00,0x08,0x00,0x98,0x00,0x20,0x00,
+ 0x00,0x00,0x0c,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20,
+ 0x00,0x00,0x00,0x42,0x00,0x80,0x00,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,
+ 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x01,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_l1_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .............................. ",
+" ",
+" ......... ",
+" ........ .+++++++++. ",
+" ...++++++++... .++++++++++. ",
+" ..++++++++++++.. ..++++++++++++. ",
+" ..++++++++++++++++. .@++++++++++++. ",
+" .++++@..+++++++++++..@@++++++++++++. ",
+" .++++..++++++++++++++..@++++++++++++. ",
+" .+++@.+++++++++++++++++.@+++++++++++. ",
+" .+++@.+++++++++++++++++++.@++++++++++. ",
+" .+++@.+++++++++++++++++++..++++++++++. ",
+" .+++@.+++++++++++++++++++++++++++++++. ",
+" .++++++++++++++++++++++++++++++++++++@. ",
+" ..@++++++++++++++++++++++++++++++++++@. ",
+" .@@+++++++++++++++++++++++++++++++++@. ",
+" .@@++++++++++++++++++++++++++++++++@@. ",
+" .@@@++++++++++++++++++++++++++++++@. ",
+" ..@@@++++++++++++++++++++@@@++++@@. ",
+" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ",
+" .............................. ",
+" ",
+" ",
+" "};
--- /dev/null
+#define nose_l2_width 64
+#define nose_l2_height 64
+static unsigned char nose_l2_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00,
+ 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00,
+ 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00,
+ 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00,
+ 0x18,0x00,0x10,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x20,0x00,0x80,0x00,0x00,
+ 0x00,0x08,0x00,0x40,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x80,0x00,0x20,0x00,
+ 0x00,0x00,0xe4,0x00,0x00,0x03,0x18,0x00,0x00,0x00,0x26,0x03,0x00,0xfc,0x07,
+ 0x00,0x00,0x00,0x12,0x0c,0x00,0x00,0xf8,0xff,0xff,0xff,0x11,0x10,0x80,0x1f,
+ 0x00,0x00,0x00,0x00,0x08,0x20,0x60,0x60,0xc0,0x07,0x00,0x00,0x04,0x40,0x10,
+ 0xc0,0x20,0x08,0x00,0x1f,0x02,0x40,0x08,0x00,0x21,0x10,0xc0,0x60,0x02,0x40,
+ 0x04,0x00,0x12,0x20,0x20,0x80,0x02,0x20,0xc2,0x00,0x14,0x40,0x18,0x00,0x03,
+ 0x20,0x22,0x00,0x0c,0x80,0x04,0x03,0x02,0x10,0x12,0x00,0x08,0x80,0x86,0x00,
+ 0x04,0x10,0x12,0x00,0x10,0x80,0x42,0x00,0x18,0x08,0x12,0x00,0x10,0x40,0x42,
+ 0x00,0x00,0x04,0x02,0x00,0x20,0x40,0x42,0x00,0x00,0x04,0x02,0x00,0x00,0x20,
+ 0x42,0x00,0x00,0x02,0x04,0x00,0x00,0x20,0x02,0x00,0x00,0x01,0x04,0x00,0x00,
+ 0x20,0x02,0x00,0x00,0x01,0x08,0x00,0x00,0x20,0x04,0x00,0x80,0x00,0x10,0x00,
+ 0x00,0x20,0x0c,0x00,0x80,0x00,0x60,0x00,0x00,0x10,0x08,0x00,0x40,0x00,0x80,
+ 0xff,0xff,0x0f,0x30,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_l2_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
+" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
+" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ... ",
+" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. .++.. ",
+" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. .+++++.. ",
+" .............................. .+++++++. ",
+" ...... .+++++++++. ",
+" ..++++++.. ..... .++++++++++@. ",
+" .+++++++++.. .+++++. ..... .+++++++++++@. ",
+" .++++++++++++. .++++++. ..+++++.. .++++++++++@@. ",
+" .++++++++++++++. .++++++++. .+++++++++. .@+++++++++@. ",
+" .++++..++++++++++. .+++++++++. ..+++++++++++..@++++++++@@. ",
+" .+++.@@++++++++++..@++++++++++. .+++++..+++++++.@@+++++++@. ",
+" .++.@+++++++++++++.@@+++++++++. ..++++.@@++++++++.@@+++++@@. ",
+" .++.@++++++++++++++.@+++++++++. .++++.@+++++++++++..++++@@. ",
+" .++.@++++++++++++++.@++++++++. .++++.@+++++++++++++++++@. ",
+" .@++++++++++++++++++.@+++++++. .++++.@++++++++++++++++@@. ",
+" .@@+++++++++++++++++++++++++. .++++.@+++++++++++++++@@. ",
+" .@++++++++++++++++++++++++@. .+++++++++++++++++++++@. ",
+" .@@+++++++++++++++++++++++@. .++++++++++++++++++++@@. ",
+" .@@++++++++++++++++++++++@. .+++++++++++++++++++@. ",
+" .@@@+++++++++++++++++++@@. ..+++++++++++++++++@@. ",
+" ..@@@@@@@@@@@@@@@@@@@@@. .@@@+++@@@++++++@@@. ",
+" ..................... ..@@@@@@@@@@@@@@.. ",
+" .............. ",
+" ",
+" ",
+" ",
+" "};
--- /dev/null
+#define nose_r1_width 64
+#define nose_r1_height 64
+static unsigned char nose_r1_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
+ 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f,
+ 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c,
+ 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00,
+ 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x18,0x00,0x00,0x80,0x00,
+ 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
+ 0x01,0x00,0x02,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x20,0x00,0x00,
+ 0x00,0x04,0x80,0x00,0x00,0x60,0x00,0x00,0x00,0x18,0x60,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0xe0,0x1f,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0xc0,0xc0,0x00,0x03,0x00,
+ 0x00,0x00,0x04,0x80,0x30,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x19,0x00,0x10,
+ 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x30,0x00,0x00,0x00,0x04,0x00,0x03,0x00,
+ 0x43,0x00,0x00,0x00,0x04,0x00,0x01,0x00,0x42,0x00,0x00,0x00,0x04,0x80,0x00,
+ 0x00,0x84,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00,
+ 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_r1_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ",
+" .............................. ",
+" ",
+" ......... ",
+" .+++++++++. ........ ",
+" .++++++++++. ...++++++++... ",
+" .++++++++++++.. ..++++++++++++.. ",
+" .++++++++++++@. .++++++++++++++++.. ",
+" .++++++++++++@@..+++++++++++..@++++. ",
+" .++++++++++++@..++++++++++++++..++++. ",
+" .+++++++++++@.+++++++++++++++++.@+++. ",
+" .++++++++++@.+++++++++++++++++++.@+++. ",
+" .++++++++++..+++++++++++++++++++.@+++. ",
+" .+++++++++++++++++++++++++++++++.@+++. ",
+" .@++++++++++++++++++++++++++++++++++++. ",
+" .@++++++++++++++++++++++++++++++++++@.. ",
+" .@+++++++++++++++++++++++++++++++++@@. ",
+" .@@++++++++++++++++++++++++++++++++@@. ",
+" .@++++++++++++++++++++++++++++++@@@. ",
+" .@@++++@@@++++++++++++++++++++@@@.. ",
+" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ",
+" .............................. ",
+" ",
+" ",
+" "};
--- /dev/null
+#define nose_r2_width 64
+#define nose_r2_height 64
+static unsigned char nose_r2_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
+ 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f,
+ 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c,
+ 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00,
+ 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x18,0x00,0x00,0x80,0x00,
+ 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x08,0x00,0x10,0x00,0x00,0x00,
+ 0x01,0x00,0x04,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x02,0x00,0x27,0x00,0x00,
+ 0x00,0x04,0x00,0x01,0xc0,0x64,0x00,0x00,0x00,0x18,0xc0,0x00,0x30,0x48,0x00,
+ 0x00,0x00,0xe0,0x3f,0x00,0x08,0x88,0xff,0xff,0xff,0x1f,0x00,0x00,0x04,0x10,
+ 0x00,0x00,0x00,0x00,0xf8,0x01,0x02,0x20,0x00,0x00,0xe0,0x03,0x06,0x06,0x02,
+ 0x40,0xf8,0x00,0x10,0x04,0x03,0x08,0x02,0x40,0x06,0x03,0x08,0x84,0x00,0x10,
+ 0x04,0x40,0x01,0x04,0x04,0x48,0x00,0x20,0x04,0xc0,0x00,0x18,0x02,0x28,0x00,
+ 0x43,0x08,0x40,0xc0,0x20,0x01,0x30,0x00,0x44,0x08,0x20,0x00,0x61,0x01,0x10,
+ 0x00,0x48,0x10,0x18,0x00,0x42,0x01,0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,
+ 0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,0x04,0x00,0x40,0x40,0x00,0x00,0x42,
+ 0x04,0x00,0x00,0x40,0x80,0x00,0x00,0x40,0x04,0x00,0x00,0x20,0x80,0x00,0x00,
+ 0x40,0x04,0x00,0x00,0x20,0x00,0x01,0x00,0x20,0x04,0x00,0x00,0x10,0x00,0x01,
+ 0x00,0x30,0x04,0x00,0x00,0x08,0x00,0x02,0x00,0x10,0x08,0x00,0x00,0x06,0x00,
+ 0x0c,0x00,0x0c,0xf0,0xff,0xff,0x01,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00};
--- /dev/null
+/* XPM */
+static char * nose_r2_xpm[] = {
+"64 64 7 1",
+" c black m black",
+". c black m white",
+"X c gray m black",
+"o c yellow m black",
+"O c yellow2 m black",
+"+ c purple m black",
+"@ c purple3 m black",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ",
+" ..................... ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
+" ........................................... ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ",
+" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ",
+" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ",
+" ... .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ",
+" ..++. ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ",
+" ..+++++. .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ",
+" .+++++++. .............................. ",
+" .+++++++++. ...... ",
+" .@++++++++++. ..... ..++++++.. ",
+" .@+++++++++++. ..... .+++++. ..+++++++++. ",
+" .@@++++++++++. ..+++++.. .++++++. .++++++++++++. ",
+" .@+++++++++@. .+++++++++. .++++++++. .++++++++++++++. ",
+" .@@++++++++@..+++++++++++.. .+++++++++. .++++++++++..++++. ",
+" .@+++++++@@.+++++++..+++++. .++++++++++@..++++++++++@@.+++. ",
+" .@@+++++@@.++++++++@@.++++.. .+++++++++@@.+++++++++++++@.++. ",
+" .@@++++..+++++++++++@.++++. .+++++++++@.++++++++++++++@.++. ",
+" .@+++++++++++++++++@.++++. .++++++++@.++++++++++++++@.++. ",
+" .@@++++++++++++++++@.++++. .+++++++@.++++++++++++++++++@. ",
+" .@@+++++++++++++++@.++++. .+++++++++++++++++++++++++@@. ",
+" .@+++++++++++++++++++++. .@++++++++++++++++++++++++@. ",
+" .@@++++++++++++++++++++. .@+++++++++++++++++++++++@@. ",
+" .@+++++++++++++++++++. .@++++++++++++++++++++++@@. ",
+" .@@+++++++++++++++++.. .@@+++++++++++++++++++@@@. ",
+" .@@@++++++@@@+++@@@. .@@@@@@@@@@@@@@@@@@@@@.. ",
+" ..@@@@@@@@@@@@@@.. ..................... ",
+" .............. ",
+" ",
+" ",
+" ",
+" "};
--- /dev/null
+#define puzzle_width 523
+#define puzzle_height 366
+static char puzzle_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x0c,0x00,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,
+ 0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xc0,0x07,
+ 0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x0e,0x00,0x00,
+ 0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c,
+ 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0xc0,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c,
+ 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x0c,0x00,0x00,
+ 0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x60,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30,
+ 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,
+ 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0xf8,
+ 0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x80,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0xf8,
+ 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x00,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0xf8,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x40,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8,
+ 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0xf8,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0xf8,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,
+ 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf9,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,
+ 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfa,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfc,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,
+ 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfa,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x10,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0xf8,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x10,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,
+ 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0xf8,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x02,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x02,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x08,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0xf8,
+ 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x80,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0xf8,
+ 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,
+ 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x60,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0xf8,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x18,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0xc0,0x00,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x0c,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c,
+ 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0xc0,0x00,0x00,
+ 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,
+ 0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x0e,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0xc0,0x07,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,
+ 0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x00,0x00,
+ 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,
+ 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
+ 0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x07,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8};
--- /dev/null
+#define puzzle_a_e_f_width 88
+#define puzzle_a_e_f_height 78
+#define puzzle_a_e_f_x_hot 20
+#define puzzle_a_e_f_y_hot 6
+static unsigned char puzzle_a_e_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
+ 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff,
+ 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f,
+ 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00,
+ 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7e, 0x80, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x00, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00,
+ 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f,
+ 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00,
+ 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_e_h_width 88
+#define puzzle_a_e_h_height 78
+#define puzzle_a_e_h_x_hot 20
+#define puzzle_a_e_h_y_hot 6
+static unsigned char puzzle_a_e_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00,
+ 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60,
+ 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00,
+ 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00,
+ 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00,
+ 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18,
+ 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00,
+ 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
+ 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x07, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7e, 0x80, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0,
+ 0x00, 0x70, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00,
+ 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, 0x01,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30,
+ 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00,
+ 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c,
+ 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00,
+ 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00,
+ 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_f_width 108
+#define puzzle_a_f_height 78
+#define puzzle_a_f_x_hot 20
+#define puzzle_a_f_y_hot 5
+static unsigned char puzzle_a_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
+ 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f,
+ 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
+ 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00, 0xc0, 0xff,
+ 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8,
+ 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
+ 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
+ 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07,
+ 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_h_width 108
+#define puzzle_a_h_height 78
+#define puzzle_a_h_x_hot 20
+#define puzzle_a_h_y_hot 5
+static unsigned char puzzle_a_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
+ 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c,
+ 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
+ 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
+ 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
+ 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00,
+ 0xf0, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00, 0xc0, 0xff,
+ 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, 0x3f, 0x00,
+ 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f,
+ 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x3e, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00, 0xe0, 0x80,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, 0x70, 0x00,
+ 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8,
+ 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00,
+ 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0,
+ 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38,
+ 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
+ 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00,
+ 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07,
+ 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_n_f_width 108
+#define puzzle_a_n_f_height 73
+#define puzzle_a_n_f_x_hot 21
+#define puzzle_a_n_f_y_hot 1
+static unsigned char puzzle_a_n_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e,
+ 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8,
+ 0x3f, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
+ 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
+ 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f,
+ 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00};
--- /dev/null
+#define puzzle_a_n_h_width 108
+#define puzzle_a_n_h_height 73
+#define puzzle_a_n_h_x_hot 21
+#define puzzle_a_n_h_y_hot 1
+static unsigned char puzzle_a_n_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e,
+ 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00,
+ 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8,
+ 0x3f, 0x00, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf0, 0x3f, 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00,
+ 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00,
+ 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f,
+ 0x70, 0x00, 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
+ 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
+ 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80,
+ 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c,
+ 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00};
--- /dev/null
+#define puzzle_a_ne_f_width 89
+#define puzzle_a_ne_f_height 74
+#define puzzle_a_ne_f_x_hot 21
+#define puzzle_a_ne_f_y_hot 1
+static unsigned char puzzle_a_ne_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xfe, 0x7f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_ne_h_width 89
+#define puzzle_a_ne_h_height 74
+#define puzzle_a_ne_h_x_hot 21
+#define puzzle_a_ne_h_y_hot 1
+static unsigned char puzzle_a_ne_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x0f, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x3e, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x78, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0xe0, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xf8, 0x00,
+ 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0x80, 0x01, 0x80, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x00, 0x03, 0xf8, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0x86, 0x7f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_nw_f_width 88
+#define puzzle_a_nw_f_height 74
+#define puzzle_a_nw_f_x_hot 1
+#define puzzle_a_nw_f_y_hot 1
+static unsigned char puzzle_a_nw_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03,
+ 0x00, 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
+ 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff,
+ 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07,
+ 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00,
+ 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
+ 0xff, 0x07, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_nw_h_width 88
+#define puzzle_a_nw_h_height 74
+#define puzzle_a_nw_h_x_hot 1
+#define puzzle_a_nw_h_y_hot 1
+static unsigned char puzzle_a_nw_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03,
+ 0x00, 0x0c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00,
+ 0x1c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
+ 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06,
+ 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06,
+ 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00,
+ 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
+ 0xc0, 0x07, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc,
+ 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_s_f_width 108
+#define puzzle_a_s_f_height 73
+#define puzzle_a_s_f_x_hot 20
+#define puzzle_a_s_f_y_hot 5
+static unsigned char puzzle_a_s_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
+ 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f,
+ 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
+ 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
+ 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0xc0, 0xff,
+ 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8,
+ 0x3f, 0x00, 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x1f, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00};
--- /dev/null
+#define puzzle_a_s_h_width 108
+#define puzzle_a_s_h_height 73
+#define puzzle_a_s_h_x_hot 20
+#define puzzle_a_s_h_y_hot 5
+static unsigned char puzzle_a_s_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
+ 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c,
+ 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
+ 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
+ 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
+ 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0xc0, 0xff,
+ 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8, 0x3f, 0x00,
+ 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f,
+ 0x70, 0x00, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x7e, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0xe0, 0xc1,
+ 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x78, 0x00,
+ 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8,
+ 0x3f, 0x00, 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x1c, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00};
--- /dev/null
+#define puzzle_a_se_f_width 88
+#define puzzle_a_se_f_height 74
+#define puzzle_a_se_f_x_hot 20
+#define puzzle_a_se_f_y_hot 6
+static unsigned char puzzle_a_se_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
+ 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
+ 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
+ 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff,
+ 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff,
+ 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f,
+ 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00,
+ 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7f, 0x80, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
+ 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_se_h_width 88
+#define puzzle_a_se_h_height 74
+#define puzzle_a_se_h_x_hot 20
+#define puzzle_a_se_h_y_hot 6
+static unsigned char puzzle_a_se_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00,
+ 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60,
+ 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00,
+ 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00,
+ 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00,
+ 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18,
+ 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00,
+ 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
+ 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7f, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_sw_f_width 88
+#define puzzle_a_sw_f_height 74
+#define puzzle_a_sw_f_x_hot 1
+#define puzzle_a_sw_f_y_hot 6
+static unsigned char puzzle_a_sw_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff,
+ 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01,
+ 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00,
+ 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
+ 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01,
+ 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00,
+ 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff,
+ 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_sw_h_width 88
+#define puzzle_a_sw_h_height 74
+#define puzzle_a_sw_h_x_hot 1
+#define puzzle_a_sw_h_y_hot 6
+static unsigned char puzzle_a_sw_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3,
+ 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01,
+ 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00,
+ 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06,
+ 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00,
+ 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
+ 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00,
+ 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_w_f_width 88
+#define puzzle_a_w_f_height 78
+#define puzzle_a_w_f_x_hot 1
+#define puzzle_a_w_f_y_hot 6
+static unsigned char puzzle_a_w_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff,
+ 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01,
+ 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00,
+ 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe,
+ 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
+ 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01,
+ 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00,
+ 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff,
+ 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x3f, 0xc0,
+ 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff,
+ 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01,
+ 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
+ 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
+ 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00,
+ 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f,
+ 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00,
+ 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_a_w_h_width 88
+#define puzzle_a_w_h_height 78
+#define puzzle_a_w_h_x_hot 1
+#define puzzle_a_w_h_y_hot 6
+static unsigned char puzzle_a_w_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3,
+ 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01,
+ 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00,
+ 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06,
+ 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00,
+ 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
+ 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x0f, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x00,
+ 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x01, 0x07,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xf8,
+ 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x3c, 0xc0,
+ 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07,
+ 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
+ 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06,
+ 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00,
+ 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80,
+ 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01,
+ 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00,
+ 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
+ 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0xc0, 0x07, 0x00, 0x00,
+ 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0xc0,
+ 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f,
+ 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00,
+ 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_e_f_width 74
+#define puzzle_b_e_f_height 108
+#define puzzle_b_e_f_x_hot 6
+#define puzzle_b_e_f_y_hot 21
+static unsigned char puzzle_b_e_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
+ 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07,
+ 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01,
+ 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_e_h_width 74
+#define puzzle_b_e_h_height 108
+#define puzzle_b_e_h_x_hot 6
+#define puzzle_b_e_h_y_hot 21
+static unsigned char puzzle_b_e_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00,
+ 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01,
+ 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00,
+ 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f,
+ 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07,
+ 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, 0x00, 0x00,
+ 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f,
+ 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01,
+ 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f,
+ 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_f_width 78
+#define puzzle_b_f_height 108
+#define puzzle_b_f_x_hot 5
+#define puzzle_b_f_y_hot 20
+static unsigned char puzzle_b_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
+ 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07,
+ 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01,
+ 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_h_width 78
+#define puzzle_b_h_height 108
+#define puzzle_b_h_x_hot 5
+#define puzzle_b_h_y_hot 20
+static unsigned char puzzle_b_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
+ 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00,
+ 0xff, 0x01, 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01,
+ 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01, 0x60, 0x00,
+ 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x07,
+ 0x00, 0x00, 0xfc, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
+ 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00,
+ 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07,
+ 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00,
+ 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0xc0, 0x07, 0x00, 0x00,
+ 0xfc, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f,
+ 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01,
+ 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f,
+ 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x01, 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_n_f_width 78
+#define puzzle_b_n_f_height 88
+#define puzzle_b_n_f_x_hot 6
+#define puzzle_b_n_f_y_hot 1
+static unsigned char puzzle_b_n_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff,
+ 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0x00, 0x00, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00,
+ 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff,
+ 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0,
+ 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01,
+ 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_n_h_width 78
+#define puzzle_b_n_h_height 88
+#define puzzle_b_n_h_x_hot 6
+#define puzzle_b_n_h_y_hot 1
+static unsigned char puzzle_b_n_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06,
+ 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f,
+ 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01,
+ 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00,
+ 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07,
+ 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00,
+ 0x00, 0x00, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00,
+ 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
+ 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x1f,
+ 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00,
+ 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0,
