From: Zygo Blaxell Date: Mon, 2 Mar 2009 05:42:23 +0000 (-0500) Subject: http://ftp.x.org/contrib/applications/xscreensaver-2.16.tar.gz X-Git-Url: http://git.hungrycats.org/cgi-bin/gitweb.cgi?a=commitdiff_plain;h=6bb727f03bff0389fbb1349d7df4c9d8d7532959;hp=5b7bc6e70fb439cf4c4bf771ae9f94077fe4fe08;p=xscreensaver ftp.x.org/contrib/applications/xscreensaver-2.16.tar.gz -rw-r--r-- 1 zblaxell zblaxell 742705 Feb 19 1998 xscreensaver-2.16.tar.gz e800ed42f5e289e1f3b7847d1a2e27c85d92ed1b xscreensaver-2.16.tar.gz --- diff --git a/Makefile.in b/Makefile.in index 6991f8e8..4985d506 100644 --- a/Makefile.in +++ b/Makefile.in @@ -7,10 +7,11 @@ VPATH = @srcdir@ SHELL = /bin/sh SUBDIRS = utils driver hacks hacks/glx -TARFILES = README README.VMS README.debugging INSTALL \ +TARFILES = README README.VMS README.debugging INSTALL xscreensaver.lsm \ configure configure.in Makefile.in config.h.in \ config.h-vms install-sh setup.com config.guess \ - config.sub makevms.com screenblank.txt + config.sub makevms.com screenblank.txt \ + xscreensaver.lsm.sh TAR = gtar COMPRESS = gzip --verbose --best COMPRESS_EXT = gz @@ -45,7 +46,7 @@ tags: clean: @$(MAKE_SUBDIR) distclean: clean - -rm -f Makefile config.status config.cache config.log *~ "#"* + -rm -f config.h Makefile config.status config.cache config.log *~ "#"* @$(MAKE_SUBDIR) dist: tar @@ -54,6 +55,8 @@ dist: tar tar: @$(MAKE) distdepend ; \ sh config.status ; \