+ 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01,
+ 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_ne_f_width 74
+#define puzzle_b_ne_f_height 88
+#define puzzle_b_ne_f_x_hot 6
+#define puzzle_b_ne_f_y_hot 1
+static unsigned char puzzle_b_ne_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff,
+ 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0,
+ 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01,
+ 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_ne_h_width 74
+#define puzzle_b_ne_h_height 88
+#define puzzle_b_ne_h_x_hot 6
+#define puzzle_b_ne_h_y_hot 1
+static unsigned char puzzle_b_ne_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f,
+ 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8,
+ 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
+ 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f,
+ 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00,
+ 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0,
+ 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01,
+ 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_nw_f_width 74
+#define puzzle_b_nw_f_height 88
+#define puzzle_b_nw_f_x_hot 1
+#define puzzle_b_nw_f_y_hot 1
+static unsigned char puzzle_b_nw_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f,
+ 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff,
+ 0x1f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00,
+ 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_nw_h_width 74
+#define puzzle_b_nw_h_height 88
+#define puzzle_b_nw_h_x_hot 1
+#define puzzle_b_nw_h_y_hot 1
+static unsigned char puzzle_b_nw_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
+ 0x7c, 0x00, 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00,
+ 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70,
+ 0xf0, 0x0f, 0x18, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff,
+ 0x18, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00,
+ 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80,
+ 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_s_f_width 78
+#define puzzle_b_s_f_height 88
+#define puzzle_b_s_f_x_hot 5
+#define puzzle_b_s_f_y_hot 20
+static unsigned char puzzle_b_s_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
+ 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07,
+ 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_s_h_width 78
+#define puzzle_b_s_h_height 88
+#define puzzle_b_s_h_x_hot 5
+#define puzzle_b_s_h_y_hot 20
+static unsigned char puzzle_b_s_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00,
+ 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01,
+ 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00,
+ 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f,
+ 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
+ 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00,
+ 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07,
+ 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00,
+ 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_se_f_width 74
+#define puzzle_b_se_f_height 88
+#define puzzle_b_se_f_x_hot 6
+#define puzzle_b_se_f_y_hot 20
+static unsigned char puzzle_b_se_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
+ 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
+ 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
+ 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07,
+ 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_se_h_width 74
+#define puzzle_b_se_h_height 88
+#define puzzle_b_se_h_x_hot 6
+#define puzzle_b_se_h_y_hot 20
+static unsigned char puzzle_b_se_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
+ 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
+ 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
+ 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
+ 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00,
+ 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01,
+ 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00,
+ 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f,
+ 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0,
+ 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07,
+ 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_sw_f_width 74
+#define puzzle_b_sw_f_height 88
+#define puzzle_b_sw_f_x_hot 1
+#define puzzle_b_sw_f_y_hot 21
+static unsigned char puzzle_b_sw_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f,
+ 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0,
+ 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00,
+ 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80,
+ 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_sw_h_width 74
+#define puzzle_b_sw_h_height 88
+#define puzzle_b_sw_h_x_hot 1
+#define puzzle_b_sw_h_y_hot 21
+static unsigned char puzzle_b_sw_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c,
+ 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0,
+ 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00,
+ 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0,
+ 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00,
+ 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80,
+ 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f,
+ 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_w_f_width 74
+#define puzzle_b_w_f_height 108
+#define puzzle_b_w_f_x_hot 1
+#define puzzle_b_w_f_y_hot 21
+static unsigned char puzzle_b_w_f_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
+ 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f,
+ 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0,
+ 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00,
+ 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80,
+ 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00,
+ 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
+ 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00,
+ 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, 0xfe, 0x03,
+ 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0xfc,
+ 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
+ 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
+ 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define puzzle_b_w_h_width 74
+#define puzzle_b_w_h_height 108
+#define puzzle_b_w_h_x_hot 1
+#define puzzle_b_w_h_y_hot 21
+static unsigned char puzzle_b_w_h_bits[] = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
+ 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
+ 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c,
+ 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0,
+ 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00,
+ 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0,
+ 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00,
+ 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80,
+ 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
+ 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00,
+ 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f,
+ 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
+ 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x7c, 0x00, 0x00, 0xc0,
+ 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00,
+ 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00,
+ 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, 0xfe, 0x03,
+ 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0x0c,
+ 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
+ 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
+ 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
--- /dev/null
+#define som_width 464
+#define som_height 435
+static unsigned char som_bits[] = {
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x60,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x60,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,
+ 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfc,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,
+ 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,
+ 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x7f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,
+ 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,
+ 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfc,0xff,0xdf,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,
+ 0xff,0xdf,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x8f,
+ 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0xff,0xff,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0xff,0xff,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0xff,0xff,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xff,0xff,0x07,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0xff,0xff,0x07,0xfe,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0xff,0x03,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,
+ 0x03,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0xfc,
+ 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xe0,0xff,0xff,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x07,0x00,0x00,
+ 0x80,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,
+ 0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x03,0x00,0x00,0xe0,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfc,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,
+ 0x7f,0xfe,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x01,0xfe,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x01,0xfe,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x07,0x00,0xce,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfe,0x7f,0x00,0x00,0x87,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0xff,0x07,0x00,0x80,0x03,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0x3f,0x00,0x00,0x80,0x03,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x3f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x3f,0x00,
+ 0x00,0x80,0x03,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x07,0x00,0x00,0xc0,
+ 0x01,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,0xc0,0xfb,0xff,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x07,0x00,0xc0,0xff,0xff,0x3f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0xff,0xc0,0xff,0x7f,0x00,0xe0,0xff,0xff,0x7f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0xff,0xc0,0xff,0x7f,0x00,0xe0,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x1f,
+ 0x00,0xf8,0xff,0x0f,0xf0,0x0f,0xc0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,
+ 0xff,0x7f,0xf0,0x01,0x00,0xf8,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x80,0xff,
+ 0x7b,0x00,0x00,0xe0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xfc,0x3f,0x00,
+ 0x00,0x80,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xfc,0x3f,0x00,0x00,0x80,
+ 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0xe0,0x7f,0x00,0x00,0x00,0x7e,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0xff,0x03,0x00,0x00,0x70,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfc,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf8,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x3f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0xfe,0x03,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,
+ 0x00,0xfe,0x03,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x00,0x00,0xf0,0xff,
+ 0x1f,0x00,0x00,0x00,0x80,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3f,0x00,0x00,0xfc,0xff,0x7f,0x00,
+ 0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x1f,0x00,0x00,0xff,0x47,0x7f,0x00,0x00,0x00,
+ 0x00,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0x03,0xc0,0xff,0xfe,0xff,0x7d,0x00,0x00,0x00,0x00,0x80,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,0x40,
+ 0x00,0x00,0xfe,0x7f,0x00,0x00,0x00,0x00,0x80,0xff,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x3f,0x00,0x00,0x80,0x03,
+ 0xf8,0x3f,0x00,0x00,0x00,0x00,0x80,0xe7,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0xf0,0xff,0xff,0x1f,
+ 0x00,0x00,0x00,0x00,0x80,0xc7,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0xf0,0xff,0xff,0x1f,0x00,0x00,
+ 0x00,0x00,0x80,0xc7,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0xf0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,
+ 0xc0,0x0f,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0x7f,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x0f,
+ 0xfc,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0xf0,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x1f,0x80,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1c,0x00,0xfe,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0x1c,0x00,0xfe,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x70,0x1c,0x00,0xf0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x70,0x38,0x00,0xc0,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,
+ 0x78,0x00,0x00,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x70,0x00,
+ 0x00,0xfc,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x70,0x00,0x00,0xfc,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x70,0x00,0x00,0xfe,0x03,0xfe,
+ 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x38,0xf0,0x00,0x00,0xfe,0x0f,0xff,0xff,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x18,0xe0,0x00,0x80,0x9f,0xff,0x3f,0xfe,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x1c,0xe0,0x00,0x80,0x0f,0xff,0x07,0xc0,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x1c,0xe0,0x00,0x80,0x0f,0xff,0x07,0xc0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xf1,
+ 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,0xe0,
+ 0x00,0xc0,0x07,0xfc,0x01,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xe1,0xff,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,0xe0,0x01,0xe0,
+ 0x03,0x60,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xc3,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0xc0,0x01,0xf0,0x01,0x00,
+ 0xe0,0x03,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0xf0,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0xc0,0x03,0xf8,0x00,0x00,0xf8,0x1f,
+ 0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x07,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x07,0xc0,0x03,0xf8,0x00,0x00,0xf8,0x1f,0xe0,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x0f,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x07,0x80,0x03,0x78,0x00,0x00,0xf8,0x7f,0xe0,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x0f,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x03,0x80,0x03,0x3e,0x00,0x00,0x78,0x7e,0xc0,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x1e,0x1c,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf3,
+ 0x9f,0x03,0x1f,0x00,0x00,0x00,0xf0,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0x70,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0xfe,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,
+ 0x0f,0x00,0x00,0x00,0xe0,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0xfe,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x0f,0x00,
+ 0x00,0x00,0xe0,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0xfc,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x87,0x07,0x00,0x00,0x00,
+ 0xe0,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0x3f,0xf4,0xc7,0x07,0x00,0x00,0x00,0xe0,0x00,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0x03,0x80,0xe7,0x01,0x00,0x00,0x00,0xe0,0x00,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0x00,0x00,0xff,0x01,0x00,0x00,0x00,0xe0,0x80,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xff,0x00,0x00,0x00,0x00,0xf8,0x80,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xff,0x00,0x00,0x00,0x00,0xf8,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7e,0x00,
+ 0x00,0x00,0x00,0x7c,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,0x80,0x07,
+ 0xe0,0x3f,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0xc0,0xff,0xff,0x0f,
+ 0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xe0,0xff,0xff,0x03,0xe0,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xe0,0xff,0xff,0x03,0xe0,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0x3f,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x07,0x00,0x80,0xff,0x7f,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0x03,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0xfc,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x1e,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,
+ 0x00,0x00,0x80,0xcf,0x3f,0x00,0x00,0xfe,0x01,0x00,0xc0,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,
+ 0x80,0xcf,0x3f,0x00,0x00,0xfe,0x01,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0xe0,0xe7,
+ 0xff,0x00,0x00,0xfe,0x0f,0x00,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0x03,0x00,0xfc,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0x03,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0xf0,0xff,0xf9,0xff,0x01,
+ 0x00,0xe0,0x1f,0x00,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0x03,0x00,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0x03,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x7e,0x00,0x00,0x00,0xc0,0xff,0x7f,0xfe,0xe1,0x07,0x00,0xc0,
+ 0xff,0x00,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0x01,0x00,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0x03,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x1e,0x00,0x00,0x00,0xfc,0xff,0x1f,0xff,0x81,0x0f,0x00,0x80,0xf1,0x03,
+ 0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,
+ 0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,
+ 0x00,0x00,0x00,0xfc,0xff,0x1f,0xff,0x81,0x0f,0x00,0x80,0xf1,0x03,0xc0,0xe1,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,0xc0,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x81,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,
+ 0x00,0xff,0x3f,0x80,0xff,0x00,0x1f,0x00,0x80,0xc1,0x07,0xc0,0xe1,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xc1,0xff,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x03,0xc0,0x3f,
+ 0x00,0xe0,0x7f,0x00,0x7e,0x00,0x80,0x01,0x1f,0xe0,0xe1,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x80,0x07,0xf0,0x07,0x00,0xf0,
+ 0x3f,0x00,0xf8,0x00,0x80,0x01,0x3c,0xe0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x80,0xff,0xff,0x01,0x00,0xfc,0x1f,0x00,
+ 0xf0,0x01,0xc0,0x01,0x38,0xe0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0x7f,0xf0,0x00,0xf8,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0x03,0x00,0xfe,0x1f,0x00,0x80,0xbf,0x07,0x00,0x80,0x07,
+ 0xc0,0x01,0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,
+ 0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0x7f,0xf0,0x00,0xf8,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0x03,0x00,0xfe,0x1f,0x00,0x80,0xbf,0x07,0x00,0x80,0x07,0xc0,0x01,
+ 0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
+ 0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,
+ 0xf0,0x00,0x00,0xfe,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,
+ 0x01,0x00,0xf8,0x03,0x00,0xc0,0xcf,0x03,0x00,0x80,0x1f,0xf0,0x01,0xe0,0x71,
+ 0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0xf0,0x00,
+ 0x00,0xe0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0xe7,0x03,0x00,0x00,0x7e,0xff,0x00,0xc0,0x73,0xf0,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0xf0,0x00,0x00,0x00,
+ 0xfc,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,
+ 0x00,0xf8,0xf3,0x00,0x00,0x00,0xfc,0x7f,0x00,0x00,0x7f,0xf0,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,
+ 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0xe0,0xff,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x7c,
+ 0xf8,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x1f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0xe0,0xff,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x7c,0xf8,0x00,
+ 0x00,0x00,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
+ 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x80,0xff,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0x7f,0x7c,0x00,0x00,0x00,
+ 0xe0,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0xfe,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0xc0,0x1f,0x3e,0x00,0x00,0x00,0xc0,0xff,
+ 0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x7c,0x00,0x00,0x00,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x0f,0x00,0x00,0x00,0x00,0xe0,0x07,0x1f,0x00,0x00,0x00,0x80,0x0f,0x00,0x00,
+ 0x3c,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,
+ 0x00,0x00,0x00,0xfc,0x83,0x0f,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x38,0xf0,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfc,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,
+ 0x00,0xfc,0x83,0x0f,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x38,0xf0,0xff,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,
+ 0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0xf8,
+ 0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0xff,
+ 0x80,0x07,0x00,0x00,0x00,0x00,0x3e,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,
+ 0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,
+ 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0xff,0xff,0xff,
+ 0xff,0x03,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0xe0,0x1f,0xe0,0x03,
+ 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,
+ 0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x00,0x00,0xff,0x3f,0xe0,0xff,0x0f,
+ 0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0xf8,0x07,0xf0,0x01,0x00,0x00,
+ 0x00,0x00,0xf0,0x01,0x00,0x1e,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x03,0x00,
+ 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0xe0,0xff,0x01,0xfe,0x3f,0x00,0x00,
+ 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0xfe,0x01,0xf8,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0x03,0x00,0x0e,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x03,0x00,0x00,0x00,
+ 0x00,0x80,0x07,0x00,0x00,0x00,0xe0,0xff,0x01,0xfe,0x3f,0x00,0x00,0x00,0x00,
+ 0xf0,0x00,0x00,0x00,0x00,0xfe,0x01,0xf8,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,
+ 0x00,0x0e,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x80,
+ 0x07,0x00,0x00,0x00,0x00,0xf8,0x07,0xc0,0xff,0x01,0x00,0x00,0x00,0xf8,0x00,
+ 0x00,0x00,0x80,0x7f,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0x0e,
+ 0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0xc0,0xe3,0xff,
+ 0xff,0x00,0x00,0xc0,0x1f,0x80,0xff,0x03,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,
+ 0xe0,0x1f,0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x07,0x00,0x00,
+ 0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0xc0,0xfb,0xff,0xff,0x0f,
+ 0x00,0x00,0x3e,0x80,0xf3,0x1f,0x00,0x00,0x00,0x3e,0x00,0x00,0x00,0xf8,0x07,
+ 0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x07,0x00,0x00,0x00,0xe0,
+ 0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0x00,0x00,
+ 0x7c,0xc0,0x81,0xff,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0xff,0x01,0x00,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x80,0x07,0x00,0x00,0x00,0xf0,0xff,0xff,
+ 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,
+ 0xff,0xff,0x03,0x00,0x00,0x00,0xc0,0x7f,0x00,0xe0,0xff,0x3f,0x00,0xf0,0xc0,
+ 0x01,0xfe,0x03,0x00,0x00,0x0f,0x00,0x00,0xc0,0x7f,0x00,0xc0,0x07,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0xc0,0x03,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,
+ 0x03,0x00,0x00,0x00,0xc0,0x7f,0x00,0xe0,0xff,0x3f,0x00,0xf0,0xc0,0x01,0xfe,
+ 0x03,0x00,0x00,0x0f,0x00,0x00,0xc0,0x7f,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xc0,0x03,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x07,0x00,
+ 0x00,0x00,0xc0,0x0f,0x00,0x00,0xfc,0xff,0x03,0xc0,0xe3,0x01,0xf0,0x07,0x00,
+ 0x80,0x07,0x00,0x00,0xf0,0x1f,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0xc1,0x01,0x00,0x00,0x00,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,
+ 0xc0,0x07,0x00,0x00,0x00,0xfc,0xff,0x00,0xf7,0x00,0x00,0x3f,0x00,0xc0,0x03,
+ 0x00,0x00,0xff,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xe3,
+ 0x01,0x00,0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0xc0,0x01,
+ 0x00,0x00,0x00,0xc0,0xff,0x07,0x7f,0x00,0x00,0xfc,0x00,0xe0,0x03,0x00,0xe0,
+ 0x3f,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x00,0x00,
+ 0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,
+ 0x00,0x00,0xfe,0x7f,0x7f,0x00,0x00,0xf8,0x01,0xe0,0x01,0x00,0xfc,0x07,0x00,
+ 0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x00,0x00,0x00,0xfc,
+ 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfe,0xff,0xff,0xff,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,
+ 0xfe,0x7f,0x7f,0x00,0x00,0xf8,0x01,0xe0,0x01,0x00,0xfc,0x07,0x00,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x00,0x00,0x00,0xfc,0xff,0xff,
+ 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0xff,0xff,0x03,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0xe0,0xff,
+ 0x3f,0x00,0x00,0xf0,0x07,0xf0,0x00,0x00,0xff,0x03,0x00,0x00,0x7c,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x7e,0x00,0x00,0x00,0xff,0xff,0xff,0x7f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,
+ 0xff,0xff,0x0f,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0xfe,0x3f,0x00,
+ 0x00,0xc0,0x3f,0xf8,0x00,0xf8,0x3f,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,
+ 0x3f,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x0f,0x00,0x00,
+ 0x7f,0x7c,0x00,0xfe,0x07,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x1e,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,
+ 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x7f,0x00,0x00,0xfc,0x3e,
+ 0xe0,0x7f,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x1f,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x80,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x7f,0x00,0x00,0xfc,0x3e,0xe0,0x7f,
+ 0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,
+ 0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x80,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x1f,0x00,0xf0,0x1f,0xfe,0x0f,0x00,0x00,
+ 0x00,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0x00,0x00,0xfc,
+ 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfc,0xff,0x3f,0xc0,0xff,0xff,0x00,0x00,0x00,0x00,0xc0,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x03,0x00,0x00,0xff,0xff,0xff,
+ 0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0xff,0x0f,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0xe0,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x03,0x00,0xc0,0xff,0xff,0xff,0x1f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,
+ 0xff,0xff,0x7f,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,
+ 0xff,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0xff,0x1f,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x7c,0x00,0x00,0xfc,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x03,
+ 0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x7f,
+ 0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,
+ 0x00,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0xe0,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0xfe,0x00,0x00,
+ 0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x1f,0x00,0xc0,0xff,
+ 0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x1f,0x00,0xc0,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0xf8,0x03,0x00,0x00,0x00,
+ 0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0xe0,0xff,0xff,0xff,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x80,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0xe0,0x0f,0x00,0x00,0x00,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x70,0xe0,0x0f,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xff,0xff,0xff,0xff,0x00,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x70,0x00,0x3f,0x00,0x00,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x01,0x00,0xfe,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
+ 0xff,0xff,0xff,0x03,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x70,0x00,0xfe,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x7e,0x00,0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,
+ 0xff,0x0f,0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,
+ 0x00,0xf8,0x01,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,
+ 0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,
+ 0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x80,
+ 0x0f,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0xf8,0xff,
+ 0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,0x00,0xf8,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x80,0x0f,0x00,
+ 0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0xf8,0xff,0xff,0xff,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0x00,0xe0,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x3e,0x00,0xf0,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x07,0x00,0xfe,0xff,0xff,0xff,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x03,0xc0,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0xfc,0x00,0x78,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0x01,0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x0f,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0xe0,0x03,0x3c,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x7c,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0xff,0x1f,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x7c,0x00,0x00,0xc0,0x1f,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x3e,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0xff,0xff,0x1f,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x7c,0x00,0x00,0xc0,0x1f,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,
+ 0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,
+ 0xff,0x7f,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,
+ 0x00,0x00,0x3f,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0xfc,0xff,
+ 0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,
+ 0x01,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,
+ 0xfc,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x07,0x00,0xff,0xff,0xff,0x3f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x03,0x78,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0xf8,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0xc0,0xff,0xff,0xff,0x1f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0xfc,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0xfc,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x1f,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x7e,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xff,0xff,0xff,0xff,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x1e,0x00,0x00,0x00,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,
+ 0xfe,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0xff,0xff,0x01,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,
+ 0x00,0x00,0x80,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x80,0xff,0xff,
+ 0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,
+ 0xff,0xff,0x07,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,0x00,0x00,
+ 0xc0,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0xe0,0xff,0xff,0xff,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,
+ 0x0f,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0xe0,0x3f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x7c,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0xe0,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,0xf0,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x7e,0x00,0xfc,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x7f,0xe0,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfc,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x3e,0x00,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0x07,0x00,0x00,0xfc,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0xc0,
+ 0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xff,0xff,0xff,0xc1,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x03,0x00,0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0xf0,0xff,0xff,
+ 0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf0,0xff,0xff,0xff,0xc1,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,
+ 0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0xf0,0xff,0xff,0xff,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,
+ 0xff,0xff,0x83,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xff,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,
+ 0x0f,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0xc0,0xef,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0xe0,0x01,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x0f,0x1c,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0xe0,0xf3,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x1f,0x38,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x70,0x00,0x00,0xf0,0xf9,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x78,0xe0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x1f,0x38,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x70,0x00,0x00,0xf0,0xf9,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0xe0,
+ 0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x7f,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x78,0x00,0x00,0x78,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xf0,0xff,0xff,
+ 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0xff,0xff,0xff,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,
+ 0x00,0x7e,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xf8,0xff,0xff,0xff,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xff,0xff,0xff,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x3e,
+ 0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0xfe,0xff,0xff,0x7f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,
+ 0xff,0xff,0xc1,0x03,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x0f,0x1e,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x0f,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,
+ 0xc1,0x03,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x0f,0x1e,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x0f,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x83,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0xc0,0x07,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x07,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x07,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x0f,0x00,0xe0,0x83,0x0f,0x00,0x00,0x00,0x00,0x00,0x80,0xc7,
+ 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x0f,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x07,0x00,0xf0,0x81,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0xc3,0xff,0xff,
+ 0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x1f,0x1c,0x00,0x00,0x00,0x00,0x80,0x03,
+ 0x00,0x7c,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0xe0,0xe1,0xff,0xff,0x7f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0x3f,0x3c,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x3f,
+ 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0xe0,0xe0,0xff,0xff,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0x3f,0x3c,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x3f,0xe0,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0xe0,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
+ 0xff,0x3f,0x3c,0x00,0x00,0x00,0x00,0xe0,0x01,0x80,0x1f,0xe0,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0xe0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,
+ 0x38,0x00,0x00,0x00,0x00,0xe0,0x00,0xe0,0x07,0xf0,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x78,0xf8,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,
+ 0x00,0x00,0x00,0xf0,0x00,0xf0,0x03,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x78,
+ 0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,0x00,0x00,
+ 0x00,0x70,0x00,0xfe,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xfc,0xff,
+ 0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,0x00,0x00,0x00,0x70,
+ 0x00,0xfe,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xfc,0xff,0x3f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,0x00,0x00,0x00,0x38,0x80,0x3f,
+ 0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0xfc,0xff,0x3f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0xff,0x3f,0x38,0x00,0x00,0x00,0x00,0x1c,0xc0,0x0f,0x00,0x1c,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0x1f,0x38,0x00,0x00,0x00,0x00,0x1e,0xf0,0x03,0x00,0x1e,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x1e,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,
+ 0x1f,0x38,0x00,0x00,0x00,0x00,0x0f,0x7f,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x0f,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x1f,0x38,
+ 0x00,0x00,0x00,0x00,0x0f,0x7f,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x0f,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x1f,0x38,0x00,0x00,
+ 0x00,0x00,0xe7,0x3f,0x00,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0xfc,
+ 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x0f,0x38,0x00,0x00,0x00,0x80,
+ 0xfb,0x0f,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0xfc,0xff,0x7f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0x38,0x00,0x00,0x00,0xc0,0xff,0x01,
+ 0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0xf8,0xff,0xff,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xff,0xff,0x07,0x38,0x00,0x00,0x00,0xe0,0x3f,0x00,0x00,0xc0,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0xf8,0xff,0xff,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xff,0xff,0x07,0x38,0x00,0x00,0x00,0xe0,0x3f,0x00,0x00,0xc0,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0xc0,0x03,0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,
+ 0xff,0x07,0x38,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0x03,0xf8,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,
+ 0x38,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x01,0xf8,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0x38,0x00,
+ 0x00,0x00,0x70,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,
+ 0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x38,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0xf0,0xff,
+ 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0xf0,0xff,0xff,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x38,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0xf0,0xff,0xff,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0xe0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
+ 0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x78,0x00,0xe0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,
+ 0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x78,0x00,0xc0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x18,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,
+ 0x00,0xc0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x18,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0xc0,
+ 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x7f,0x00,0x1c,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x80,0xff,0xff,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x80,0xff,0xff,0x1f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0xff,0x1f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x80,0xff,0xff,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0x1f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,
+ 0x1f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x1f,0x00,0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,
+ 0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x0f,0x00,0x00,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x1c,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,
+ 0x00,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x07,0x00,0x1c,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfe,
+ 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfe,0xff,0x7f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xff,0xff,0x07,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x70,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfe,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xff,0xff,0x07,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,
+ 0xff,0x03,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0x03,0x00,0x00,0xfc,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,
+ 0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0x03,0x00,0x00,0xfc,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0x00,0x1e,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,
+ 0x00,0x00,0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0x00,0x1e,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,
+ 0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,0x1e,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0xf8,0xff,
+ 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0xff,0xff,0x01,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xf0,0xff,0xff,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0xff,0xff,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xf0,0xff,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
+ 0xff,0xff,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xf0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,
+ 0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0x01,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,
+ 0x3c,0x00,0x00,0x00,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x01,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,0x38,0x00,
+ 0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,
+ 0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x00,0x00,0x38,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xe0,
+ 0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0xff,0xff,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfc,0xff,0x1f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0x1f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,
+ 0x1f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0x01,0x00,0x00,0x80,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00,
+ 0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0x03,0x00,0x00,0x80,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x38,
+ 0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,
+ 0x00,0x00,0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x3c,0x00,0x00,
+ 0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,
+ 0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,
+ 0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0xff,
+ 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xff,0x07,0x00,0x00,0xfc,0x3f,0x00,0x00,0x00,0x00,0x00,0x3e,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0xfe,0xff,0x1f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x0f,0x00,0xe0,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,
+ 0xff,0x0f,0x3c,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x0e,0x00,0x00,0x00,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,
+ 0x3c,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x0e,0x00,0x00,0x00,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x01,0x00,0x38,0x00,
+ 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,
+ 0x00,0x00,0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x38,0x00,0x00,0x00,
+ 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,
+ 0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xff,0xff,0x03,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0xc0,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0xf8,0xff,
+ 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0x1f,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0xf8,0xff,0xff,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,
+ 0x01,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,
+ 0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0x00,0xfe,0x00,0x00,
+ 0x00,0x70,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xe0,0x03,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x1f,0x00,0xf8,0xff,0x00,0x00,0x00,0x70,
+ 0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x03,0x00,0x00,0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0x7f,0x00,0xe0,0xff,0x7f,0x00,0x00,0x00,0x70,0x00,0x00,
+ 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,
+ 0x00,0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xe0,0xff,0x03,0x00,0xf0,0xff,0x3f,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,
+ 0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0xe0,
+ 0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,
+ 0x03,0x00,0xf0,0xff,0x3f,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x78,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0xe0,0xff,0xff,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x7f,0x00,0x00,
+ 0xf8,0xff,0x3f,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x07,0x00,0x00,0xf8,0xff,
+ 0x1f,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0x01,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00,
+ 0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0x07,0x00,0xc0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xc0,0x1f,0x00,0x00,0x00,0xfe,0xff,0x1f,0x00,0x00,0x00,
+ 0xe0,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0x3f,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0x1f,0x00,0x00,0x00,0xfe,0xff,0x1f,0x00,0x00,0x00,0xe0,0x00,
+ 0x00,0x00,0x00,0x3c,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x3f,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x80,0x03,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,
+ 0x00,0x3e,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x01,
+ 0x80,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x3f,
+ 0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x3f,0x80,0xff,
+ 0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xff,0xff,0x07,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0xff,0x00,0x00,
+ 0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,0xfc,0xff,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,
+ 0xff,0x07,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0xf7,0x03,0x00,0x3c,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,0xc0,0xff,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,
+ 0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0xf7,0x03,0x00,0x3c,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,0xc0,0xff,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0x00,
+ 0x00,0xc0,0x01,0x00,0x00,0x80,0xe3,0x0f,0x00,0x3f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0x7f,0x00,0xf8,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0x00,0x00,0xc0,
+ 0x01,0x00,0x00,0x80,0xe3,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x80,0xff,0x03,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0x00,0x00,0xc0,0x01,0x00,
+ 0x00,0x80,0xc3,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,
+ 0x01,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
+ 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0x01,0xfe,
+ 0x7f,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x1f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0x01,0xfe,0x7f,0x38,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x1f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,
+ 0x00,0x00,0x00,0x00,0xc1,0x01,0x00,0x00,0xe0,0x00,0x3e,0x00,0x38,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x01,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x00,
+ 0x00,0x80,0xc3,0x01,0x00,0x00,0xe0,0x00,0x7c,0x00,0x3c,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,0x00,0xf0,
+ 0xc3,0x01,0x00,0x00,0xf0,0x00,0xf0,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x7f,0x00,0x00,0x00,0xf8,0xc3,0x01,
+ 0x00,0x00,0xf0,0x00,0xe0,0x01,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf8,0xff,0x7f,0x00,0x00,0x00,0xf8,0xc3,0x01,0x00,0x00,
+ 0xf0,0x00,0xe0,0x01,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0xff,0x7f,0x00,0x00,0x00,0xff,0xc3,0x03,0x00,0x00,0x70,0x00,
+ 0xc0,0x03,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x80,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf8,0xff,0x3f,0x00,0x00,0x80,0xff,0xc3,0x03,0x00,0x00,0x70,0x00,0xc0,0x03,
+ 0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,
+ 0xf0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,
+ 0x1f,0x00,0x00,0xe0,0xff,0xc3,0x03,0x00,0x00,0x78,0x00,0x80,0x07,0x3c,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x7f,0x00,0x00,0x00,
+ 0xfc,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00,
+ 0x00,0xf8,0xff,0xc3,0x03,0x00,0x00,0x78,0x00,0x00,0x0f,0x3c,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00,0x00,0xf8,
+ 0xff,0xc3,0x03,0x00,0x00,0x78,0x00,0x00,0x0f,0x3c,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x0f,0x00,0x00,0xfe,0xff,0x83,
+ 0x03,0x00,0x00,0x3c,0x00,0x00,0x1e,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfc,0xff,0x01,0xe0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x80,0xff,0xff,0x87,0x03,0x00,
+ 0x00,0x3c,0x00,0x00,0x3c,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,
+ 0xff,0xff,0xe1,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0xc0,0xff,0xff,0x87,0x03,0x00,0x00,0x3c,
+ 0x00,0x00,0x78,0x1c,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0xff,
+ 0xe1,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xff,0xff,0x07,0x00,0xf8,0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,
+ 0xe0,0x1c,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0xc0,0xff,
+ 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,
+ 0xff,0x07,0x00,0xf8,0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,0xe0,0x1c,
+ 0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x03,
+ 0x00,0xfe,0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,0xe0,0x1f,0x00,0x00,
+ 0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x07,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0xff,
+ 0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,0x80,0x1f,0x00,0x00,0x00,0xff,
+ 0xff,0x03,0x00,0x00,0x00,0xfc,0x03,0x80,0xff,0xff,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,
+ 0xc7,0x03,0x00,0x00,0x1e,0x00,0x00,0x00,0x1f,0x00,0x00,0xf8,0xff,0x0f,0x00,
+ 0x80,0xff,0xff,0xff,0x1f,0x00,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x01,0xf0,0xff,0xff,0xff,0xc3,0x03,
+ 0x00,0x00,0xfe,0xff,0x00,0x00,0x1f,0x00,0xe0,0xff,0x3f,0x00,0x00,0x80,0xff,
+ 0xff,0xff,0x3f,0x00,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0x00,0x00,
+ 0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x80,0xff,0xff,0xff,
+ 0x7f,0x00,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0x00,0x00,0xfe,0xff,
+ 0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,
+ 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,
+ 0xff,0xff,0x01,0xff,0xff,0xff,0xff,0x80,0x03,0x00,0x00,0xfe,0xff,0xff,0xff,
+ 0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0xfe,0xff,
+ 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,
+ 0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0xf5,0xff,0xff,
+ 0x3f,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x07,0xfe,0xff,0x1f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,0xf0,0xff,
+ 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x1f,0xfe,0xff,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,
+ 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,0x03,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,
+ 0xff,0xff,0xff,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,
+ 0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf8,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0xff,
+ 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,
+ 0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,
+ 0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0xff,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfc,0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,
+ 0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,
+ 0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,
+ 0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,
+ 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,
+ 0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0x01,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x3f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0x01,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xf0,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,
+ 0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,
+ 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,
+ 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x0f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf8,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xf8,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,
+ 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,
+ 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x07,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x3f,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x3f,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x80,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xfe,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,
+ 0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,
+ 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x3f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x7f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0xc0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
+ 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xf0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x1f,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0xc0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x1f,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,
+ 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x01,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x03,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x03,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
+ 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00};
#ifdef XROGER
"*logoColor: red3",
#endif
- "*eraseSpeed: 400",
- "*eraseMode: -1",
0
};
--- /dev/null
+/* xscreensaver, Copyright (c) 1997 Jamie Zawinski <jwz@netscape.com>
+ *
+ * Permission to use, copy, modify, distribute, and sell this software and its
+ * documentation for any purpose is hereby granted without fee, provided that
+ * the above copyright notice appear in all copies and that both that
+ * copyright notice and this permission notice appear in supporting
+ * documentation. No representations are made about the suitability of this
+ * software for any purpose. It is provided "as is" without express or
+ * implied warranty.
+ */
+
+#include "screenhack.h"
+#include <X11/Xutil.h>
+#include <stdio.h>
+
+static int ncolors, color_shift;
+static XColor *colors = 0;
+static int fg_pixel, bg_pixel;
+static Pixmap p0 = 0, p1 = 0, p2 = 0, p3 = 0;
+static GC copy_gc = 0, erase_gc = 0, window_gc = 0;
+static int width, height, size;
+static int x1, x2, y1, y2, x3, y3;
+static int dx1, dx2, dx3, dy1, dy2, dy3;
+static int othickness, thickness;
+static Bool do_three;
+
+static void
+init_moire2 (Display *dpy, Window window)
+{
+ XWindowAttributes xgwa;
+ XGetWindowAttributes (dpy, window, &xgwa);
+
+ othickness = get_integer_resource("thickness", "Thickness");
+
+ if (mono_p)
+ ncolors = 2;
+ else
+ ncolors = get_integer_resource ("colors", "Colors");
+ if (ncolors < 2) ncolors = 2;
+ if (ncolors <= 2) mono_p = True;
+
+ if (mono_p)
+ colors = 0;
+ else
+ colors = (XColor *) malloc(sizeof(*colors) * (ncolors+1));
+
+ if (mono_p)
+ ;
+ else
+ make_smooth_colormap (dpy, xgwa.visual, xgwa.colormap, colors, &ncolors,
+ True, 0, True);
+
+ bg_pixel = get_pixel_resource("background", "Background", dpy,
+ xgwa.colormap);
+ fg_pixel = get_pixel_resource("foreground", "Foreground", dpy,
+ xgwa.colormap);
+}
+
+
+static void
+reset_moire2 (Display *dpy, Window window)
+{
+ GC gc;
+ XWindowAttributes xgwa;
+ XGCValues gcv;
+ Bool xor;
+ XGetWindowAttributes (dpy, window, &xgwa);
+
+ do_three = (0 == (random() % 3));
+
+ width = xgwa.width;
+ height = xgwa.height;
+ size = width > height ? width : height;
+
+ if (p0) XFreePixmap(dpy, p0);
+ if (p1) XFreePixmap(dpy, p1);
+ if (p2) XFreePixmap(dpy, p2);
+ if (p3) XFreePixmap(dpy, p3);
+
+ p0 = XCreatePixmap(dpy, window, width, height, 1);
+ p1 = XCreatePixmap(dpy, window, width*2, height*2, 1);
+ p2 = XCreatePixmap(dpy, window, width*2, height*2, 1);
+ if (do_three)
+ p3 = XCreatePixmap(dpy, window, width*2, height*2, 1);
+ else
+ p3 = 0;
+
+ thickness = (othickness > 0 ? othickness : (1 + (random() % 4)));
+
+ gcv.foreground = 0;
+ gcv.line_width = (thickness == 1 ? 0 : thickness);
+ gc = XCreateGC (dpy, p1, GCForeground|GCLineWidth, &gcv);
+
+ XFillRectangle(dpy, p1, gc, 0, 0, width*2, height*2);
+ XFillRectangle(dpy, p2, gc, 0, 0, width*2, height*2);
+ if (do_three)
+ XFillRectangle(dpy, p3, gc, 0, 0, width*2, height*2);
+
+ XSetForeground(dpy, gc, 1);
+
+ xor = (do_three || (thickness == 1) || (random() & 1));
+
+ {
+ int i, ii, maxx, maxy;
+
+#define FROB(P) do { \
+ maxx = (size*4); \
+ maxy = (size*4); \
+ if (0 == (random() % 5)) { \
+ float f = 1.0 + frand(0.05); \
+ if (random() & 1) maxx *= f; \
+ else maxy *= f; \
+ } \
+ ii = (thickness + 1 + (xor ? 0 : 1) + (random() % (4 * thickness))); \
+ for (i = 0; i < (size*2); i += ii) \
+ XDrawArc(dpy, (P), gc, i-size, i-size, maxx-i-i, maxy-i-i, 0, 360*64); \
+ if (0 == (random() % 5)) \
+ { \
+ XSetFunction(dpy, gc, GXxor); \
+ XFillRectangle(dpy, (P), gc, 0, 0, width*2, height*2); \
+ XSetFunction(dpy, gc, GXcopy); \
+ } \
+ } while(0)
+
+ FROB(p1);
+ FROB(p2);
+ if (do_three)
+ FROB(p3);
+#undef FROB
+ }
+
+ XFreeGC(dpy, gc);
+
+ if (copy_gc) XFreeGC(dpy, copy_gc);
+ gcv.function = (xor ? GXxor : GXor);
+ gcv.foreground = 1;
+ gcv.background = 0;
+
+ copy_gc = XCreateGC (dpy, p0, GCFunction|GCForeground|GCBackground, &gcv);
+
+ gcv.foreground = 0;
+ if (erase_gc) XFreeGC(dpy, erase_gc);
+ erase_gc = XCreateGC (dpy, p0, GCForeground, &gcv);
+
+ gcv.foreground = fg_pixel;
+ gcv.background = bg_pixel;
+ if (window_gc) XFreeGC(dpy, window_gc);
+ window_gc = XCreateGC (dpy, window, GCForeground|GCBackground, &gcv);
+
+#define FROB(N,DN,MAX) \
+ N = (MAX/2) + (random() % MAX); \
+ DN = ((1 + (random() % (7*thickness))) * ((random() & 1) ? 1 : -1))
+
+ FROB(x1,dx1,width);
+ FROB(x2,dx2,width);
+ FROB(x3,dx3,width);
+ FROB(y1,dy1,height);
+ FROB(y2,dy2,height);
+ FROB(y3,dy3,height);
+#undef FROB
+}
+
+
+
+static void
+moire2 (Display *dpy, Window window)
+{
+#define FROB(N,DN,MAX) \
+ N += DN; \
+ if (N <= 0) N = 0, DN = -DN; \
+ else if (N >= MAX) N = MAX, DN = -DN; \
+ else if (0 == (random() % 100)) DN = -DN; \
+ else if (0 == (random() % 50)) \
+ DN += (DN <= -20 ? 1 : (DN >= 20 ? -1 : ((random() & 1) ? 1 : -1)))
+
+ FROB(x1,dx1,width);
+ FROB(x2,dx2,width);
+ FROB(x3,dx3,width);
+ FROB(y1,dy1,height);
+ FROB(y2,dy2,height);
+ FROB(y3,dy3,height);
+#undef FROB
+
+ XFillRectangle(dpy, p0, erase_gc, 0, 0, width, height);
+ XCopyArea(dpy, p1, p0, copy_gc, x1, y1, width, height, 0, 0);
+ XCopyArea(dpy, p2, p0, copy_gc, x2, y2, width, height, 0, 0);
+ if (do_three)
+ XCopyArea(dpy, p3, p0, copy_gc, x3, y3, width, height, 0, 0);
+
+ XSync(dpy, False);
+ XCopyPlane(dpy, p0, window, window_gc, 0, 0, width, height, 0, 0, 1L);
+ XSync(dpy, False);
+
+#if 0
+ XCopyPlane(dpy, p1, window, window_gc, (width*2)/3, (height*2)/3,
+ width/2, height/2,
+ 0, height/2, 1L);
+ XCopyPlane(dpy, p2, window, window_gc, (width*2)/3, (height*2)/3,
+ width/2, height/2,
+ width/2, height/2, 1L);
+#endif
+}
+
+
+
+\f
+char *progclass = "Moire2";
+
+char *defaults [] = {
+ "Moire2.background: black", /* to placate SGI */
+ "Moire2.foreground: white",
+ "*delay: 50000",
+ "*thickness: 0",
+ "*colors: 150",
+ "*colorShift: 5",
+ 0
+};
+
+XrmOptionDescRec options [] = {
+ { "-delay", ".delay", XrmoptionSepArg, 0 },
+ { "-ncolors", ".colors", XrmoptionSepArg, 0 },
+ { "-thickness", ".thickness", XrmoptionSepArg, 0 },
+ { 0, 0, 0, 0 }
+};
+
+void
+screenhack (Display *dpy, Window window)
+{
+ int delay = get_integer_resource ("delay", "Integer");
+ int color_shift = get_integer_resource ("colorShift", "Integer");
+ int pix = 0;
+ Bool flip_a, flip_b;
+
+ if (color_shift <= 0) color_shift = 1;
+ init_moire2 (dpy, window);
+ while (1)
+ {
+ int iterations = 30 + (random() % 70) + (random() % 70);
+ reset_moire2 (dpy, window);
+
+ flip_a = mono_p ? False : (random() & 1);
+ flip_b = mono_p ? False : (random() & 1);
+
+ if (flip_b)
+ {
+ XSetForeground(dpy, window_gc, bg_pixel);
+ XSetBackground(dpy, window_gc, fg_pixel);
+ }
+ else
+ {
+ XSetForeground(dpy, window_gc, fg_pixel);
+ XSetBackground(dpy, window_gc, bg_pixel);
+ }
+
+ while (--iterations > 0)
+ {
+ int i;
+
+ if (!mono_p)
+ {
+ pix++;
+ pix = pix % ncolors;
+
+ if (flip_a)
+ XSetBackground(dpy, window_gc, colors[pix].pixel);
+ else
+ XSetForeground(dpy, window_gc, colors[pix].pixel);
+ }
+
+ for (i = 0; i < color_shift; i++)
+ {
+ moire2 (dpy, window);
+ if (delay)
+ usleep(delay);
+ }
+ }
+ }
+}
drawamountain(mi);
break;
case 1:
-#ifdef STANDALONE
- XSync(MI_DISPLAY(mi), False);
- usleep(2000000);
-#else
MI_PAUSE(mi) = 2000000;
-#endif
/*if (++mp->time > MI_CYCLES(mi)); */
mp->stage++;
break;
-/* xscreensaver, Copyright (c) 1992, 1996, 1997
+/* xscreensaver, Copyright (c) 1992, 1996, 1997, 1998
* Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
#ifdef HAVE_XPM
# include <X11/xpm.h>
-# include "noses/nose-f1.xpm"
-# include "noses/nose-f2.xpm"
-# include "noses/nose-f3.xpm"
-# include "noses/nose-f4.xpm"
-# include "noses/nose-l1.xpm"
-# include "noses/nose-l2.xpm"
-# include "noses/nose-r1.xpm"
-# include "noses/nose-r2.xpm"
+# include "images/noseguy/nose-f1.xpm"
+# include "images/noseguy/nose-f2.xpm"
+# include "images/noseguy/nose-f3.xpm"
+# include "images/noseguy/nose-f4.xpm"
+# include "images/noseguy/nose-l1.xpm"
+# include "images/noseguy/nose-l2.xpm"
+# include "images/noseguy/nose-r1.xpm"
+# include "images/noseguy/nose-r2.xpm"
#else
-# include "noses/nose-f1.xbm"
-# include "noses/nose-f2.xbm"
-# include "noses/nose-f3.xbm"
-# include "noses/nose-f4.xbm"
-# include "noses/nose-l1.xbm"
-# include "noses/nose-l2.xbm"
-# include "noses/nose-r1.xbm"
-# include "noses/nose-r2.xbm"
+# include "images/noseguy/nose-f1.xbm"
+# include "images/noseguy/nose-f2.xbm"
+# include "images/noseguy/nose-f3.xbm"
+# include "images/noseguy/nose-f4.xbm"
+# include "images/noseguy/nose-l1.xbm"
+# include "images/noseguy/nose-l2.xbm"
+# include "images/noseguy/nose-r1.xbm"
+# include "images/noseguy/nose-r2.xbm"
#endif
static void
+++ /dev/null
-#define nose_f1_width 64
-#define nose_f1_height 64
-static unsigned char nose_f1_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0xc0,0x1f,0x00,0x20,0x00,0x00,0x08,0x00,0x30,0x60,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0x0f,0x80,0xff,0x3f,0x00,0x00,0x00,0x02,0x02,0x00,0x82,0x00,
- 0x00,0x00,0x00,0x03,0x01,0x00,0x84,0x01,0x00,0x00,0x00,0x81,0x00,0x00,0x08,
- 0x01,0x00,0x00,0x80,0x80,0x00,0x00,0x08,0x02,0x00,0x00,0x80,0x40,0x00,0x00,
- 0x10,0x02,0x00,0x00,0x40,0x40,0x00,0x00,0x10,0x04,0x00,0x00,0x40,0x20,0x00,
- 0x00,0x20,0x04,0x00,0x00,0x60,0x20,0x00,0x00,0x20,0x0c,0x00,0x00,0x20,0x20,
- 0x00,0x00,0x20,0x08,0x00,0x00,0x20,0x20,0x00,0x00,0x20,0x08,0x00,0x00,0x10,
- 0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,
- 0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,
- 0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,
- 0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,0x00,0x00,0x30,0x00,0x01,0x00,0x04,
- 0x18,0x00,0x00,0x20,0x00,0x02,0x00,0x02,0x08,0x00,0x00,0x20,0x00,0x0c,0x80,
- 0x01,0x08,0x00,0x00,0x60,0x00,0x30,0x60,0x00,0x0c,0x00,0x00,0x40,0x00,0xc0,
- 0x1f,0x00,0x04,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0xc0,0x0f,0x00,0x00,0x00,
- 0x00,0x40,0x10,0x20,0x10,0x00,0x00,0x00,0x00,0x20,0x60,0x30,0x20,0x00,0x00,
- 0x00,0x00,0x20,0xc0,0x18,0x20,0x00,0x00,0xc0,0x7f,0x10,0x80,0x0d,0x40,0xe0,
- 0x01,0x70,0xc0,0x18,0x00,0x05,0x40,0x1c,0x06,0x10,0x00,0x0f,0x00,0x05,0x80,
- 0x07,0x08,0x08,0x00,0x06,0x00,0x05,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x05,
- 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80,
- 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00,
- 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00,
- 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84,
- 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08,
- 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff,
- 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_f1_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXX. ",
-" .................ooooooooooo............... ",
-" .OOOOOOO.ooooooooooooooo.OOOOO. ",
-" ..OOOOOO.ooooooooooooooooo.OOOO.. ",
-" .OOOOOO.ooooooooooooooooooo.OOOO. ",
-" .OOOOOOO.ooooooooooooooooooo.OOOOO. ",
-" .OOOOOO.ooooooooooooooooooooo.OOOO. ",
-" .OOOOOOO.ooooooooooooooooooooo.OOOOO. ",
-" .OOOOOO.ooooooooooooooooooooooo.OOOO. ",
-" ..OOOOOO.ooooooooooooooooooooooo.OOOO.. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
-" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ",
-" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ",
-" ..OOOOOOOOOO.ooooooooooooooooo.OOOOOOOO.. ",
-" .OOOOOOOOOOO.ooooooooooooooo.OOOOOOOOO. ",
-" .OOOOOOOOOOOO..ooooooooooo..OOOOOOOOOO. ",
-" ..OOOOOOOOOOOOO..ooooooo..OOOOOOOOOOO.. ",
-" .OOOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" ................................ ",
-" ",
-" ..... ...... ",
-" .+++++. .++++++. ",
-" .+++++++.. ..+++++++. ",
-" .++++++++.. ..++++++++. ",
-" ......... .++++++++++.. ..++++++++++. .... ",
-" ...+++++++.. ..+++++++++++. .+++++++++++. ...++++.. ",
-" .+++++++++++....@+++++++++++. .+++++++++++@....++++++++. ",
-" .+++++++++++++..@@+++++++++++. .++++++++++@@..++++++++++. ",
-" .+++++++++++++++..@++++++++++. .+++++++++@@..++++++++++++. ",
-" .+++++++++++++++++..@+++++++++. .++++++++@..++++++++++++++. ",
-" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ",
-" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ",
-" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ",
-" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ",
-" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.@++. ",
-" .+@@.+++++++++++++++++++++++. .+++++++++++++++++++.@@+. ",
-" .++@@..+++++++++++++++++++++.. ..+++++++++++++++++..@@++. ",
-" .++@@++++++++++++++++++++++@. .@++++++++++++++++++@@++. ",
-" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ",
-" ........................... ....................... ",
-" ",
-" "};
+++ /dev/null
-#define nose_f2_width 64
-#define nose_f2_height 64
-static unsigned char nose_f2_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0xe0,0x0f,0x00,0x20,0x00,0x00,0x08,0x00,0x18,0x30,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0x07,0xc0,0xff,0x3f,0x00,0x00,0x00,0x02,0x01,0x00,0x81,0x00,
- 0x00,0x00,0x00,0x83,0x00,0x00,0x82,0x01,0x00,0x00,0x00,0x41,0x00,0x00,0x04,
- 0x01,0x00,0x00,0x80,0x40,0x00,0x00,0x04,0x02,0x00,0x00,0x80,0x20,0x00,0x00,
- 0x08,0x02,0x00,0x00,0x40,0x20,0x00,0x00,0x08,0x04,0x00,0x00,0x40,0x10,0x00,
- 0x00,0x10,0x04,0x00,0x00,0x60,0x10,0x00,0x00,0x10,0x0c,0x00,0x00,0x20,0x10,
- 0x00,0x00,0x10,0x08,0x00,0x00,0x30,0x10,0x00,0x00,0x10,0x08,0x00,0x00,0x10,
- 0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,
- 0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,
- 0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x04,0x10,
- 0x00,0x00,0x30,0x40,0x00,0x00,0x04,0x10,0x00,0x00,0x20,0x80,0x00,0x00,0x02,
- 0x18,0x00,0x00,0x20,0x00,0x01,0x00,0x01,0x08,0x00,0x00,0x60,0x00,0x06,0xc0,
- 0x00,0x08,0x00,0x00,0x80,0x00,0x18,0x30,0x00,0x0c,0x00,0x00,0x80,0x00,0xe0,
- 0x0f,0x00,0x04,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,
- 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xe0,0x00,0x07,0x02,0x10,0x00,0x00,
- 0x00,0x30,0x00,0x8c,0x01,0x20,0x00,0x00,0x00,0x0c,0x00,0x90,0x00,0x20,0x00,
- 0x00,0x00,0x04,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20,
- 0x00,0x00,0x00,0x42,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x02,
- 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x06,0x20,0x00,0x00,0x00,0x21,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x03,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_f2_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ",
-" ................ooooooooooo................ ",
-" .OOOOOO.ooooooooooooooo.OOOOOO. ",
-" ..OOOOO.ooooooooooooooooo.OOOOO.. ",
-" .OOOOO.ooooooooooooooooooo.OOOOO. ",
-" .OOOOOO.ooooooooooooooooooo.OOOOOO. ",
-" .OOOOO.ooooooooooooooooooooo.OOOOO. ",
-" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ",
-" .OOOOO.ooooooooooooooooooooooo.OOOOO. ",
-" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ",
-" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
-" ..OOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
-" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ",
-" ..OOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ",
-" .OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO.. ",
-" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ",
-" ..OOOOOOOOOO..ooooooooooo..OOOOOOOOOOO. ",
-" .OOOOOOOOOOO..ooooooo..OOOOOOOOOOOO.. ",
-" .OOOOOOOOOOOOO.......OOOOOOOOOOOOOO. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" ................................ ",
-" ",
-" ......... ",
-" ........ .+++++++++. ",
-" ...++++++++... .++++++++++. ",
-" ..++++++++++++.. ..++++++++++++. ",
-" ..++++++++++++++++. .@++++++++++++. ",
-" .++++@..+++++++++++..@@++++++++++++. ",
-" .++++..++++++++++++++..@++++++++++++. ",
-" .+++@.+++++++++++++++++.@+++++++++++. ",
-" .+++@.+++++++++++++++++++.@++++++++++. ",
-" .+++@.+++++++++++++++++++..++++++++++. ",
-" .+++@.+++++++++++++++++++++++++++++++. ",
-" .++++++++++++++++++++++++++++++++++++@. ",
-" ..@++++++++++++++++++++++++++++++++++@. ",
-" .@@+++++++++++++++++++++++++++++++++@. ",
-" .@@++++++++++++++++++++++++++++++++@@. ",
-" .@@@++++++++++++++++++++++++++++++@. ",
-" ..@@@++++++++++++++++++++@@@++++@@. ",
-" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ",
-" .............................. ",
-" ",
-" ",
-" "};
+++ /dev/null
-#define nose_f3_width 64
-#define nose_f3_height 64
-static unsigned char nose_f3_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
- 0x04,0x00,0xf0,0x07,0x00,0x10,0x00,0x00,0x04,0x00,0x0c,0x18,0x00,0x10,0x00,
- 0x00,0xfc,0xff,0x03,0xe0,0xff,0x1f,0x00,0x00,0x00,0x81,0x00,0x80,0x40,0x00,
- 0x00,0x00,0x80,0x41,0x00,0x00,0xc1,0x00,0x00,0x00,0x80,0x20,0x00,0x00,0x82,
- 0x00,0x00,0x00,0x40,0x20,0x00,0x00,0x02,0x01,0x00,0x00,0x40,0x10,0x00,0x00,
- 0x04,0x01,0x00,0x00,0x20,0x10,0x00,0x00,0x04,0x02,0x00,0x00,0x20,0x08,0x00,
- 0x00,0x08,0x02,0x00,0x00,0x30,0x08,0x00,0x00,0x08,0x06,0x00,0x00,0x10,0x08,
- 0x00,0x00,0x08,0x04,0x00,0x00,0x10,0x08,0x00,0x00,0x08,0x0c,0x00,0x00,0x08,
- 0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,
- 0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,
- 0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x08,
- 0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x0c,0x00,0x00,0x18,0x40,0x00,0x00,0x01,
- 0x04,0x00,0x00,0x10,0x80,0x00,0x80,0x00,0x04,0x00,0x00,0x10,0x00,0x03,0x60,
- 0x00,0x06,0x00,0x00,0x30,0x00,0x0c,0x18,0x00,0x01,0x00,0x00,0x20,0x00,0xf0,
- 0x07,0x00,0x01,0x00,0x00,0x60,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0x40,0xe0,0x00,0x07,0x00,
- 0x00,0x00,0x04,0x80,0x31,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x09,0x00,0x30,
- 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x20,0x00,0x00,0x00,0x04,0x00,0x03,0x00,
- 0x43,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x42,0x00,0x00,0x00,0x04,0x40,0x00,
- 0x00,0x84,0x00,0x00,0x00,0x04,0x60,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0xc0,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00,
- 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_f3_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ",
-" ................ooooooooooo................ ",
-" .OOOOOO.ooooooooooooooo.OOOOOO. ",
-" ..OOOOO.ooooooooooooooooo.OOOOO.. ",
-" .OOOOO.ooooooooooooooooooo.OOOOO. ",
-" .OOOOOO.ooooooooooooooooooo.OOOOOO. ",
-" .OOOOO.ooooooooooooooooooooo.OOOOO. ",
-" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ",
-" .OOOOO.ooooooooooooooooooooooo.OOOOO. ",
-" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ",
-" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ",
-" .OOOOOO.ooooooooooooooooooooooo.OOOOOO.. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
-" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ",
-" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ",
-" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOO.. ",
-" ..OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO. ",
-" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ",
-" .OOOOOOOOOOO..ooooooooooo..OOOOOOOOOO.. ",
-" ..OOOOOOOOOOOO..ooooooo..OOOOOOOOOOO. ",
-" .OOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" ................................ ",
-" ",
-" ......... ",
-" .+++++++++. ........ ",
-" .++++++++++. ...++++++++... ",
-" .++++++++++++.. ..++++++++++++.. ",
-" .++++++++++++@. .++++++++++++++++.. ",
-" .++++++++++++@@..+++++++++++..@++++. ",
-" .++++++++++++@..++++++++++++++..++++. ",
-" .+++++++++++@.+++++++++++++++++.@+++. ",
-" .++++++++++@.+++++++++++++++++++.@+++. ",
-" .++++++++++..+++++++++++++++++++.@+++. ",
-" .+++++++++++++++++++++++++++++++.@+++. ",
-" .@++++++++++++++++++++++++++++++++++++. ",
-" .@++++++++++++++++++++++++++++++++++@.. ",
-" .@+++++++++++++++++++++++++++++++++@@. ",
-" .@@++++++++++++++++++++++++++++++++@@. ",
-" .@++++++++++++++++++++++++++++++@@@. ",
-" .@@++++@@@++++++++++++++++++++@@@.. ",
-" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ",
-" .............................. ",
-" ",
-" ",
-" "};
+++ /dev/null
-#define nose_f4_width 64
-#define nose_f4_height 64
-static unsigned char nose_f4_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x1e,0x00,
- 0x00,0x00,0x00,0x38,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,
- 0x03,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x04,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x08,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x10,0x00,0x80,
- 0x1f,0x00,0x40,0x00,0x00,0x08,0x00,0x60,0x60,0x00,0x80,0x00,0x00,0x08,0x00,
- 0x10,0x80,0x00,0x80,0x00,0x00,0x04,0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x04,
- 0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x02,0x00,0x18,0x80,0x01,0x00,0x02,0x00,
- 0x02,0x00,0x68,0x60,0x01,0x00,0x02,0x00,0x02,0x00,0x88,0x1f,0x01,0x00,0x02,
- 0x00,0x02,0x00,0x08,0x00,0x01,0x00,0x02,0x00,0x02,0x00,0x10,0x80,0x00,0x00,
- 0x03,0x00,0x06,0x00,0x60,0x60,0x00,0x80,0x02,0x00,0x0c,0x00,0x80,0x1f,0x00,
- 0x40,0x01,0x00,0x14,0x00,0x00,0x00,0x00,0x20,0x01,0x00,0x28,0x00,0x00,0x00,
- 0x00,0x90,0x00,0x00,0x50,0x00,0x00,0x00,0x00,0x48,0x00,0x00,0xa0,0x01,0x00,
- 0x00,0x00,0x26,0x00,0x00,0x40,0x1e,0x00,0x00,0xc0,0x11,0x00,0x00,0x80,0xe1,
- 0x03,0x00,0x3c,0x0c,0x00,0x00,0x00,0x0e,0xfc,0xff,0x83,0x03,0x00,0x00,0x00,
- 0xf0,0x01,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,
- 0x00,0x80,0x03,0x00,0x0c,0x00,0x00,0x00,0x00,0x80,0x02,0x00,0x14,0x00,0x00,
- 0x00,0x00,0x60,0x04,0x00,0x12,0x00,0x00,0xc0,0x7f,0x10,0x04,0x00,0x22,0xe0,
- 0x01,0x70,0xc0,0x18,0x08,0x00,0x61,0x1c,0x06,0x10,0x00,0x0f,0x30,0xc0,0x80,
- 0x07,0x08,0x08,0x00,0x06,0xc0,0x3f,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x02,
- 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80,
- 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00,
- 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00,
- 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84,
- 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08,
- 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff,
- 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_f4_xpm[] = {
-"64 64 6 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ............... ",
-" ....XXXXXXXXXXXXXXX.... ",
-" ...XXXXXXXXXXXXXXXXXXXXXXX... ",
-" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ",
-" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ",
-" .XXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXX..XXXXXXXXXX..XXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXX.X..XXXXXX..X.XXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXX.XXX......XXX.XXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXXX.. ",
-" ..XXXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. . ",
-" ..XXXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX.X. ",
-" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ",
-" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ",
-" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ",
-" .X..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..XX. ",
-" .XX....XXXXXXXXXXXXXXXXXXXXXXXXX...XXX. ",
-" ..XXXX.....XXXXXXXXXXXXXXXX....XXXX.. ",
-" ...XXXXXX................XXXXX... ",
-" .....XXXXXXXXXXXXXXXXXX.... ",
-" ................... ",
-" ...oooooooooooooooo.. ",
-" .+.oooooooooooooooo.+. ",
-" ..+++.oooooooooooooo.++. ",
-" ......... .+++++.oooooooooooooo.+++. .... ",
-" ...+++++++.. ..++++++.oooooooooooo.++++.. ...++++.. ",
-" .+++++++++++....@+++++++..oooooooo..++++++@....++++++++. ",
-" .+++++++++++++..@@+++++++++........+++++++@@..++++++++++. ",
-" .+++++++++++++++..@+++++++++++.++++++++++@@..++++++++++++. ",
-" .+++++++++++++++++..++++++++++. .+++++++++..++++++++++++++. ",
-" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ",
-" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ",
-" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ",
-" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ",
-" .++.++++++++++++++++++++++++. .++++++++++++++++++++.@+@. ",
-" .@+@.+++++++++++++++++++++++. .+++++++++++++++++++.@+@. ",
-" .@@+@..++++++++++++++++++++@.. ..@++++++++++++++++..@++@. ",
-" .@@+++++++++++++++++++++++@@. .@@+++++++++++++++++++@@. ",
-" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ",
-" ........................... ....................... ",
-" ",
-" "};
+++ /dev/null
-#define nose_l1_width 64
-#define nose_l1_height 64
-static unsigned char nose_l1_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00,
- 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00,
- 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00,
- 0x18,0x00,0x20,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x40,0x00,0x80,0x00,0x00,
- 0x00,0x08,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x00,0x01,0x20,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x06,0x18,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x07,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,
- 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xc0,0x00,0x03,0x03,0x10,0x00,0x00,
- 0x00,0x30,0x00,0x0c,0x01,0x20,0x00,0x00,0x00,0x08,0x00,0x98,0x00,0x20,0x00,
- 0x00,0x00,0x0c,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20,
- 0x00,0x00,0x00,0x42,0x00,0x80,0x00,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,
- 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_l1_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .............................. ",
-" ",
-" ......... ",
-" ........ .+++++++++. ",
-" ...++++++++... .++++++++++. ",
-" ..++++++++++++.. ..++++++++++++. ",
-" ..++++++++++++++++. .@++++++++++++. ",
-" .++++@..+++++++++++..@@++++++++++++. ",
-" .++++..++++++++++++++..@++++++++++++. ",
-" .+++@.+++++++++++++++++.@+++++++++++. ",
-" .+++@.+++++++++++++++++++.@++++++++++. ",
-" .+++@.+++++++++++++++++++..++++++++++. ",
-" .+++@.+++++++++++++++++++++++++++++++. ",
-" .++++++++++++++++++++++++++++++++++++@. ",
-" ..@++++++++++++++++++++++++++++++++++@. ",
-" .@@+++++++++++++++++++++++++++++++++@. ",
-" .@@++++++++++++++++++++++++++++++++@@. ",
-" .@@@++++++++++++++++++++++++++++++@. ",
-" ..@@@++++++++++++++++++++@@@++++@@. ",
-" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ",
-" .............................. ",
-" ",
-" ",
-" "};
+++ /dev/null
-#define nose_l2_width 64
-#define nose_l2_height 64
-static unsigned char nose_l2_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00,
- 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00,
- 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00,
- 0x18,0x00,0x10,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x20,0x00,0x80,0x00,0x00,
- 0x00,0x08,0x00,0x40,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x80,0x00,0x20,0x00,
- 0x00,0x00,0xe4,0x00,0x00,0x03,0x18,0x00,0x00,0x00,0x26,0x03,0x00,0xfc,0x07,
- 0x00,0x00,0x00,0x12,0x0c,0x00,0x00,0xf8,0xff,0xff,0xff,0x11,0x10,0x80,0x1f,
- 0x00,0x00,0x00,0x00,0x08,0x20,0x60,0x60,0xc0,0x07,0x00,0x00,0x04,0x40,0x10,
- 0xc0,0x20,0x08,0x00,0x1f,0x02,0x40,0x08,0x00,0x21,0x10,0xc0,0x60,0x02,0x40,
- 0x04,0x00,0x12,0x20,0x20,0x80,0x02,0x20,0xc2,0x00,0x14,0x40,0x18,0x00,0x03,
- 0x20,0x22,0x00,0x0c,0x80,0x04,0x03,0x02,0x10,0x12,0x00,0x08,0x80,0x86,0x00,
- 0x04,0x10,0x12,0x00,0x10,0x80,0x42,0x00,0x18,0x08,0x12,0x00,0x10,0x40,0x42,
- 0x00,0x00,0x04,0x02,0x00,0x20,0x40,0x42,0x00,0x00,0x04,0x02,0x00,0x00,0x20,
- 0x42,0x00,0x00,0x02,0x04,0x00,0x00,0x20,0x02,0x00,0x00,0x01,0x04,0x00,0x00,
- 0x20,0x02,0x00,0x00,0x01,0x08,0x00,0x00,0x20,0x04,0x00,0x80,0x00,0x10,0x00,
- 0x00,0x20,0x0c,0x00,0x80,0x00,0x60,0x00,0x00,0x10,0x08,0x00,0x40,0x00,0x80,
- 0xff,0xff,0x0f,0x30,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x0f,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_l2_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ",
-" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ",
-" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ... ",
-" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. .++.. ",
-" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. .+++++.. ",
-" .............................. .+++++++. ",
-" ...... .+++++++++. ",
-" ..++++++.. ..... .++++++++++@. ",
-" .+++++++++.. .+++++. ..... .+++++++++++@. ",
-" .++++++++++++. .++++++. ..+++++.. .++++++++++@@. ",
-" .++++++++++++++. .++++++++. .+++++++++. .@+++++++++@. ",
-" .++++..++++++++++. .+++++++++. ..+++++++++++..@++++++++@@. ",
-" .+++.@@++++++++++..@++++++++++. .+++++..+++++++.@@+++++++@. ",
-" .++.@+++++++++++++.@@+++++++++. ..++++.@@++++++++.@@+++++@@. ",
-" .++.@++++++++++++++.@+++++++++. .++++.@+++++++++++..++++@@. ",
-" .++.@++++++++++++++.@++++++++. .++++.@+++++++++++++++++@. ",
-" .@++++++++++++++++++.@+++++++. .++++.@++++++++++++++++@@. ",
-" .@@+++++++++++++++++++++++++. .++++.@+++++++++++++++@@. ",
-" .@++++++++++++++++++++++++@. .+++++++++++++++++++++@. ",
-" .@@+++++++++++++++++++++++@. .++++++++++++++++++++@@. ",
-" .@@++++++++++++++++++++++@. .+++++++++++++++++++@. ",
-" .@@@+++++++++++++++++++@@. ..+++++++++++++++++@@. ",
-" ..@@@@@@@@@@@@@@@@@@@@@. .@@@+++@@@++++++@@@. ",
-" ..................... ..@@@@@@@@@@@@@@.. ",
-" .............. ",
-" ",
-" ",
-" ",
-" "};
+++ /dev/null
-#define nose_r1_width 64
-#define nose_r1_height 64
-static unsigned char nose_r1_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f,
- 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c,
- 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00,
- 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x18,0x00,0x00,0x80,0x00,
- 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
- 0x01,0x00,0x02,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x20,0x00,0x00,
- 0x00,0x04,0x80,0x00,0x00,0x60,0x00,0x00,0x00,0x18,0x60,0x00,0x00,0x40,0x00,
- 0x00,0x00,0xe0,0x1f,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0xc0,0xc0,0x00,0x03,0x00,
- 0x00,0x00,0x04,0x80,0x30,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x19,0x00,0x10,
- 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x30,0x00,0x00,0x00,0x04,0x00,0x03,0x00,
- 0x43,0x00,0x00,0x00,0x04,0x00,0x01,0x00,0x42,0x00,0x00,0x00,0x04,0x80,0x00,
- 0x00,0x84,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00,
- 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_r1_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ",
-" .............................. ",
-" ",
-" ......... ",
-" .+++++++++. ........ ",
-" .++++++++++. ...++++++++... ",
-" .++++++++++++.. ..++++++++++++.. ",
-" .++++++++++++@. .++++++++++++++++.. ",
-" .++++++++++++@@..+++++++++++..@++++. ",
-" .++++++++++++@..++++++++++++++..++++. ",
-" .+++++++++++@.+++++++++++++++++.@+++. ",
-" .++++++++++@.+++++++++++++++++++.@+++. ",
-" .++++++++++..+++++++++++++++++++.@+++. ",
-" .+++++++++++++++++++++++++++++++.@+++. ",
-" .@++++++++++++++++++++++++++++++++++++. ",
-" .@++++++++++++++++++++++++++++++++++@.. ",
-" .@+++++++++++++++++++++++++++++++++@@. ",
-" .@@++++++++++++++++++++++++++++++++@@. ",
-" .@++++++++++++++++++++++++++++++@@@. ",
-" .@@++++@@@++++++++++++++++++++@@@.. ",
-" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ",
-" .............................. ",
-" ",
-" ",
-" "};
+++ /dev/null
-#define nose_r2_width 64
-#define nose_r2_height 64
-static unsigned char nose_r2_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f,
- 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c,
- 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00,
- 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x18,0x00,0x00,0x80,0x00,
- 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x08,0x00,0x10,0x00,0x00,0x00,
- 0x01,0x00,0x04,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x02,0x00,0x27,0x00,0x00,
- 0x00,0x04,0x00,0x01,0xc0,0x64,0x00,0x00,0x00,0x18,0xc0,0x00,0x30,0x48,0x00,
- 0x00,0x00,0xe0,0x3f,0x00,0x08,0x88,0xff,0xff,0xff,0x1f,0x00,0x00,0x04,0x10,
- 0x00,0x00,0x00,0x00,0xf8,0x01,0x02,0x20,0x00,0x00,0xe0,0x03,0x06,0x06,0x02,
- 0x40,0xf8,0x00,0x10,0x04,0x03,0x08,0x02,0x40,0x06,0x03,0x08,0x84,0x00,0x10,
- 0x04,0x40,0x01,0x04,0x04,0x48,0x00,0x20,0x04,0xc0,0x00,0x18,0x02,0x28,0x00,
- 0x43,0x08,0x40,0xc0,0x20,0x01,0x30,0x00,0x44,0x08,0x20,0x00,0x61,0x01,0x10,
- 0x00,0x48,0x10,0x18,0x00,0x42,0x01,0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,
- 0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,0x04,0x00,0x40,0x40,0x00,0x00,0x42,
- 0x04,0x00,0x00,0x40,0x80,0x00,0x00,0x40,0x04,0x00,0x00,0x20,0x80,0x00,0x00,
- 0x40,0x04,0x00,0x00,0x20,0x00,0x01,0x00,0x20,0x04,0x00,0x00,0x10,0x00,0x01,
- 0x00,0x30,0x04,0x00,0x00,0x08,0x00,0x02,0x00,0x10,0x08,0x00,0x00,0x06,0x00,
- 0x0c,0x00,0x0c,0xf0,0xff,0xff,0x01,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/* XPM */
-static char * nose_r2_xpm[] = {
-"64 64 7 1",
-" c black m black",
-". c black m white",
-"X c gray m black",
-"o c yellow m black",
-"O c yellow2 m black",
-"+ c purple m black",
-"@ c purple3 m black",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ",
-" ..................... ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ",
-" ........................................... ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ",
-" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ",
-" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ",
-" ... .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ",
-" ..++. ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ",
-" ..+++++. .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ",
-" .+++++++. .............................. ",
-" .+++++++++. ...... ",
-" .@++++++++++. ..... ..++++++.. ",
-" .@+++++++++++. ..... .+++++. ..+++++++++. ",
-" .@@++++++++++. ..+++++.. .++++++. .++++++++++++. ",
-" .@+++++++++@. .+++++++++. .++++++++. .++++++++++++++. ",
-" .@@++++++++@..+++++++++++.. .+++++++++. .++++++++++..++++. ",
-" .@+++++++@@.+++++++..+++++. .++++++++++@..++++++++++@@.+++. ",
-" .@@+++++@@.++++++++@@.++++.. .+++++++++@@.+++++++++++++@.++. ",
-" .@@++++..+++++++++++@.++++. .+++++++++@.++++++++++++++@.++. ",
-" .@+++++++++++++++++@.++++. .++++++++@.++++++++++++++@.++. ",
-" .@@++++++++++++++++@.++++. .+++++++@.++++++++++++++++++@. ",
-" .@@+++++++++++++++@.++++. .+++++++++++++++++++++++++@@. ",
-" .@+++++++++++++++++++++. .@++++++++++++++++++++++++@. ",
-" .@@++++++++++++++++++++. .@+++++++++++++++++++++++@@. ",
-" .@+++++++++++++++++++. .@++++++++++++++++++++++@@. ",
-" .@@+++++++++++++++++.. .@@+++++++++++++++++++@@@. ",
-" .@@@++++++@@@+++@@@. .@@@@@@@@@@@@@@@@@@@@@.. ",
-" ..@@@@@@@@@@@@@@.. ..................... ",
-" .............. ",
-" ",
-" ",
-" ",
-" "};
+++ /dev/null
-#define puzzle_width 523
-#define puzzle_height 366
-static char puzzle_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,
- 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x0c,0x00,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
- 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,
- 0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xc0,0x07,
- 0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x0e,0x00,0x00,
- 0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c,
- 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0xc0,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c,
- 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x0c,0x00,0x00,
- 0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x60,
- 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30,
- 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,
- 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0xf8,
- 0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x80,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0xf8,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x00,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0xf8,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x40,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8,
- 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x10,0xf8,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x80,0xf8,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,
- 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf9,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,
- 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xfa,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xfc,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,
- 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xfa,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x10,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0xf8,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x10,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,
- 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0xf8,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x02,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x02,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x08,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0xf8,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x80,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0xf8,
- 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,
- 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x60,0x00,0x00,0x00,
- 0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0xf8,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00,
- 0x18,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0xc0,0x00,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x0c,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c,
- 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0xc0,0x00,0x00,
- 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,
- 0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x0e,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0xc0,0x07,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,
- 0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,
- 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x00,0x00,
- 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,
- 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,
- 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,
- 0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x80,0x07,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xf8};
+++ /dev/null
-#define puzzle_a_e_f_width 88
-#define puzzle_a_e_f_height 78
-#define puzzle_a_e_f_x_hot 20
-#define puzzle_a_e_f_y_hot 6
-static unsigned char puzzle_a_e_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
- 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff,
- 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f,
- 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00,
- 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7e, 0x80, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x00, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00,
- 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f,
- 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00,
- 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_e_h_width 88
-#define puzzle_a_e_h_height 78
-#define puzzle_a_e_h_x_hot 20
-#define puzzle_a_e_h_y_hot 6
-static unsigned char puzzle_a_e_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00,
- 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60,
- 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00,
- 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00,
- 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00,
- 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18,
- 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00,
- 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
- 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x07, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7e, 0x80, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0,
- 0x00, 0x70, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00,
- 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, 0x01,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30,
- 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00,
- 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c,
- 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00,
- 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00,
- 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_f_width 108
-#define puzzle_a_f_height 78
-#define puzzle_a_f_x_hot 20
-#define puzzle_a_f_y_hot 5
-static unsigned char puzzle_a_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
- 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f,
- 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
- 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00, 0xc0, 0xff,
- 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8,
- 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
- 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
- 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07,
- 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_h_width 108
-#define puzzle_a_h_height 78
-#define puzzle_a_h_x_hot 20
-#define puzzle_a_h_y_hot 5
-static unsigned char puzzle_a_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
- 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c,
- 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
- 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
- 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
- 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00,
- 0xf0, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00, 0xc0, 0xff,
- 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, 0x3f, 0x00,
- 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f,
- 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x3e, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00, 0xe0, 0x80,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, 0x70, 0x00,
- 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8,
- 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00,
- 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0,
- 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38,
- 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
- 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00,
- 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07,
- 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_n_f_width 108
-#define puzzle_a_n_f_height 73
-#define puzzle_a_n_f_x_hot 21
-#define puzzle_a_n_f_y_hot 1
-static unsigned char puzzle_a_n_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e,
- 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8,
- 0x3f, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
- 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
- 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f,
- 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_n_h_width 108
-#define puzzle_a_n_h_height 73
-#define puzzle_a_n_h_x_hot 21
-#define puzzle_a_n_h_y_hot 1
-static unsigned char puzzle_a_n_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e,
- 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00,
- 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8,
- 0x3f, 0x00, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf0, 0x3f, 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00,
- 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00,
- 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f,
- 0x70, 0x00, 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
- 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
- 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80,
- 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c,
- 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_ne_f_width 89
-#define puzzle_a_ne_f_height 74
-#define puzzle_a_ne_f_x_hot 21
-#define puzzle_a_ne_f_y_hot 1
-static unsigned char puzzle_a_ne_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xfe, 0x7f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_ne_h_width 89
-#define puzzle_a_ne_h_height 74
-#define puzzle_a_ne_h_x_hot 21
-#define puzzle_a_ne_h_y_hot 1
-static unsigned char puzzle_a_ne_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x0f, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x3e, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x78, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0xe0, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xf8, 0x00,
- 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0x80, 0x01, 0x80, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x00, 0x03, 0xf8, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0x86, 0x7f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_nw_f_width 88
-#define puzzle_a_nw_f_height 74
-#define puzzle_a_nw_f_x_hot 1
-#define puzzle_a_nw_f_y_hot 1
-static unsigned char puzzle_a_nw_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03,
- 0x00, 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
- 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff,
- 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07,
- 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00,
- 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
- 0xff, 0x07, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_nw_h_width 88
-#define puzzle_a_nw_h_height 74
-#define puzzle_a_nw_h_x_hot 1
-#define puzzle_a_nw_h_y_hot 1
-static unsigned char puzzle_a_nw_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03,
- 0x00, 0x0c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00,
- 0x1c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
- 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06,
- 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06,
- 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00,
- 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
- 0xc0, 0x07, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc,
- 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_s_f_width 108
-#define puzzle_a_s_f_height 73
-#define puzzle_a_s_f_x_hot 20
-#define puzzle_a_s_f_y_hot 5
-static unsigned char puzzle_a_s_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
- 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f,
- 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f,
- 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff,
- 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0xc0, 0xff,
- 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8,
- 0x3f, 0x00, 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x1f, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_s_h_width 108
-#define puzzle_a_s_h_height 73
-#define puzzle_a_s_h_x_hot 20
-#define puzzle_a_s_h_y_hot 5
-static unsigned char puzzle_a_s_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00,
- 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c,
- 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60,
- 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
- 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
- 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0xc0, 0xff,
- 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8, 0x3f, 0x00,
- 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f,
- 0x70, 0x00, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x7e, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0xe0, 0xc1,
- 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x78, 0x00,
- 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8,
- 0x3f, 0x00, 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x1c, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_se_f_width 88
-#define puzzle_a_se_f_height 74
-#define puzzle_a_se_f_x_hot 20
-#define puzzle_a_se_f_y_hot 6
-static unsigned char puzzle_a_se_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f,
- 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00,
- 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
- 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff,
- 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff,
- 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f,
- 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00,
- 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7f, 0x80, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00,
- 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_se_h_width 88
-#define puzzle_a_se_h_height 74
-#define puzzle_a_se_h_x_hot 20
-#define puzzle_a_se_h_y_hot 6
-static unsigned char puzzle_a_se_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00,
- 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60,
- 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00,
- 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00,
- 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00,
- 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18,
- 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00,
- 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0,
- 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7f, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_sw_f_width 88
-#define puzzle_a_sw_f_height 74
-#define puzzle_a_sw_f_x_hot 1
-#define puzzle_a_sw_f_y_hot 6
-static unsigned char puzzle_a_sw_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff,
- 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01,
- 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00,
- 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
- 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01,
- 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00,
- 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff,
- 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_sw_h_width 88
-#define puzzle_a_sw_h_height 74
-#define puzzle_a_sw_h_x_hot 1
-#define puzzle_a_sw_h_y_hot 6
-static unsigned char puzzle_a_sw_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3,
- 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01,
- 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00,
- 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06,
- 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00,
- 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
- 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00,
- 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_w_f_width 88
-#define puzzle_a_w_f_height 78
-#define puzzle_a_w_f_x_hot 1
-#define puzzle_a_w_f_y_hot 6
-static unsigned char puzzle_a_w_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff,
- 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01,
- 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00,
- 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe,
- 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
- 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01,
- 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00,
- 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff,
- 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x3f, 0xc0,
- 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff,
- 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01,
- 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00,
- 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff,
- 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00,
- 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f,
- 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00,
- 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_a_w_h_width 88
-#define puzzle_a_w_h_height 78
-#define puzzle_a_w_h_x_hot 1
-#define puzzle_a_w_h_y_hot 6
-static unsigned char puzzle_a_w_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3,
- 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01,
- 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00,
- 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06,
- 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00,
- 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00,
- 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x0f, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x00,
- 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x01, 0x07,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xf8,
- 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x3c, 0xc0,
- 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07,
- 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
- 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06,
- 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00,
- 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80,
- 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01,
- 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00,
- 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00,
- 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0xc0, 0x07, 0x00, 0x00,
- 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0xc0,
- 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f,
- 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00,
- 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_e_f_width 74
-#define puzzle_b_e_f_height 108
-#define puzzle_b_e_f_x_hot 6
-#define puzzle_b_e_f_y_hot 21
-static unsigned char puzzle_b_e_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
- 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07,
- 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01,
- 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_e_h_width 74
-#define puzzle_b_e_h_height 108
-#define puzzle_b_e_h_x_hot 6
-#define puzzle_b_e_h_y_hot 21
-static unsigned char puzzle_b_e_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00,
- 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01,
- 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00,
- 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f,
- 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07,
- 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, 0x00, 0x00,
- 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f,
- 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01,
- 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f,
- 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_f_width 78
-#define puzzle_b_f_height 108
-#define puzzle_b_f_x_hot 5
-#define puzzle_b_f_y_hot 20
-static unsigned char puzzle_b_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
- 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07,
- 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01,
- 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_h_width 78
-#define puzzle_b_h_height 108
-#define puzzle_b_h_x_hot 5
-#define puzzle_b_h_y_hot 20
-static unsigned char puzzle_b_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
- 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00,
- 0xff, 0x01, 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01,
- 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01, 0x60, 0x00,
- 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x07,
- 0x00, 0x00, 0xfc, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
- 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00,
- 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07,
- 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00,
- 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0xc0, 0x07, 0x00, 0x00,
- 0xfc, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f,
- 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01,
- 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f,
- 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x01, 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_n_f_width 78
-#define puzzle_b_n_f_height 88
-#define puzzle_b_n_f_x_hot 6
-#define puzzle_b_n_f_y_hot 1
-static unsigned char puzzle_b_n_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff,
- 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0x00, 0x00, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00,
- 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff,
- 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0,
- 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01,
- 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_n_h_width 78
-#define puzzle_b_n_h_height 88
-#define puzzle_b_n_h_x_hot 6
-#define puzzle_b_n_h_y_hot 1
-static unsigned char puzzle_b_n_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06,
- 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f,
- 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01,
- 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00,
- 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07,
- 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00,
- 0x00, 0x00, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00,
- 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
- 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x1f,
- 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00,
- 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0,
- 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01,
- 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_ne_f_width 74
-#define puzzle_b_ne_f_height 88
-#define puzzle_b_ne_f_x_hot 6
-#define puzzle_b_ne_f_y_hot 1
-static unsigned char puzzle_b_ne_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff,
- 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0,
- 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01,
- 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_ne_h_width 74
-#define puzzle_b_ne_h_height 88
-#define puzzle_b_ne_h_x_hot 6
-#define puzzle_b_ne_h_y_hot 1
-static unsigned char puzzle_b_ne_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f,
- 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8,
- 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
- 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f,
- 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00,
- 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0,
- 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01,
- 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_nw_f_width 74
-#define puzzle_b_nw_f_height 88
-#define puzzle_b_nw_f_x_hot 1
-#define puzzle_b_nw_f_y_hot 1
-static unsigned char puzzle_b_nw_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f,
- 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff,
- 0x1f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00,
- 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_nw_h_width 74
-#define puzzle_b_nw_h_height 88
-#define puzzle_b_nw_h_x_hot 1
-#define puzzle_b_nw_h_y_hot 1
-static unsigned char puzzle_b_nw_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
- 0x7c, 0x00, 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00,
- 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70,
- 0xf0, 0x0f, 0x18, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff,
- 0x18, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00,
- 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80,
- 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_s_f_width 78
-#define puzzle_b_s_f_height 88
-#define puzzle_b_s_f_x_hot 5
-#define puzzle_b_s_f_y_hot 20
-static unsigned char puzzle_b_s_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
- 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07,
- 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_s_h_width 78
-#define puzzle_b_s_h_height 88
-#define puzzle_b_s_h_x_hot 5
-#define puzzle_b_s_h_y_hot 20
-static unsigned char puzzle_b_s_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00,
- 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01,
- 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00,
- 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f,
- 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
- 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00,
- 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07,
- 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00,
- 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_se_f_width 74
-#define puzzle_b_se_f_height 88
-#define puzzle_b_se_f_x_hot 6
-#define puzzle_b_se_f_y_hot 20
-static unsigned char puzzle_b_se_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff,
- 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00,
- 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01,
- 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07,
- 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_se_h_width 74
-#define puzzle_b_se_h_height 88
-#define puzzle_b_se_h_x_hot 6
-#define puzzle_b_se_h_y_hot 20
-static unsigned char puzzle_b_se_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00,
- 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
- 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0,
- 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0,
- 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00,
- 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01,
- 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00,
- 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f,
- 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0,
- 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07,
- 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_sw_f_width 74
-#define puzzle_b_sw_f_height 88
-#define puzzle_b_sw_f_x_hot 1
-#define puzzle_b_sw_f_y_hot 21
-static unsigned char puzzle_b_sw_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f,
- 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0,
- 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00,
- 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80,
- 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_sw_h_width 74
-#define puzzle_b_sw_h_height 88
-#define puzzle_b_sw_h_x_hot 1
-#define puzzle_b_sw_h_y_hot 21
-static unsigned char puzzle_b_sw_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c,
- 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0,
- 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00,
- 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0,
- 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00,
- 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80,
- 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f,
- 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_w_f_width 74
-#define puzzle_b_w_f_height 108
-#define puzzle_b_w_f_x_hot 1
-#define puzzle_b_w_f_y_hot 21
-static unsigned char puzzle_b_w_f_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc,
- 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f,
- 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0,
- 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00,
- 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80,
- 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00,
- 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00,
- 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00,
- 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, 0xfe, 0x03,
- 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0xfc,
- 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe,
- 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff,
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0,
- 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
+++ /dev/null
-#define puzzle_b_w_h_width 74
-#define puzzle_b_w_h_height 108
-#define puzzle_b_w_h_x_hot 1
-#define puzzle_b_w_h_y_hot 21
-static unsigned char puzzle_b_w_h_bits[] = {
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0,
- 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c,
- 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c,
- 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0,
- 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00,
- 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0,
- 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00,
- 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80,
- 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80,
- 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00,
- 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f,
- 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00,
- 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x7c, 0x00, 0x00, 0xc0,
- 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00,
- 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00,
- 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, 0xfe, 0x03,
- 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0x0c,
- 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06,
- 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70,
- 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00};
-/* xscreensaver, Copyright (c) 1997 Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
#define DEBUG
-#include "pieces/puzzle_a_h.xbm"
-#include "pieces/puzzle_a_n_h.xbm"
-#include "pieces/puzzle_a_ne_h.xbm"
-#include "pieces/puzzle_a_e_h.xbm"
-#include "pieces/puzzle_a_se_h.xbm"
-#include "pieces/puzzle_a_s_h.xbm"
-#include "pieces/puzzle_a_sw_h.xbm"
-#include "pieces/puzzle_a_w_h.xbm"
-#include "pieces/puzzle_a_nw_h.xbm"
-
-#include "pieces/puzzle_b_h.xbm"
-#include "pieces/puzzle_b_n_h.xbm"
-#include "pieces/puzzle_b_ne_h.xbm"
-#include "pieces/puzzle_b_e_h.xbm"
-#include "pieces/puzzle_b_se_h.xbm"
-#include "pieces/puzzle_b_s_h.xbm"
-#include "pieces/puzzle_b_sw_h.xbm"
-#include "pieces/puzzle_b_w_h.xbm"
-#include "pieces/puzzle_b_nw_h.xbm"
-
-#include "pieces/puzzle_a_f.xbm"
-#include "pieces/puzzle_a_n_f.xbm"
-#include "pieces/puzzle_a_ne_f.xbm"
-#include "pieces/puzzle_a_e_f.xbm"
-#include "pieces/puzzle_a_se_f.xbm"
-#include "pieces/puzzle_a_s_f.xbm"
-#include "pieces/puzzle_a_sw_f.xbm"
-#include "pieces/puzzle_a_w_f.xbm"
-#include "pieces/puzzle_a_nw_f.xbm"
-
-#include "pieces/puzzle_b_f.xbm"
-#include "pieces/puzzle_b_n_f.xbm"
-#include "pieces/puzzle_b_ne_f.xbm"
-#include "pieces/puzzle_b_e_f.xbm"
-#include "pieces/puzzle_b_se_f.xbm"
-#include "pieces/puzzle_b_s_f.xbm"
-#include "pieces/puzzle_b_sw_f.xbm"
-#include "pieces/puzzle_b_w_f.xbm"
-#include "pieces/puzzle_b_nw_f.xbm"
+#include "images/puzzle/puzzle_a_h.xbm"
+#include "images/puzzle/puzzle_a_n_h.xbm"
+#include "images/puzzle/puzzle_a_ne_h.xbm"
+#include "images/puzzle/puzzle_a_e_h.xbm"
+#include "images/puzzle/puzzle_a_se_h.xbm"
+#include "images/puzzle/puzzle_a_s_h.xbm"
+#include "images/puzzle/puzzle_a_sw_h.xbm"
+#include "images/puzzle/puzzle_a_w_h.xbm"
+#include "images/puzzle/puzzle_a_nw_h.xbm"
+
+#include "images/puzzle/puzzle_b_h.xbm"
+#include "images/puzzle/puzzle_b_n_h.xbm"
+#include "images/puzzle/puzzle_b_ne_h.xbm"
+#include "images/puzzle/puzzle_b_e_h.xbm"
+#include "images/puzzle/puzzle_b_se_h.xbm"
+#include "images/puzzle/puzzle_b_s_h.xbm"
+#include "images/puzzle/puzzle_b_sw_h.xbm"
+#include "images/puzzle/puzzle_b_w_h.xbm"
+#include "images/puzzle/puzzle_b_nw_h.xbm"
+
+#include "images/puzzle/puzzle_a_f.xbm"
+#include "images/puzzle/puzzle_a_n_f.xbm"
+#include "images/puzzle/puzzle_a_ne_f.xbm"
+#include "images/puzzle/puzzle_a_e_f.xbm"
+#include "images/puzzle/puzzle_a_se_f.xbm"
+#include "images/puzzle/puzzle_a_s_f.xbm"
+#include "images/puzzle/puzzle_a_sw_f.xbm"
+#include "images/puzzle/puzzle_a_w_f.xbm"
+#include "images/puzzle/puzzle_a_nw_f.xbm"
+
+#include "images/puzzle/puzzle_b_f.xbm"
+#include "images/puzzle/puzzle_b_n_f.xbm"
+#include "images/puzzle/puzzle_b_ne_f.xbm"
+#include "images/puzzle/puzzle_b_e_f.xbm"
+#include "images/puzzle/puzzle_b_se_f.xbm"
+#include "images/puzzle/puzzle_b_s_f.xbm"
+#include "images/puzzle/puzzle_b_sw_f.xbm"
+#include "images/puzzle/puzzle_b_w_f.xbm"
+#include "images/puzzle/puzzle_b_nw_f.xbm"
#define GRID_WIDTH 66
#define GRID_HEIGHT 66
#include "screenhack.h"
-/* why doesn't this work??? */
-#ifdef HAVE_XSHM_EXTENSION
-#include <sys/ipc.h>
-#include <sys/shm.h>
-#include <X11/extensions/XShm.h>
+/* costs ~6% speed */
+#define dither_when_mapped 1
+
+int verbose;
+int ncolors = 0;
+XColor *colors = 0;
+Display *display;
+Visual *visual;
+#if dither_when_mapped
+unsigned char *mc = 0;
#endif
+Colormap cmap = 0;
+Window window;
+int mapped;
+int pdepth;
+void random_colors(void);
+
+/* -----------------------------------------------------------
+ pixel hack, 8-bit pixel grid, first/next frame interface
+
+ pixack_init(int *size_h, int *size_v)
+ pixack_frame(char *pix_buf)
+ */
+
+
+#define bps 16
+#define mx ((1<<16)-1)
+
+/* you can replace integer mults wish shift/adds with these,
+ but it doesn't help on my 586 */
+#define x5(n) ((n<<2)+n)
+#define x7(n) ((n<<3)-n)
+
+/* why strip bit? */
+#define R (ya_random()&((1<<30)-1))
+
+int frame = 0, epoch_time;
+ushort *r1, *r2, *r1b, *r2b;
+int width, height, npix;
+int radius;
+int reaction = 0;
+int diffusion = 0;
+
+/* returns number of pixels that the pixack produces. called once. */
+void
+pixack_init(int *size_h, int *size_v) {
+ int sz_base;
+ width = get_integer_resource ("width", "Integer");
+ height = get_integer_resource ("height", "Integer");
+ sz_base = 80 + (R%40);
+ if (width <= 0) width = (R%20) ? sz_base : (28 + R%10);
+ if (height <= 0) height = (R%20) ? sz_base : (28 + R%10);
+ /* don't go there */
+ if (width < 10) width = 10;
+ if (height < 10) height = 10;
+ epoch_time = get_integer_resource ("epoch", "Integer");
+ npix = (width + 2) * (height + 2);
+ r1 = (ushort *) malloc(sizeof(ushort) * npix);
+ r2 = (ushort *) malloc(sizeof(ushort) * npix);
+ r1b = (ushort *) malloc(sizeof(ushort) * npix);
+ r2b = (ushort *) malloc(sizeof(ushort) * npix);
+
+ if (!r1 || !r2 || !r1b || !r2b) {
+ fprintf(stderr, "not enough memory for %d pixels.\n", npix);
+ exit(1);
+ }
+
+ *size_h = width;
+ *size_v = height;
+}
#define test_pattern_hyper 0
-/* costs ~6% speed */
-#define dither_when_mapped 1
+
+/* returns the pixels. called many times. */
+void
+pixack_frame(char *pix_buf) {
+ int i, j;
+ int w2 = width + 2;
+ ushort *t;
+#if test_pattern_hyper
+ if (frame&0x100)
+ sleep(1);
+#endif
+ if (verbose) {
+ double tm = 0;
+ struct timeval tp;
+ if (!(frame%100)) {
+ double tm2;
+#ifdef GETTIMEOFDAY_TWO_ARGS
+ struct timezone tzp;
+ gettimeofday(&tp, &tzp);
+#else
+ gettimeofday(&tp);
+#endif
+ tm2 = tp.tv_sec + tp.tv_usec * 1e-6;
+ if (frame > 0)
+ printf("fps = %2.4g\n", 100.0 / (tm2 - tm));
+ tm = tm2;
+ }
+ }
+ if (!(frame%epoch_time)) {
+ int s;
+ if (0 != frame) {
+ int t = epoch_time / 500;
+ if (t > 15)
+ t = 15;
+ sleep(t);
+ }
+
+ for (i = 0; i < npix; i++) {
+ /* equilibrium */
+ r1[i] = 65500;
+ r2[i] = 11;
+ }
+
+ random_colors();
+
+ XSetWindowBackground(display, window, colors[255 % ncolors].pixel);
+ XClearWindow(display, window);
+
+ s = w2 * (height/2) + width/2;
+ radius = get_integer_resource ("radius", "Integer");
+ {
+ int maxr = width/2-2;
+ int maxr2 = height/2-2;
+ if (maxr2 < maxr) maxr = maxr2;
+
+ if (radius < 0)
+ radius = 1 + ((R%10) ? (R%5) : (R % maxr));
+ if (radius > maxr) radius = maxr;
+ }
+ for (i = -radius; i < (radius+1); i++)
+ for (j = -radius; j < (radius+1); j++)
+ r2[s + i + j*w2] = mx - (R&63);
+ reaction = get_integer_resource ("reaction", "Integer");
+ if (reaction < 0 || reaction > 2) reaction = R&1;
+ diffusion = get_integer_resource ("diffusion", "Integer");
+ if (diffusion < 0 || diffusion > 2)
+ diffusion = (R%5) ? ((R%3)?0:1) : 2;
+ if (2 == reaction && 2 == diffusion)
+ reaction = diffusion = 0;
+
+ if (verbose)
+ printf("reaction = %d\ndiffusion = %d\nradius = %d\n",
+ reaction, diffusion, radius);
+ }
+ for (i = 0; i <= width+1; i++) {
+ r1[i] = r1[i + w2 * height];
+ r2[i] = r2[i + w2 * height];
+ r1[i + w2 * (height + 1)] = r1[i + w2];
+ r2[i + w2 * (height + 1)] = r2[i + w2];
+ }
+ for (i = 0; i <= height+1; i++) {
+ r1[w2 * i] = r1[width + w2 * i];
+ r2[w2 * i] = r2[width + w2 * i];
+ r1[w2 * i + width + 1] = r1[w2 * i + 1];
+ r2[w2 * i + width + 1] = r2[w2 * i + 1];
+ }
+ for (i = 0; i < height; i++) {
+ int ii = i + 1;
+ char *q = pix_buf + width * i;
+ short *qq = ((short *) pix_buf) + width * i;
+ long *qqq = ((long *) pix_buf) + width * i;
+ ushort *i1 = r1 + 1 + w2 * ii;
+ ushort *i2 = r2 + 1 + w2 * ii;
+ ushort *o1 = r1b + 1 + w2 * ii;
+ ushort *o2 = r2b + 1 + w2 * ii;
+ for (j = 0; j < width; j++) {
+#if test_pattern_hyper
+ int r1 = (i * j + (frame&127)*frame)&65535;
+#else
+ int uvv, r1 = 0, r2 = 0;
+ switch (diffusion) {
+ case 0:
+ r1 = i1[j] + i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2];
+ r1 = r1 / 5;
+ r2 = (i2[j]<<3) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2];
+ r2 = r2 / 12;
+ break;
+ case 1:
+ r1 = i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2];
+ r1 = r1 >> 2;
+ r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2];
+ r2 = r2 >> 3;
+ break;
+ case 2:
+ r1 = (i1[j]<<1) + (i1[j+1]<<1) + (i1[j-1]<<1) + i1[j+w2] + i1[j-w2];
+ r1 = r1 >> 3;
+ r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2];
+ r2 = r2 >> 3;
+ break;
+ }
+
+ /* John E. Pearson "Complex Patterns in a Simple System"
+ Science, July 1993 */
+
+ uvv = (((r1 * r2) >> bps) * r2) >> bps;
+ switch (reaction) { /* costs 4% */
+ case 0:
+ r1 += 4 * (((28 * (mx-r1)) >> 10) - uvv);
+ r2 += 4 * (uvv - ((80 * r2) >> 10));
+ break;
+ case 1:
+ r1 += 3 * (((27 * (mx-r1)) >> 10) - uvv);
+ r2 += 3 * (uvv - ((80 * r2) >> 10));
+ break;
+ case 2:
+ r1 += 2 * (((28 * (mx-r1)) >> 10) - uvv);
+ r2 += 3 * (uvv - ((80 * r2) >> 10));
+ break;
+ }
+ if (r1 > mx) r1 = mx;
+ if (r2 > mx) r2 = mx;
+ if (r1 < 0) r1 = 0;
+ if (r2 < 0) r2 = 0;
+ o1[j] = r1;
+ o2[j] = r2;
+#endif
+
+ /* this is terrible. here i want to assume ncolors = 256.
+ should lose double indirection */
+
+ if (mapped)
+#if dither_when_mapped
+ q[j] = colors[mc[r1] % ncolors].pixel;
+#else
+ q[j] = colors[(r1>>8) % ncolors].pixel;
+#endif
+ else if (pdepth == 8)
+ q[j] = colors[(r1>>8) % ncolors].pixel;
+ else if (pdepth == 16)
+#if dither_when_mapped
+ qq[j] = colors[mc[r1] % ncolors].pixel;
+#else
+ qq[j] = colors[(r1>>8) % ncolors].pixel;
+#endif
+ else if (pdepth == 32)
+#if dither_when_mapped
+ qqq[j] = colors[mc[r1] % ncolors].pixel;
+#else
+ qqq[j] = colors[(r1>>8) % ncolors].pixel;
+#endif
+ else
+ abort();
+ }
+ }
+ t = r1; r1 = r1b; r1b = t;
+ t = r2; r2 = r2b; r2b = t;
+}
+
+
+/* ------------- xscreensaver rendering -------------- */
+
+
char *progclass = "RD";
char *defaults [] = {
"RD.background: black", /* to placate SGI */
"RD.foreground: white",
- "*width: 100",
- "*height: 100",
+ "*width: 0", /* tried to use -1 but it complained */
+ "*height: 0",
"*epoch: 40000",
"*reaction: -1",
"*diffusion: -1",
"*radius: -1",
"*speed: 0.0",
"*size: 0.66",
- "*delay: 1000",
+ "*delay: 1",
"*colors: -1",
0
};
{ 0, 0, 0, 0 }
};
-#define bps 16
-#define mx ((1<<16)-1)
-/* you can replace integer mults wish shift/adds with these,
- but it doesn't help on my 586 */
-#define x5(n) ((n<<2)+n)
-#define x7(n) ((n<<3)-n)
+/* why doesn't this work??? and more importantly, do i really still have
+ to do this in X? */
+
+#ifdef HAVE_XSHM_EXTENSION
+#include <sys/ipc.h>
+#include <sys/shm.h>
+#include <X11/extensions/XShm.h>
+#endif
-/* why strip bit? */
-#define R (ya_random()&((1<<30)-1))
+
+void
+random_colors() {
+ memset(colors, 0, ncolors*sizeof(*colors));
+ make_smooth_colormap (display, visual, cmap, colors, &ncolors,
+ True, 0, True);
+ if (ncolors <= 2) {
+ mono_p = True;
+ ncolors = 2;
+ colors[0].flags = DoRed|DoGreen|DoBlue;
+ colors[0].red = colors[0].green = colors[0].blue = 0;
+ XAllocColor(display, cmap, &colors[0]);
+ colors[1].flags = DoRed|DoGreen|DoBlue;
+ colors[1].red = colors[1].green = colors[1].blue = 0xFFFF;
+ XAllocColor(display, cmap, &colors[1]);
+ }
+
+ /* Scale it up so that there are exactly 255 colors -- that keeps the
+ animation speed consistent, even when there aren't many allocatable
+ colors, and prevents the -mono mode from looking like static. */
+ if (ncolors != 255) {
+ int i, n = 255;
+ double scale = (double) ncolors / (double) (n+1);
+ XColor *c2 = (XColor *) malloc(sizeof(*c2) * (n+1));
+ for (i = 0; i < n; i++)
+ c2[i] = colors[(int) (i * scale)];
+ free(colors);
+ colors = c2;
+ ncolors = n;
+ }
+
+}
/* should factor into RD-specfic and compute-every-pixel general */
void
GC gc;
XGCValues gcv;
XWindowAttributes xgwa;
- Colormap cmap = 0;
XImage *image;
- int width, height, radius;
int array_width, array_height;
double array_x, array_y;
double array_dx, array_dy;
int w2;
- int frame = 0, epoch_time;
char *p;
- int vdepth, pdepth;
- ushort *r1, *r2, *r1b, *r2b;
+ int vdepth;
int npix;
- int reaction = 0;
- int diffusion = 0;
- int verbose;
- int mapped;
int *m = 0;
-#if dither_when_mapped
- unsigned char *mc = 0;
-#endif
#ifdef HAVE_XSHM_EXTENSION
int use_shm = 0;
XShmSegmentInfo shm_info;
#endif
- int ncolors = 0;
- XColor *colors = 0;
- int delay = get_float_resource ("delay", "Integer");
+ double delay = get_float_resource ("delay", "Float");
+
+ display = dpy;
+ window = win;
+
XGetWindowAttributes (dpy, win, &xgwa);
- width = get_integer_resource ("width", "Integer");
- height = get_integer_resource ("height", "Integer");
+ visual = xgwa.visual;
+ pixack_init(&width, &height);
{
double s = get_float_resource ("size", "Float");
double p = get_float_resource ("speed", "Float");
array_dx = p;
array_dy = .31415926 * p;
}
- if (width < 10) width = 10;
- if (height < 10) height = 10;
verbose = get_boolean_resource ("verbose", "Boolean");
npix = (width + 2) * (height + 2);
- epoch_time = get_integer_resource ("epoch", "Integer");
w2 = width + 2;
gcv.function = GXcopy;
gc = XCreateGC(dpy, win, GCFunction, &gcv);
mapped = (vdepth <= 8 &&
has_writable_cells(xgwa.screen, xgwa.visual));
- if (!mapped)
- m = (int *) malloc(sizeof(int) * (1<<16));
-#if dither_when_mapped
- else {
+ {
int i, di;
mc = (unsigned char *) malloc(1<<16);
for (i = 0; i < (1<<16); i++) {
mc[i] = di;
}
}
-#endif
+
p = malloc(npix * (pdepth == 1 ? 1 : (pdepth / 8)));
- r1 = (ushort *) malloc(sizeof(ushort) * npix);
- r2 = (ushort *) malloc(sizeof(ushort) * npix);
- r1b = (ushort *) malloc(sizeof(ushort) * npix);
- r2b = (ushort *) malloc(sizeof(ushort) * npix);
- if (!p || !r1 || !r2 || !r1b || !r2b) {
+ if (!p) {
fprintf(stderr, "not enough memory for %d pixels.\n", npix);
exit(1);
}
while (1) {
int i, j;
- ushort *t;
-#if test_pattern_hyper
- if (frame&0x100)
- sleep(1);
-#endif
- if (verbose) {
- double tm = 0;
- struct timeval tp;
- if (!(frame%100)) {
- double tm2;
-#ifdef GETTIMEOFDAY_TWO_ARGS
- struct timezone tzp;
- gettimeofday(&tp, &tzp);
-#else
- gettimeofday(&tp);
-#endif
- tm2 = tp.tv_sec + tp.tv_usec * 1e-6;
- if (frame > 0)
- printf("fps = %2.4g\n", 100.0 / (tm2 - tm));
- tm = tm2;
- }
- }
- if (!(frame%epoch_time)) {
- int s;
- if (0 != frame) {
- int t = epoch_time / 500;
- if (t > 15)
- t = 15;
- sleep(t);
- }
-
- for (i = 0; i < npix; i++) {
- /* equilibrium */
- r1[i] = 65500;
- r2[i] = 11;
- }
-
- memset(colors, 0, ncolors*sizeof(*colors));
- make_smooth_colormap (dpy, xgwa.visual, cmap, colors, &ncolors,
- True, 0, True);
- if (ncolors <= 2) {
- mono_p = True;
- ncolors = 2;
- colors[0].flags = DoRed|DoGreen|DoBlue;
- colors[0].red = colors[0].green = colors[0].blue = 0;
- XAllocColor(dpy, cmap, &colors[0]);
- colors[1].flags = DoRed|DoGreen|DoBlue;
- colors[1].red = colors[1].green = colors[1].blue = 0xFFFF;
- XAllocColor(dpy, cmap, &colors[1]);
- }
-
- /* Scale it up so that there are exactly 255 colors -- that keeps the
- animation speed consistent, even when there aren't many allocatable
- colors, and prevents the -mono mode from looking like static. */
- if (ncolors != 255) {
- int i, n = 255;
- double scale = (double) ncolors / (double) (n+1);
- XColor *c2 = (XColor *) malloc(sizeof(*c2) * (n+1));
- for (i = 0; i < n; i++)
- c2[i] = colors[(int) (i * scale)];
- free(colors);
- colors = c2;
- ncolors = n;
- }
-
-
- XSetWindowBackground(dpy, win, colors[255 % ncolors].pixel);
- XClearWindow(dpy, win);
-
- s = w2 * height/2 + width/2;
- radius = get_integer_resource ("radius", "Integer");
- if (radius < 0)
- radius = 1 + ((R%10) ? (R%5) : (R % (width/2-2)));
- for (i = -radius; i < (radius+1); i++)
- for (j = -radius; j < (radius+1); j++)
- r2[s + i + j*w2] = mx - (R&63);
- reaction = get_integer_resource ("reaction", "Integer");
- if (reaction < 0 || reaction > 2) reaction = R&1;
- diffusion = get_integer_resource ("diffusion", "Integer");
- if (diffusion < 0 || diffusion > 2)
- diffusion = (R%5) ? ((R%3)?0:1) : 2;
- if (2 == reaction && 2 == diffusion)
- reaction = diffusion = 0;
-
- if (verbose)
- printf("reaction = %d\ndiffusion = %d\nradius = %d\n",
- reaction, diffusion, radius);
- }
- for (i = 0; i <= width+1; i++) {
- r1[i] = r1[i + w2 * height];
- r2[i] = r2[i + w2 * height];
- r1[i + w2 * (height + 1)] = r1[i + w2];
- r2[i + w2 * (height + 1)] = r2[i + w2];
- }
- for (i = 0; i <= height+1; i++) {
- r1[w2 * i] = r1[width + w2 * i];
- r2[w2 * i] = r2[width + w2 * i];
- r1[w2 * i + width + 1] = r1[w2 * i + 1];
- r2[w2 * i + width + 1] = r2[w2 * i + 1];
- }
- for (i = 0; i < height; i++) {
- int ii = i + 1;
- char *q = p + width * i;
- short *qq = ((short *) p) + width * i;
- long *qqq = ((long *) p) + width * i;
- ushort *i1 = r1 + 1 + w2 * ii;
- ushort *i2 = r2 + 1 + w2 * ii;
- ushort *o1 = r1b + 1 + w2 * ii;
- ushort *o2 = r2b + 1 + w2 * ii;
- for (j = 0; j < width; j++) {
-#if test_pattern_hyper
- int r1 = (i * j + (frame&127)*frame)&65535;
-#else
- int uvv, r1 = 0, r2 = 0;
- switch (diffusion) {
- case 0:
- r1 = i1[j] + i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2];
- r1 = r1 / 5;
- r2 = (i2[j]<<3) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2];
- r2 = r2 / 12;
- break;
- case 1:
- r1 = i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2];
- r1 = r1 >> 2;
- r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2];
- r2 = r2 >> 3;
- break;
- case 2:
- r1 = (i1[j]<<1) + (i1[j+1]<<1) + (i1[j-1]<<1) + i1[j+w2] + i1[j-w2];
- r1 = r1 >> 3;
- r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2];
- r2 = r2 >> 3;
- break;
- }
- uvv = (((r1 * r2) >> bps) * r2) >> bps;
- switch (reaction) { /* costs 4% */
- case 0:
- r1 += 4 * (((28 * (mx-r1)) >> 10) - uvv);
- r2 += 4 * (uvv - ((80 * r2) >> 10));
- break;
- case 1:
- r1 += 3 * (((27 * (mx-r1)) >> 10) - uvv);
- r2 += 3 * (uvv - ((80 * r2) >> 10));
- break;
- case 2:
- r1 += 2 * (((28 * (mx-r1)) >> 10) - uvv);
- r2 += 3 * (uvv - ((80 * r2) >> 10));
- break;
- }
- if (r1 > mx) r1 = mx;
- if (r2 > mx) r2 = mx;
- if (r1 < 0) r1 = 0;
- if (r2 < 0) r2 = 0;
- o1[j] = r1;
- o2[j] = r2;
-#endif
-
- if (mapped)
-#if dither_when_mapped
- q[j] = colors[mc[r1] % ncolors].pixel;
-#else
- q[j] = colors[(r1>>8) % ncolors].pixel;
-#endif
- else if (pdepth == 8)
- q[j] = colors[(r1>>8) % ncolors].pixel;
- else if (pdepth == 16)
- qq[j] = colors[(r1>>8) % ncolors].pixel;
- else if (pdepth == 32)
- qqq[j] = colors[(r1>>8) % ncolors].pixel;
- else
- abort();
- }
- }
- t = r1; r1 = r1b; r1b = t;
- t = r2; r2 = r2b; r2b = t;
+ pixack_frame(p);
for (i = 0; i < array_width; i += width)
for (j = 0; j < array_height; j += height)
#ifdef HAVE_XSHM_EXTENSION
XSync(dpy, False);
if (delay > 0)
- usleep(delay);
+ usleep(1000 * delay);
}
}
static unsigned int default_fg_pixel;
static int iterations, offset;
static Bool xsym, ysym;
-static int erase_speed, sleep_time, erase_mode;
+static int sleep_time;
static void
init_rorschach (Display *dpy, Window window)
"*iterations: 4000",
"*offset: 4",
"*delay: 5",
- "*eraseSpeed: 400",
- "*eraseMode: -1",
0
};
{ "-ysymmetry", ".ysymmetry", XrmoptionNoArg, "true" },
{ "-erase-speed", ".eraseSpeed", XrmoptionSepArg, 0 },
{ "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-erase-mode", ".eraseMode", XrmoptionSepArg, 0 },
{ 0, 0, 0, 0 }
};
void
screenhack (Display *dpy, Window window)
{
- erase_speed = get_integer_resource("eraseSpeed", "Integer");
sleep_time = get_integer_resource("delay", "Integer");
- erase_mode = get_integer_resource("eraseMode", "Integer");
init_rorschach (dpy, window);
while (1)
hurm (dpy, window);
* - swirl is the swirl data
*/
static void
-initialise_image(Display * dpy, SWIRL_P swirl)
+initialise_image(ModeInfo * mi, SWIRL_P swirl)
{
- unsigned int pad;
- int bytes_per_line;
- int image_depth = swirl->rdepth;
- int data_depth = image_depth;
-
- /* On SGIs at least, using an XImage of depth 24 on a Visual of depth 24
- requires the XImage data to use 32 bits per pixel. I don't understand
- how one is supposed to determine this -- maybe XListPixmapFormats?
- But on systems that don't work this way, allocating 32 bpp instead of
- 24 will be wasteful but non-fatal. -- jwz, 16-May-97. */
- if (data_depth >= 24 && data_depth < 32)
- data_depth = 32;
-
- /* get the bitmap pad */
- pad = BitmapPad(dpy);
- /* destroy the old image (destroy XImage and data) */
- if (swirl->ximage != NULL)
- XDestroyImage(swirl->ximage);
-
- /* how many bytes per line? (bits rounded up to pad) */
- bytes_per_line = ((swirl->width * data_depth + pad - 1) / pad) * (pad / 8);
-
- /* allocate space for the image */
- swirl->image = (unsigned char *) calloc(bytes_per_line * swirl->height, 1);
-
- /* create an ximage with this */
- swirl->ximage = XCreateImage(dpy, swirl->visual, image_depth, ZPixmap,
- 0, (char *) swirl->image, swirl->width,
- swirl->height, pad, bytes_per_line);
+ Display *dpy = MI_DISPLAY(mi);
+
+ if (swirl->ximage != NULL)
+ XDestroyImage(swirl->ximage);
+
+ swirl->ximage = XCreateImage(dpy, swirl->visual, swirl->rdepth, ZPixmap,
+ 0, 0, swirl->width, swirl->height,
+ 8, 0);
+ swirl->ximage->data = swirl->image =
+ (unsigned char *) calloc(swirl->height, swirl->ximage->bytes_per_line);
}
/****************************************************************/
swirl->depth = 16;
/* initialise image for speeding up drawing */
- initialise_image(display, swirl);
+ initialise_image(mi, swirl);
/* clear the window (before setting the colourmap) */
XClearWindow(display, MI_WINDOW(mi));
--- /dev/null
+#!/bin/sh
+#
+# vidwhacker, for xscreensaver. Copyright (c) 1998 Jamie Zawinski.
+#
+# This script grabs a frame of video, then uses various pbm filters to
+# munge the image in random nefarious ways, then uses xv to put it on
+# the root window. This works out really nicely if you just feed some
+# random TV station into it...
+#
+# The video grabbing part is SGI-specific -- if you want to use this on
+# another system, add a new clause to the grab() procedure.
+
+
+# Process command-line args...
+
+onroot=false
+verbose=false
+delay=3
+
+if [ "$1" = "-root" ]; then
+ onroot=true
+ shift
+fi
+
+if [ "$1" = "-verbose" ]; then
+ verbose=true
+ shift
+fi
+
+if [ "$1" != "" ]; then
+ echo "usage: $0 [-root] [-verbose]" >&2
+ exit 1
+fi
+
+
+xvargs="-quick24"
+
+if [ "$onroot" = true ]; then
+ xvargs="$xvargs -root -rmode 5 -quit"
+else
+ xvargs="$xvargs -geom +0+0"
+fi
+
+screen_width=`xdpyinfo | sed -n 's/.* dimensions: *\([0-9]*\).*/\1/p'`
+
+# global vars...
+
+tmp=/tmp/vd$$
+tmp_rgb=$tmp-00000.rgb
+tmp_ppm=$tmp.ppm
+tmp_ppm2=$tmp-2.ppm
+tmp_ppm3=$tmp-3.ppm
+
+clean() {
+ rm -f $tmp_rgb $tmp_ppm $tmp_ppm2 $tmp_ppm3
+}
+
+
+# Grab a frame of video.
+#
+grab() {
+ if [ `uname` = IRIX ]; then
+ #
+ # SGI's "vidtomem" returns an SGI RGB image of the default video input,
+ # and has stupid non-overridable ouput-file-naming conventions. So, let
+ # it write its file; and then convert it to a pgm.
+ #
+ vidtomem -f $tmp
+ sgitopnm $tmp_rgb > $tmp_ppm
+ # Cut off the close-captioning blips in the NTSC overscan region. YMMV.
+ # | pnmcut 12 7 695 477
+
+ else
+ echo "$0: don't know how to grab video on this OS." >&2
+ clean
+ exit 1
+ fi
+
+
+ # I got this message from Marcus Herbert <rhoenie@chillout.org>.
+ # I'm not sure of the best way to make the presence of qcam be
+ # auto-detected, but here's what he said, FYI...
+ #
+ # i am using a black/white Connectix Qcam on linux and its very simple
+ # to adept the script:
+ #
+ # # qcam: Version 0.91
+ # # Options:
+ # # O -x width Set width
+ # # O y height Setheight
+ # # O B bpp Setbits per pixel
+ # # O W Auto-set white balance
+ # # O E "vals" Autoexposure mode, parameters required
+ # # O D Remove dark speckling
+ # # O s val Set scaling factor (1, 2, or 4)
+ # #
+ # qcam -x 320 -y 240 -B 6 -W -E 1 -D -s 1 > $tmp_ppm
+ #
+ # You dont really need the parameters for qcam as it reads out a system
+ # config file where you store the values for brightnes, contrast and
+ # white balance. But with this parameters you are independant of the
+ # light ratios at the place the cam is set up.
+ #
+ # Other versions of qcam (0.7, 0.96..) don't support the autoexposure and
+ # auto- whitebalance commandline parameters. On such systems (and on
+ # color-qcam systems) a simple qcam > $tmp_ppm (or cqcam > $tmp_ppm) is
+ # enough.
+ #
+ # I dont know about other systems but afaik fBSD uses the Qcam in this way:
+ #
+ # qcamcontrol -bla -foo -bar > picture.pgm
+ #
+}
+
+
+# Use perl to pick a random foreground/background color in pbm's syntax.
+#
+randcolor() {
+ perl -e 'srand;
+ printf("#%02x%02x%02x-#%02x%02x%02x",
+ int(rand()*60),
+ int(rand()*60),
+ int(rand()*60),
+ 120+int(rand()*135),
+ 120+int(rand()*135),
+ 120+int(rand()*135))'
+}
+
+# Frobnicate the image in some random way.
+#
+frob() {
+
+ N=`perl -e 'srand; print int(rand() * 10)'`
+
+ if [ "$verbose" = true ]; then
+ echo "mode $N..." >&2
+ fi
+
+ if [ $N = 0 ]; then
+ ppmtopgm $tmp_ppm | pgmedge | pgmtoppm `randcolor` | ppmnorm
+
+ elif [ $N = 1 ]; then
+ ppmtopgm $tmp_ppm |
+ pgmenhance |
+ pgmtoppm `randcolor`
+
+ elif [ $N = 2 ]; then
+ ppmtopgm $tmp_ppm | pgmoil | pgmtoppm `randcolor`
+
+ elif [ $N = 3 ]; then
+ ppmrelief $tmp_ppm | ppmtopgm | pgmedge | ppmrelief | ppmtopgm |
+ pgmedge | pnminvert | pgmtoppm `randcolor`
+
+ elif [ $N = 4 ]; then
+ ppmspread 71 $tmp_ppm > $tmp_ppm2
+ pnmarith -add $tmp_ppm $tmp_ppm2
+
+ elif [ $N = 5 ]; then
+ pnmflip -lr $tmp_ppm > $tmp_ppm2
+ pnmarith -multiply $tmp_ppm $tmp_ppm2 > $tmp_ppm3
+ pnmflip -tb $tmp_ppm3 | ppmnorm > $tmp_ppm2
+ pnmarith -multiply $tmp_ppm $tmp_ppm2
+
+ elif [ $N = 6 ]; then
+ N2=`perl -e 'srand; print int(rand() * 3)'`
+ if [ $N2 = 0 ]; then
+ pnmflip -lr $tmp_ppm > $tmp_ppm2
+ elif [ $N2 = 1 ]; then
+ pnmflip -tb $tmp_ppm > $tmp_ppm2
+ else
+ pnmflip -lr $tmp_ppm > $tmp_ppm2
+ pnmflip -tb $tmp_ppm2 > $tmp_ppm3
+ cp $tmp_ppm3 $tmp_ppm2
+ fi
+
+ pnmarith -difference $tmp_ppm $tmp_ppm2
+
+ elif [ $N = 7 ]; then
+
+ for i in 1 2 3 ; do
+ ppmtopgm $tmp_ppm | pgmedge > $tmp_ppm2
+ pnmarith -difference $tmp_ppm $tmp_ppm2 > $tmp_ppm3
+ cp $tmp_ppm3 $tmp_ppm
+ done
+ ppmnorm < $tmp_ppm
+
+ elif [ $N = 8 ]; then
+ pnmflip -lr $tmp_ppm > $tmp_ppm2
+ pnmarith -multiply $tmp_ppm $tmp_ppm2 | ppmrelief | ppmnorm | pnminvert
+
+ elif [ $N = 9 ]; then
+ pnmflip -lr $tmp_ppm > $tmp_ppm2
+ pnmarith -subtract $tmp_ppm $tmp_ppm2 | ppmrelief | ppmtopgm | pgmedge
+
+ else cat $tmp_ppm
+ fi
+}
+
+
+
+# Grab a frame and frob it. leave it in $tmp_ppm3.
+#
+whack() {
+ clean
+
+ while [ ! -f $tmp_ppm ]; do
+ grab
+ done
+
+ rm -f $tmp_rgb
+ frob | pnmscale -width $screen_width > $tmp_ppm3
+ rm -f $tmp_ppm $tmp_ppm2
+}
+
+
+pid=""
+
+if [ "$onroot" != true ]; then
+ trap "kill \$pid; clean; exit 1" 2 15
+fi
+
+while true; do
+
+ # Loop grabbing and frobbing images.
+ #
+ # If we're running on the root, run xv in the foreground (with -exit)
+ # and then wait.
+ #
+ # If we're running in a window, spawn xv in the background; then when
+ # it's time to put up the new image, kill off the currently-running xv.
+
+ if [ "$verbose" = true ]; then
+ whack
+ else
+ whack >&- 2>&-
+ fi
+
+ if [ "$pid" != "" ]; then
+ kill $pid
+ pid=""
+ fi
+
+ if [ ! -s $tmp_ppm3 ]; then
+ echo "$0: no image grabbed" >&2
+ else
+
+ pnmtosgi < $tmp_ppm3 > $tmp_ppm2
+ rm -f $tmp_ppm3
+
+ if [ "$onroot" = true ]; then
+ xv $xvargs $tmp_ppm2
+ else
+ xv $xvargs $tmp_ppm2 &
+ pid=$!
+ fi
+
+ #xv -geom =320x220 $tmp_ppm3 &
+ #pid=
+ fi
+
+ clean
+ sleep $delay
+
+done
XColor color;
int i;
time_t start, now;
+ int orig_pause;
memset(&mi, 0, sizeof(mi));
mi.dpy = dpy;
mi.pause = 0;
else if (mi.pause > 100000000)
mi.pause = 100000000;
+ orig_pause = mi.pause;
xlockmore_read_resources ();
XSync(dpy, False);
if (mi.pause)
usleep(mi.pause);
+ mi.pause = orig_pause;
if (hack_free)
{
/* xlockmore.h --- xscreensaver compatibility layer for xlockmore modules.
- * xscreensaver, Copyright (c) 1997 Jamie Zawinski <jwz@netscape.com>
+ * xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
#ifdef USE_GL
# include <GL/glx.h>
- extern GLXContext init_GL (ModeInfo *);
+ extern GLXContext *init_GL (ModeInfo *);
# define FreeAllGL(dpy) /* */
#endif
#define MI_BATCHCOUNT(MI) ((MI)->batchcount)
#define MI_SIZE(MI) ((MI)->size)
+#define MI_CLEARWINDOW(mi) XClearWindow(MI_DISPLAY(mi), MI_WINDOW(mi))
+
/* Some other utility macros.
*/
#define SINF(n) ((float)sin((double)(n)))
x = random () % (w - ww);
y = random () % (h - hh);
XClearWindow (dpy, window);
+
+
skull (dpy, window, draw_gc, erase_gc, x, y, ww, hh);
XSync (dpy, True);
start_time = time ((time_t *) 0);
rgb_to_hsv (color2.red, color2.green, color2.blue, &H, &S, &V);
V += delta;
if (V >= 1.0) V = 1.0, delta = -delta;
- if (V <= 0.7) V = 0.7, delta = -delta;
+ if (V <= 0.6) V = 0.7, delta = -delta;
hsv_to_rgb (H, S, V, &color2.red, &color2.green, &color2.blue);
color3 = color2;
if (XAllocColor (dpy, cmap, &color3))
$ braid :== $'mydir'braid
$ bubbles :== $'mydir'bubbles
$ coral :== $'mydir'coral
+$ cynosure :== $'mydir'cynosure
$ decayscreen :== $'mydir'decayscreen
$ deco :== $'mydir'deco
$ drift :== $'mydir'drift
$ lmorph :== $'mydir'lmorph
$ maze :== $'mydir'maze
$ moire :== $'mydir'moire
+$ moire2 :== $'mydir'moire2
$ mountain :== $'mydir'mountain
$ munch :== $'mydir'munch
$ noseguy :== $'mydir'noseguy
X_CFLAGS = @X_CFLAGS@
-INCLUDES = -I$(srcdir) -I$(srcdir)/.. @INCLUDES@
+INCLUDES = -I$(srcdir) -I$(srcdir)/.. -I.. @INCLUDES@
SRCS = alpha.c colors.c fade.c grabscreen.c hsv.c overlay.c \
resources.c spline.c usleep.c visual.c xmu.c xroger.c \
-rm -f *.o a.out core
distclean: clean
- -rm -f Makefile *~ "#"*
+ -rm -f config.h Makefile *~ "#"*
# Adds all current dependencies to Makefile
depend:
( \
awk '/^# .*Makefile.in ---/,/^# DO .*distdepend/' < Makefile.in ; \
sed -e 's@ \./@ @g;s@ /[^ ]*@@g;/^.*:$$/d' \
- -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' ; \
+ -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \
+ -e 's@ $$(srcdir)/\(.*config.h\)@ \1@g' ; \
echo '' \
) > /tmp/distdepend.$$$$ && \
mv Makefile.in Makefile.in.bak && \
# DO NOT DELETE: updated by make distdepend
alpha.o: $(srcdir)/utils.h
-alpha.o: $(srcdir)/../config.h
+alpha.o: ../config.h
alpha.o: $(srcdir)/alpha.h
alpha.o: $(srcdir)/hsv.h
alpha.o: $(srcdir)/yarandom.h
alpha.o: $(srcdir)/resources.h
colors.o: $(srcdir)/utils.h
-colors.o: $(srcdir)/../config.h
+colors.o: ../config.h
colors.o: $(srcdir)/hsv.h
colors.o: $(srcdir)/yarandom.h
colors.o: $(srcdir)/visual.h
colors.o: $(srcdir)/colors.h
fade.o: $(srcdir)/utils.h
-fade.o: $(srcdir)/../config.h
+fade.o: ../config.h
fade.o: $(srcdir)/visual.h
fade.o: $(srcdir)/usleep.h
fade.o: $(srcdir)/fade.h
grabscreen.o: $(srcdir)/utils.h
-grabscreen.o: $(srcdir)/../config.h
+grabscreen.o: ../config.h
grabscreen.o: $(srcdir)/yarandom.h
grabscreen.o: $(srcdir)/usleep.h
grabscreen.o: $(srcdir)/colors.h
grabscreen.o: $(srcdir)/resources.h
grabscreen.o: $(srcdir)/vroot.h
hsv.o: $(srcdir)/utils.h
-hsv.o: $(srcdir)/../config.h
+hsv.o: ../config.h
hsv.o: $(srcdir)/hsv.h
overlay.o: $(srcdir)/utils.h
-overlay.o: $(srcdir)/../config.h
+overlay.o: ../config.h
overlay.o: $(srcdir)/visual.h
resources.o: $(srcdir)/utils.h
-resources.o: $(srcdir)/../config.h
+resources.o: ../config.h
resources.o: $(srcdir)/resources.h
spline.o: $(srcdir)/utils.h
-spline.o: $(srcdir)/../config.h
+spline.o: ../config.h
spline.o: $(srcdir)/spline.h
-usleep.o: $(srcdir)/../config.h
+usleep.o: ../config.h
visual.o: $(srcdir)/utils.h
-visual.o: $(srcdir)/../config.h
+visual.o: ../config.h
visual.o: $(srcdir)/resources.h
visual.o: $(srcdir)/visual.h
-xmu.o: $(srcdir)/../config.h
+xmu.o: ../config.h
xroger.o: $(srcdir)/utils.h
-xroger.o: $(srcdir)/../config.h
-yarandom.o: $(srcdir)/../config.h
+xroger.o: ../config.h
+xroger.o: $(srcdir)/spline.h
+yarandom.o: ../config.h
yarandom.o: $(srcdir)/yarandom.h
erase.o: $(srcdir)/utils.h
-erase.o: $(srcdir)/../config.h
+erase.o: ../config.h
erase.o: $(srcdir)/yarandom.h
erase.o: $(srcdir)/usleep.h
erase.o: $(srcdir)/resources.h
sgivideo.o: $(srcdir)/utils.h
-sgivideo.o: $(srcdir)/../config.h
+sgivideo.o: ../config.h
sgivideo.o: $(srcdir)/sgivideo.h
sgivideo.o: $(srcdir)/resources.h
+sgivideo.o: $(srcdir)/visual.h
sgivideo.o: $(srcdir)/usleep.h
#include "usleep.h"
#include "resources.h"
-#define NUM_MODES 8
+#undef countof
+#define countof(x) (sizeof(x)/sizeof(*(x)))
-void
-erase_window(Display *dpy, Window window, GC gc,
- int width, int height, int mode, int delay)
+typedef void (*Eraser) (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity);
+
+
+static void
+random_lines (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
+{
+ Bool horiz_p = (random() & 1);
+ int max = (horiz_p ? height : width);
+ int *lines = (int *) calloc(max, sizeof(*lines));
+ int i;
+
+ for (i = 0; i < max; i++)
+ lines[i] = i;
+
+ for (i = 0; i < max; i++)
+ {
+ int t, r;
+ t = lines[i];
+ r = random() % max;
+ lines[i] = lines[r];
+ lines[r] = t;
+ }
+
+ for (i = 0; i < max; i++)
+ {
+ if (horiz_p)
+ XDrawLine (dpy, window, gc, 0, lines[i], width, lines[i]);
+ else
+ XDrawLine (dpy, window, gc, lines[i], 0, lines[i], height);
+
+ XSync (dpy, False);
+ if (delay > 0 && ((i % granularity) == 0))
+ usleep (delay * granularity);
+ }
+ free(lines);
+}
+
+
+static void
+venetian (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
+{
+ Bool horiz_p = (random() & 1);
+ Bool flip_p = (random() & 1);
+ int max = (horiz_p ? height : width);
+ int *lines = (int *) calloc(max, sizeof(*lines));
+ int i, j;
+
+ granularity /= 6;
+
+ j = 0;
+ for (i = 0; i < max*2; i++)
+ {
+ int line = ((i / 16) * 16) - ((i % 16) * 15);
+ if (line >= 0 && line < max)
+ lines[j++] = (flip_p ? max - line : line);
+ }
+
+ for (i = 0; i < max; i++)
+ {
+ if (horiz_p)
+ XDrawLine (dpy, window, gc, 0, lines[i], width, lines[i]);
+ else
+ XDrawLine (dpy, window, gc, lines[i], 0, lines[i], height);
+
+ XSync (dpy, False);
+ if (delay > 0 && ((i % granularity) == 0))
+ usleep (delay * granularity);
+ }
+ free(lines);
+}
+
+
+static void
+triple_wipe (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
{
- int *clear_lines;
- int i, j, line, num_lines=0, granularity, max_num;
+ Bool flip_x = random() & 1;
+ Bool flip_y = random() & 1;
+ int max = width + (height / 2);
+ int *lines = (int *)calloc(max, sizeof(int));
+ int i;
+
+ for(i = 0; i < width/2; i++)
+ lines[i] = i*2+height;
+ for(i = 0; i < height/2; i++)
+ lines[i+width/2] = i*2;
+ for(i = 0; i < width/2; i++)
+ lines[i+width/2+height/2] = width-i*2-(width%2?0:1)+height;
+
+ granularity /= 6;
- max_num = 2*height;
- if(2*width>max_num)
- max_num = 2*width;
+ for (i = 0; i < max; i++)
+ {
+ int x, y, x2, y2;
+ if (lines[i] < height)
+ x = 0, y = lines[i], x2 = width, y2 = y;
+ else
+ x = lines[i]-height, y = 0, x2 = x, y2 = height;
- clear_lines = (int *)calloc(max_num, sizeof(int));
- if(clear_lines)
+ if (flip_x)
+ x = width-x, x2 = width-x2;
+ if (flip_y)
+ y = height-y, y2 = height-y2;
+
+ XDrawLine (dpy, window, gc, x, y, x2, y2);
+ XSync (dpy, False);
+ if (delay > 0 && ((i % granularity) == 0))
+ usleep (delay*granularity);
+ }
+ free(lines);
+}
+
+
+static void
+quad_wipe (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
+{
+ Bool flip_x = random() & 1;
+ Bool flip_y = random() & 1;
+ int max = width + height;
+ int *lines = (int *)calloc(max, sizeof(int));
+ int i;
+
+ granularity /= 3;
+
+ for (i = 0; i < max/4; i++)
{
- if(mode<0 || mode>=NUM_MODES)
- mode = random()%NUM_MODES;
- granularity = 25;
- switch(mode)
- {
- case 0: /* clear random horizontal lines */
- for(i = 0; i < height; i++)
- clear_lines[i] = i;
- for(i = 0; i < height; i++)
- {
- int t, r;
- t = clear_lines[i];
- r = random()%height;
- clear_lines[i] = clear_lines[r];
- clear_lines[r] = t;
- }
- num_lines = height;
- break;
-
- case 1: /* clear random vertical lines */
- for(i = 0; i < width; i++)
- clear_lines[i] = i+height;
- for(i = 0; i < width; i++)
- {
- int t, r;
- t = clear_lines[i];
- r = random()%width;
- clear_lines[i] = clear_lines[r];
- clear_lines[r] = t;
- }
- num_lines = width;
- break;
-
- case 2: /* 4 sequential wipes,
- L-R, T-B, R-L, B-T. */
- for(i = 0; i < width/2; i++)
- clear_lines[i] = i*2+height;
- for(i = 0; i < height/2; i++)
- clear_lines[i+width/2] = i*2;
- for(i = 0; i < width/2; i++)
- clear_lines[i+width/2+height/2] = width-i*2-(width%2?0:1)+height;
- num_lines = width+height/2;
- granularity = 4;
- break;
-
- case 3: /* 4 parallel wipes,
- L-R, T-B, R-L, B-T. */
- for(i = 0; i < max_num/4; i++)
- {
- clear_lines[i*4] = i*2;
- clear_lines[i*4+1] = height-i*2-(height%2?0:1);
- clear_lines[i*4+2] = height+i*2;
- clear_lines[i*4+3] = height+width-i*2-(width%2?0:1);
- }
- num_lines = max_num;
- granularity = 4;
- break;
-
- case 4: /* flutter wipe L-R */
- j = 0;
- for(i = 0; i < width*2; i++)
- {
- line = (i/16)*16-(i%16)*15;
- if(line>=0 && line<width)
- {
- clear_lines[j] = height+line;
- j++;
- }
- }
- num_lines = width;
- granularity = 4;
- break;
-
- case 5: /* flutter wipe R-L */
- j = 0;
- for(i = width*2; i >= 0; i--)
- {
- line = (i/16)*16-(i%16)*15;
- if(line>=0 && line<width)
- {
- clear_lines[j] = height+line;
- j++;
- }
- }
- num_lines = width;
- granularity = 4;
- break;
-
- case 6: /* circle wipe */
- {
- int full = 360 * 64;
- int inc = full / 64;
- int start = random() % full;
- int rad = (width > height ? width : height);
- if (random() & 1)
- inc = -inc;
- for (i = (inc > 0 ? 0 : full);
- (inc > 0 ? i < full : i > 0);
- i += inc) {
- XFillArc(dpy, window, gc,
- (width/2)-rad, (height/2)-rad, rad*2, rad*2,
- (i+start) % full, inc);
- XFlush (dpy);
- usleep (delay*granularity);
- }
- num_lines = 0;
- }
- break;
-
- case 7: /* three-circle wipe */
- {
- int full = 360 * 64;
- int q = full / 3;
- int inc = full / 180;
- int start = random() % q;
- int rad = (width > height ? width : height);
- if (random() & 1)
- inc = -inc;
- for (i = (inc > 0 ? 0 : q);
- (inc > 0 ? i < q : i > 0);
- i += inc) {
- XFillArc(dpy, window, gc,
- (width/2)-rad, (height/2)-rad, rad*2, rad*2,
- (i+start) % full, inc);
- XFillArc(dpy, window, gc,
- (width/2)-rad, (height/2)-rad, rad*2, rad*2,
- (i+start+q) % full, inc);
- XFillArc(dpy, window, gc,
- (width/2)-rad, (height/2)-rad, rad*2, rad*2,
- (i+start+q+q) % full, inc);
- XFlush (dpy);
- usleep (delay*granularity);
- }
- num_lines = 0;
- }
- break;
-
- default:
- abort();
- break;
- }
-
- for (i = 0; i < num_lines; i++)
- {
- if(clear_lines[i] < height)
- XDrawLine (dpy, window, gc, 0, clear_lines[i], width,
- clear_lines[i]);
- else
- XDrawLine (dpy, window, gc, clear_lines[i]-height, 0,
- clear_lines[i]-height, height);
- XFlush (dpy);
- if ((i % granularity) == 0)
- {
- usleep (delay*granularity);
- }
- }
-
- free(clear_lines);
+ lines[i*4] = i*2;
+ lines[i*4+1] = height-i*2-(height%2?0:1);
+ lines[i*4+2] = height+i*2;
+ lines[i*4+3] = height+width-i*2-(width%2?0:1);
}
+ for (i = 0; i < max; i++)
+ {
+ int x, y, x2, y2;
+ if (lines[i] < height)
+ x = 0, y = lines[i], x2 = width, y2 = y;
+ else
+ x = lines[i]-height, y = 0, x2 = x, y2 = height;
+
+ if (flip_x)
+ x = width-x, x2 = width-x2;
+ if (flip_y)
+ y = height-y, y2 = height-y2;
+
+ XDrawLine (dpy, window, gc, x, y, x2, y2);
+ XSync (dpy, False);
+ if (delay > 0 && ((i % granularity) == 0))
+ usleep (delay*granularity);
+ }
+ free(lines);
+}
+
+
+
+static void
+circle_wipe (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
+{
+ int full = 360 * 64;
+ int inc = full / 64;
+ int start = random() % full;
+ int rad = (width > height ? width : height);
+ int i;
+ if (random() & 1)
+ inc = -inc;
+ for (i = (inc > 0 ? 0 : full);
+ (inc > 0 ? i < full : i > 0);
+ i += inc)
+ {
+ XFillArc(dpy, window, gc,
+ (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (i+start) % full, inc);
+ XFlush (dpy);
+ usleep (delay*granularity);
+ }
+}
+
+
+static void
+three_circle_wipe (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
+{
+ int i;
+ int full = 360 * 64;
+ int q = full / 6;
+ int q2 = q * 2;
+ int inc = full / 240;
+ int start = random() % q;
+ int rad = (width > height ? width : height);
+
+ for (i = 0; i < q; i += inc)
+ {
+ XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (start+i) % full, inc);
+ XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (start-i) % full, -inc);
+
+ XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (start+q2+i) % full, inc);
+ XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (start+q2-i) % full, -inc);
+
+ XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (start+q2+q2+i) % full, inc);
+ XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2,
+ (start+q2+q2-i) % full, -inc);
+
+ XSync (dpy, False);
+ usleep (delay*granularity);
+ }
+}
+
+
+static void
+squaretate (Display *dpy, Window window, GC gc,
+ int width, int height, int delay, int granularity)
+{
+ int steps = (((width > height ? width : width) * 2) / granularity);
+ int i;
+ Bool flip = random() & 1;
+
+#define DRAW() \
+ if (flip) { \
+ points[0].x = width-points[0].x; \
+ points[1].x = width-points[1].x; \
+ points[2].x = width-points[2].x; } \
+ XFillPolygon (dpy, window, gc, points, 3, Convex, CoordModeOrigin)
+
+ for (i = 0; i < steps; i++)
+ {
+ XPoint points [3];
+ points[0].x = 0;
+ points[0].y = 0;
+ points[1].x = width;
+ points[1].y = 0;
+ points[2].x = 0;
+ points[2].y = points[0].y + ((i * height) / steps);
+ DRAW();
+
+ points[0].x = 0;
+ points[0].y = 0;
+ points[1].x = 0;
+ points[1].y = height;
+ points[2].x = ((i * width) / steps);
+ points[2].y = height;
+ DRAW();
+
+ points[0].x = width;
+ points[0].y = height;
+ points[1].x = 0;
+ points[1].y = height;
+ points[2].x = width;
+ points[2].y = height - ((i * height) / steps);
+ DRAW();
+
+ points[0].x = width;
+ points[0].y = height;
+ points[1].x = width;
+ points[1].y = 0;
+ points[2].x = width - ((i * width) / steps);
+ points[2].y = 0;
+ DRAW();
+
+ XSync (dpy, True);
+ if (delay > 0)
+ usleep (delay * granularity);
+ }
+#undef DRAW
+}
+
+
+
+
+static Eraser erasers[] = {
+ random_lines,
+ venetian,
+ triple_wipe,
+ quad_wipe,
+ circle_wipe,
+ three_circle_wipe,
+ squaretate,
+};
+
+
+void
+erase_window(Display *dpy, Window window, GC gc,
+ int width, int height, int mode, int delay)
+{
+ int granularity = 25;
+
+ if (mode < 0 || mode >= countof(erasers))
+ mode = random() % countof(erasers);
+ (*(erasers[mode])) (dpy, window, gc, width, height, delay, granularity);
XClearWindow (dpy, window);
XSync(dpy, False);
}
XGCValues gcv;
GC erase_gc;
XColor black;
- int erase_speed = get_integer_resource("eraseSpeed", "Integer");
- int erase_mode = get_integer_resource("eraseMode", "Integer");
+ int erase_speed, erase_mode;
+ char *s;
+
+ s = get_string_resource("eraseSpeed", "Integer");
+ if (s && *s)
+ erase_speed = get_integer_resource("eraseSpeed", "Integer");
+ else
+ erase_speed = 400;
+ if (s) free(s);
+
+ s = get_string_resource("eraseMode", "Integer");
+ if (s && *s)
+ erase_mode = get_integer_resource("eraseMode", "Integer");
+ else
+ erase_mode = -1;
+ if (s) free(s);
+
XGetWindowAttributes (dpy, window, &xgwa);
black.flags = DoRed|DoGreen|DoBlue;
black.red = black.green = black.blue = 0;
XFreeColors(dpy, xgwa.colormap, &black.pixel, 1, 0);
XFreeGC(dpy, erase_gc);
}
+
+
+\f
+#if 0
+#include "screenhack.h"
+
+char *progclass = "Erase";
+char *defaults [] = {
+ 0
+};
+
+XrmOptionDescRec options [] = {0};
+int options_size = 0;
+
+void
+screenhack (dpy, window)
+ Display *dpy;
+ Window window;
+{
+ int delay = 500000;
+ XGCValues gcv;
+ GC gc;
+ XColor white;
+ XWindowAttributes xgwa;
+ XGetWindowAttributes (dpy, window, &xgwa);
+ white.flags = DoRed|DoGreen|DoBlue;
+ white.red = white.green = white.blue = 0xFFFF;
+ XAllocColor(dpy, xgwa.colormap, &white);
+ gcv.foreground = white.pixel;
+ gc = XCreateGC (dpy, window, GCForeground, &gcv);
+
+ while (1)
+ {
+ XFillRectangle(dpy, window, gc, 0, 0, 1280, 1024);
+ XSync (dpy, False);
+ usleep (delay);
+ erase_full_window(dpy, window);
+ XSync (dpy, False);
+ usleep (delay);
+
+ }
+}
+
+#endif
-/* xscreensaver, Copyright (c) 1992-1997 Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1992-1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
int seconds, int ticks,
Bool out_p, Bool clear_windows)
{
+ int oseconds = seconds;
+ Bool was_in_p = !out_p;
+
+ /* When we're asked to fade in, first fade out, then fade in.
+ That way all the transitions are smooth -- from what's on the
+ screen, to black, to the desktop.
+ */
+ if (was_in_p)
+ {
+ clear_windows = True;
+ out_p = True;
+ seconds /= 3;
+ if (seconds == 0)
+ seconds = 1;
+ }
+
+ AGAIN:
+
#ifdef HAVE_SGI_VC_EXTENSION
/* First try to do it by fading the gamma in an SGI-specific way... */
if (0 != sgi_gamma_fade(dpy, black_windows, seconds, ticks, out_p,
there are TrueColor windows visible. */
fade_screens_1 (dpy, cmaps, black_windows, seconds, ticks,
out_p, clear_windows);
+
+ /* If we were supposed to be fading in, do so now (we just faded out,
+ so now fade back in.)
+ */
+ if (was_in_p)
+ {
+ was_in_p = False;
+ out_p = False;
+ seconds = oseconds * 2 / 3;
+ if (seconds == 0)
+ seconds = 1;
+ goto AGAIN;
+ }
}
releasing the colormaps.
*/
if (out_p && black_windows)
- for (i = 0; i < nscreens; i++)
- {
- if (clear_windows)
- XClearWindow (dpy, black_windows[i]);
- XMapRaised (dpy, black_windows[i]);
- }
-
+ {
+ for (i = 0; i < nscreens; i++)
+ {
+ if (clear_windows)
+ XClearWindow (dpy, black_windows[i]);
+ XMapRaised (dpy, black_windows[i]);
+ }
+ XSync(dpy, False);
+ }
/* Now put the target maps back.
If we're fading out, use the given cmap (or the default cmap, if none.)
{
XUnmapWindow (dpy, black_windows[screen]);
XClearWindow (dpy, black_windows[screen]);
+ XSync(dpy, False);
}
}
XSync(dpy, False);
}
+ /* I can't explain this; without this delay, we get a flicker.
+ I suppose there's some lossage with stale bits being in the
+ hardware frame buffer or something, and this delay gives it
+ time to flush out. This sucks! */
+ usleep(100000); /* 1/10th second */
+
for (screen = 0; screen < nscreens; screen++)
whack_gamma(dpy, screen, &info[screen], 1.0);
XSync(dpy, False);
if (info[screen].blue2) free (info[screen].blue2);
}
free(info);
+
return status;
}
float ratio)
{
int k;
+
if (ratio < 0) ratio = 0;
if (ratio > 1) ratio = 1;
for (k = 0; k < info->gamma_size; k++)
info->green2[k] = info->green1[k] * ratio;
info->blue2[k] = info->blue1[k] * ratio;
}
+
XSGIvcStoreGammaColors16(dpy, screen, info->gamma_map, info->nred,
XSGIVC_MComponentRed, info->red2);
XSGIvcStoreGammaColors16(dpy, screen, info->gamma_map, info->ngreen,
-/* xscreensaver, Copyright (c) 1992, 1993, 1994, 1997
+/* xscreensaver, Copyright (c) 1992, 1993, 1994, 1997, 1998
* Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
return False;
}
- /* Uh, this can't be right, can it? But it's necessary. X sucks.
- If the visual is of depth 24, but the image came back as depth 32,
- hack it to be 24 lest we get a BadMatch from XPutImage. (I presume
- I'm expected to look at the server's pixmap formats or some such
- nonsense... but fuck it.)
+ /* XReadDisplay tends to LIE about the depth of the image it read.
+ It is returning an XImage which has `depth' and `bits_per_pixel'
+ confused!
+
+ That is, on a 24-bit display, where all visuals claim depth 24, and
+ where XGetImage would return an XImage with depth 24, and where
+ XPutImage will get a BadMatch with images that are not depth 24,
+ XReadDisplay is returning images with depth 32! Fuckwits!
+
+ So if the visual is of depth 24, but the image came back as depth 32,
+ hack it to be 24 lest we get a BadMatch from XPutImage.
+
+ I wonder what happens on an 8-bit SGI... Probably it still returns
+ an image claiming depth 32? Certainly it can't be 8. So, let's just
+ smash it to 32...
*/
- if (xgwa.depth == 24 && image->depth == 32)
+ if (image->depth == 32 /* && xgwa.depth == 24 */ )
image->depth = 24;
/* If the visual of the window/pixmap into which we're going to draw is
-/* xscreensaver, Copyright (c) 1992, 1997 Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1992, 1997, 1998
+ * Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
for (s2 = s + strlen(s) - 1; s2 > s; s2--)
if (*s2 == ' ' || *s2 == '\t')
*s2 = 0;
+ else
+ break;
if (! XParseColor (dpy, cmap, s, &color))
{
-/* xscreensaver, Copyright (c) 1997 Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
#include "utils.h"
#include "sgivideo.h"
#include "resources.h"
+#include "visual.h"
#ifdef HAVE_SGI_VIDEO /* whole file */
static Bool install_video_frame(unsigned long *image, int width, int height,
Screen *screen, Visual *visual, Drawable dest);
+#ifdef DEBUG
+static void
+describe_input(const char *prefix, VLServer server, int camera)
+{
+ VLDevList dl;
+ int i, j;
+
+ if (camera == VL_ANY)
+ {
+ printf("%s: %s VL_ANY\n", progname, prefix);
+ return;
+ }
+
+ vlGetDeviceList(server, &dl);
+ for (i = 0; i < dl.numDevices; i++)
+ {
+ VLDevice *d = &dl.devices[i];
+ for (j = 0; j < d->numNodes; j++)
+ if (d->nodes[j].number == camera)
+ {
+ printf("%s: %s %d, \"%s\"\n", progname, prefix,
+ d->nodes[j].number,
+ d->nodes[j].name);
+ return;
+ }
+ }
+
+ /* else... */
+ printf("%s: %s %d (???)\n", progname, prefix, camera);
+}
+#endif /* DEBUG */
+
+
static Bool
grab_frame_1(Screen *screen, Visual *visual, Drawable dest, int camera)
{
goto DONE;
}
+#ifdef DEBUG
+ describe_input("trying device", server, camera);
+#endif /* DEBUG */
+
input = vlGetNode (server, VL_SRC, VL_VIDEO, camera);
output = vlGetNode (server, VL_DRN, VL_MEM, VL_ANY);
goto DONE;
}
+#ifdef DEBUG
+ describe_input("read device", server, camera);
+#endif /* DEBUG */
+
if (dark_image_p(image, width, height))
goto DONE;
else
{
int i;
+ VLServer server = vlOpenVideo (NULL);
for (i = 0; i < 5; i++) /* if we get all black images, retry up to
five times. */
{
- VLServer server = vlOpenVideo (NULL);
VLDevList dl;
int j;
vlGetDeviceList(server, &dl);
- vlCloseVideo (server);
+ vlCloseVideo(server);
for (j = 0; j < dl.numDevices; j++)
{
VLDevice *d = &dl.devices[j];
d->nodes[k].kind == VL_VIDEO)
if (grab_frame_1(screen, visual, dest, d->nodes[k].number))
return True;
+ /* nothing yet? go around and try again... */
}
- /* nothing yet? go around and try again... */
}
}
#ifdef DEBUG
XGCValues gcv;
GC gc;
XImage *ximage = 0;
+ int image_depth;
Bool free_data = False;
int vblank_kludge = 3; /* lose the closed-captioning blips... */
gcv.foreground = BlackPixelOfScreen(screen);
gc = XCreateGC (dpy, dest, GCFunction|GCForeground, &gcv);
- ximage = XCreateImage (dpy, visual, 32, ZPixmap, 0, (char *) image,
+ image_depth = visual_depth(screen, visual);
+ if (image_depth < 24)
+ image_depth = 24; /* We'll dither */
+
+ ximage = XCreateImage (dpy, visual, image_depth, ZPixmap, 0, (char *) image,
width, height, 8, 0);
XInitImage(ximage);
if (!ximage)
return False;
- if (ximage->depth == 32 && d == 24)
- ximage->depth = d;
-
-
if (gain > 0.0) /* Pump up the volume */
{
unsigned char *end = (unsigned char *) (image + (width * height));
static const char screensaver_id[] =
- "@(#)xscreensaver 2.14, by Jamie Zawinski (jwz@netscape.com)";
+ "@(#)xscreensaver 2.16, by Jamie Zawinski (jwz@netscape.com)";
-/* xscreensaver, Copyright (c) 1993, 1994, 1995, 1996, 1997
+/* xscreensaver, Copyright (c) 1993, 1994, 1995, 1996, 1997, 1998
* by Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
}
+#if 0
+/* You very probably don't want to be using this.
+ Pixmap depth doesn't refer to the depths of pixmaps, but rather, to
+ the depth of protocol-level on-the-wire pixmap data, that is, XImages.
+ To get this info, you should be looking at XImage->bits_per_pixel
+ instead. (And allocating the data for your XImage structures by
+ multiplying ximage->bytes_per_line by ximage->height.)
+ */
+int
+visual_pixmap_depth (Screen *screen, Visual *visual)
+{
+ Display *dpy = DisplayOfScreen (screen);
+ int vdepth = visual_depth (screen, visual);
+ int pdepth = vdepth;
+ int i, pfvc = 0;
+ XPixmapFormatValues *pfv = XListPixmapFormats (dpy, &pfvc);
+
+ /* Return the first matching depth in the pixmap formats. If there are no
+ matching pixmap formats (which shouldn't be able to happen at all) then
+ return the visual depth instead. */
+ for (i = 0; i < pfvc; i++)
+ if (pfv[i].depth == vdepth)
+ {
+ pdepth = pfv[i].bits_per_pixel;
+ break;
+ }
+ if (pfv)
+ XFree (pfv);
+ return pdepth;
+}
+#endif /* 0 */
+
+
int
visual_class (Screen *screen, Visual *visual)
{
-/* xscreensaver, Copyright (c) 1997 by Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1993-1998 by Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
extern Visual *get_visual (Screen *, const char *name, Bool, Bool);
extern Visual *get_visual_resource (Screen *, char *, char *, Bool);
extern int visual_depth (Screen *, Visual *);
+/* extern int visual_pixmap_depth (Screen *, Visual *); */
extern int visual_class (Screen *, Visual *);
extern int visual_cells (Screen *, Visual *);
extern int screen_number (Screen *);
-/* xscreensaver, Copyright (c) 1991-1993 Jamie Zawinski <jwz@netscape.com>
+/* xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski <jwz@netscape.com>
*
* Permission to use, copy, modify, distribute, and sell this software and its
* documentation for any purpose is hereby granted without fee, provided that
double xscale = w / 440.0;
double yscale = h / 216.0;
XPoint points [6];
- points [0].x = x + xscale * 20;
- points [0].y = y + yscale * 10;
- points [1].x = x + xscale * 120;
- points [1].y = y + yscale * 10;
- points [2].x = x + xscale * 243;
- points [2].y = y + yscale * 93;
- points [3].x = x + xscale * 57;
- points [3].y = y + yscale * 210;
- points [4].x = x + xscale * 20;
- points [4].y = y + yscale * 210;
- points [5].x = x + xscale * 175;
- points [5].y = y + yscale * 113;
+ points[0].x = x + xscale * 20; points[0].y = y + yscale * 10;
+ points[1].x = x + xscale * 120; points[1].y = y + yscale * 10;
+ points[2].x = x + xscale * 243; points[2].y = y + yscale * 93;
+ points[3].x = x + xscale * 57; points[3].y = y + yscale * 210;
+ points[4].x = x + xscale * 20; points[4].y = y + yscale * 210;
+ points[5].x = x + xscale * 175; points[5].y = y + yscale * 113;
XFillPolygon (dpy, window, draw_gc, points, 6, Complex, CoordModeOrigin);
- points [0].x = x + xscale * 197;
- points [0].y = y + yscale * 127;
- points [1].x = x + xscale * 384;
- points [1].y = y + yscale * 10;
- points [2].x = x + xscale * 420;
- points [2].y = y + yscale * 10;
- points [3].x = x + xscale * 265;
- points [3].y = y + yscale * 108;
- points [4].x = x + xscale * 420;
- points [4].y = y + yscale * 210;
- points [5].x = x + xscale * 320;
- points [5].y = y + yscale * 210;
+ points[0].x = x + xscale * 202; points[0].y = y + yscale * 132;
+ points[1].x = x + xscale * 384; points[1].y = y + yscale * 10;
+ points[2].x = x + xscale * 420; points[2].y = y + yscale * 10;
+ points[3].x = x + xscale * 270; points[3].y = y + yscale * 113;
+ points[4].x = x + xscale * 420; points[4].y = y + yscale * 210;
+ points[5].x = x + xscale * 320; points[5].y = y + yscale * 210;
XFillPolygon (dpy, window, draw_gc, points, 6, Complex, CoordModeOrigin);
}
+#include "spline.h"
+
void
skull (Display *dpy, Window window, GC draw_gc, GC erase_gc,
int x, int y, int w, int h)
{
- XPoint points [3];
- crossbones (dpy, window, draw_gc, x, y+h/2, w, h/2);
- x += w/100;
- y += h/15;
- XFillArc (dpy, window, draw_gc, (int) (x + (w * 0.3)), y, w/2, h/2,
- -40*64, 260*64);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.35)), y + h/5,
- (int) (w * 0.4), h/5);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.375)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.495)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.555)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.675)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- points [0].x = x + (w * 0.435);
- points [0].y = y + (h * 0.425);
- points [1].x = x + (w * 0.485);
- points [1].y = points [0].y;
- points [2].x = (points [0].x + points [1].x) / 2;
- points [2].y = points [0].y + h/10;
- XFillPolygon (dpy, window, draw_gc, points, 3, Complex, CoordModeOrigin);
- points [0].x = x + (w * 0.615);
- points [1].x = x + (w * 0.665);
- points [2].x = (points [0].x + points [1].x) / 2;
- XFillPolygon (dpy, window, draw_gc, points, 3, Complex, CoordModeOrigin);
- points [0].x = x + (w * 0.52);
- points [0].y = y + (h * 0.35);
- points [1].x = points [0].x - (w * 0.05);
- points [1].y = points [0].y;
- points [2].x = points [0].x;
- points [2].y = points [0].y - (w * 0.10);
- XFillPolygon (dpy, window, erase_gc, points, 3, Complex, CoordModeOrigin);
- points [0].x = x + (w * 0.57);
- points [1].x = x + (w * 0.62);
- points [2].x = points [0].x;
- XFillPolygon (dpy, window, erase_gc, points, 3, Complex, CoordModeOrigin);
- XFillArc (dpy, window, erase_gc, x + ((int) (w * 0.375)), y + h/7,
- w/10, h/10, 0, 360*64);
- XFillArc (dpy, window, erase_gc, x + ((int) (w * 0.615)), y + h/7,
- w/10, h/10, 0, 360*64);
+ spline s;
+ float w100, h100;
+ XPoint points [20];
+ double sx[20], sy[20];
+ int i;
+
+ memset(&s, 0, sizeof(s));
+ s.control_x = sx;
+ s.control_y = sy;
+
+ y -= (w * 0.025);
+
+ crossbones (dpy, window, draw_gc, x, y+(h/2), w, (h / 3));
+
+ x += (w * 0.27);
+ y += (h * 0.25);
+ w *= 0.6;
+ h *= 0.6;
+
+ w100 = w / 100.0;
+ h100 = h / 100.0;
+
+ points[ 0].x = x + (0 * w100); points[ 0].y = y + (10 * h100);
+ points[ 1].x = x + (10 * w100); points[ 1].y = y + (0 * h100);
+ points[ 2].x = x + (90 * w100); points[ 2].y = y + (0 * h100);
+ points[ 3].x = x + (100 * w100); points[ 3].y = y + (10 * h100);
+ points[ 4].x = x + (100 * w100); points[ 4].y = y + (30 * h100);
+ points[ 5].x = x + (90 * w100); points[ 5].y = y + (40 * h100);
+ points[ 6].x = x + (70 * w100); points[ 6].y = y + (40 * h100);
+ points[ 7].x = x + (70 * w100); points[ 7].y = y + (50 * h100);
+ points[ 8].x = x + (30 * w100); points[ 8].y = y + (50 * h100);
+ points[ 9].x = x + (30 * w100); points[ 9].y = y + (40 * h100);
+ points[10].x = x + (10 * w100); points[10].y = y + (40 * h100);
+ points[11].x = x + (0 * w100); points[11].y = y + (30 * h100);
+
+ for (i = 0; i < 12; i++)
+ sx[i] = points[i].x, sy[i] = points[i].y;
+ s.n_controls = i;
+ s.allocated_points = i;
+ s.points = (XPoint *) calloc (i, sizeof (*s.points));
+ compute_closed_spline(&s);
+
+ XFillPolygon (dpy, window, draw_gc, points+6, 4, Complex, CoordModeOrigin);
+ XFillPolygon (dpy, window, draw_gc, s.points, s.n_points,
+ Complex, CoordModeOrigin);
+
+ points[0].x = x + (20 * w100); points[0].y = y + (18 * h100);
+ points[1].x = x + (25 * w100); points[1].y = y + (15 * h100);
+ points[2].x = x + (43 * w100); points[2].y = y + (15 * h100);
+ points[3].x = x + (45 * w100); points[3].y = y + (17 * h100);
+ points[4].x = x + (45 * w100); points[4].y = y + (25 * h100);
+ points[5].x = x + (40 * w100); points[5].y = y + (30 * h100);
+ points[6].x = x + (30 * w100); points[6].y = y + (30 * h100);
+ points[7].x = x + (20 * w100); points[7].y = y + (23 * h100);
+ for (i = 0; i < 8; i++)
+ sx[i] = points[i].x, sy[i] = points[i].y;
+ s.n_controls = i;
+ compute_closed_spline(&s);
+ XFillPolygon (dpy, window, erase_gc, s.points, s.n_points,
+ Complex, CoordModeOrigin);
+
+ points[0].x = x + (80 * w100); points[0].y = y + (18 * h100);
+ points[1].x = x + (75 * w100); points[1].y = y + (15 * h100);
+ points[2].x = x + (57 * w100); points[2].y = y + (15 * h100);
+ points[3].x = x + (55 * w100); points[3].y = y + (17 * h100);
+ points[4].x = x + (55 * w100); points[4].y = y + (25 * h100);
+ points[5].x = x + (60 * w100); points[5].y = y + (30 * h100);
+ points[6].x = x + (70 * w100); points[6].y = y + (30 * h100);
+ points[7].x = x + (80 * w100); points[7].y = y + (23 * h100);
+ for (i = 0; i < 8; i++)
+ sx[i] = points[i].x, sy[i] = points[i].y;
+ s.n_controls = i;
+ compute_closed_spline(&s);
+ XFillPolygon (dpy, window, erase_gc, s.points, s.n_points,
+ Complex, CoordModeOrigin);
+
+ points[ 0].x = x + (48 * w100); points[ 0].y = y + (30 * h100);
+ points[ 1].x = x + (52 * w100); points[ 1].y = y + (30 * h100);
+ points[ 2].x = x + (56 * w100); points[ 2].y = y + (42 * h100);
+ points[ 3].x = x + (52 * w100); points[ 3].y = y + (45 * h100);
+ points[ 4].x = x + (48 * w100); points[ 4].y = y + (45 * h100);
+ points[ 5].x = x + (44 * w100); points[ 5].y = y + (42 * h100);
+ for (i = 0; i < 6; i++)
+ sx[i] = points[i].x, sy[i] = points[i].y;
+ s.n_controls = i;
+ compute_closed_spline(&s);
+ XFillPolygon (dpy, window, erase_gc, s.points, s.n_points,
+ Complex, CoordModeOrigin);
+
+ free(s.points);
}
--- /dev/null
+Begin3
+Title: xscreensaver
+Version: 2.16
+Entered-date: 21FEB98
+Description: A modular screen saver and locker for the X Window System.
+ Highly customizable: allows the use of any program that
+ can draw on the root window as a display mode.
+ Comes with more than 60 display modes.
+ Home page: http://people.netscape.com/jwz/xscreensaver/
+Keywords: screen saver, screen lock, lock, xlock, X11
+Author: jwz@netscape.com (Jamie Zawinski)
+Maintained-by: jwz@netscape.com (Jamie Zawinski)
+Primary-site: ftp.x.org /contrib/applications/
+ 742K xscreensaver-2.16.tar.gz
+ 17K xscreensaver.README
+ 1K xscreensaver.lsm
+Alternate-site: sunsite.unc.edu /pub/Linux/X11/screensavers/
+ 742K xscreensaver-2.16.tar.gz
+ 17K xscreensaver.README
+ 1K xscreensaver.lsm
+Platforms: Linux, Irix, SunOS, Solaris, HPUX, AIX, FreeBSD, NetBSD,
+ BSDI, SCO, OSF1, Ultrix, VMS.
+ Requires X11 and ANSI C.
+ Works with Motif or Athena.
+ Shadow passwords, Kerberos, and OpenGL optionally supported.
+ Multi-headed machines supported.
+Copying-policy: BSD
+End
--- /dev/null
+#!/bin/sh
+#
+# generate an lsm file (http://sunsite.unc.edu/pub/Linux/Incoming/LSM-TEMPLATE)
+# that is more-or-less correct for the current version of xscreensaver.
+# jwz, 18-Jan-98
+
+size() {
+ ls -l $* |
+ tail -1 |
+ sed 's/.* \([0-9][0-9][0-9][0-9][0-9]*\) .*/\1/' |
+ sed 's/[0-9][0-9][0-9]$/K/'
+}
+
+TAR_SIZE=`size xscreensaver-*.gz`
+README_SIZE=`size README`
+#LSM_SIZE=`size xscreensaver.lsm`
+LSM_SIZE="1K"
+
+VERSION=`sed -n 's/.*\([0-9][0-9]*\.[0-9]*\).*/\1/p' < utils/version.h`
+DATE=`date '+%d%b%y' | tr a-z A-Z`
+
+#URL=`sed -n 's/\(http:[^ ]*\)/\1/p' < README | sed 's/[^a-zA-Z/]$//'`
+
+echo "Begin3
+Title: xscreensaver
+Version: $VERSION
+Entered-date: $DATE
+Description: A modular screen saver and locker for the X Window System.
+ Highly customizable: allows the use of any program that
+ can draw on the root window as a display mode.
+ Comes with more than 60 display modes.
+ Home page: http://people.netscape.com/jwz/xscreensaver/
+Keywords: screen saver, screen lock, lock, xlock, X11
+Author: jwz@netscape.com (Jamie Zawinski)
+Maintained-by: jwz@netscape.com (Jamie Zawinski)
+Primary-site: ftp.x.org /contrib/applications/
+ $TAR_SIZE xscreensaver-$VERSION.tar.gz
+ $README_SIZE xscreensaver.README
+ $LSM_SIZE xscreensaver.lsm
+Alternate-site: sunsite.unc.edu /pub/Linux/X11/screensavers/
+ $TAR_SIZE xscreensaver-$VERSION.tar.gz
+ $README_SIZE xscreensaver.README
+ $LSM_SIZE xscreensaver.lsm
+Platforms: Linux, Irix, SunOS, Solaris, HPUX, AIX, FreeBSD, NetBSD,
+ BSDI, SCO, OSF1, Ultrix, VMS.
+ Requires X11 and ANSI C.
+ Works with Motif or Athena.
+ Shadow passwords, Kerberos, and OpenGL optionally supported.
+ Multi-headed machines supported.
+Copying-policy: BSD
+End"
+
+exit 0
projects / xscreensaver / commitdiff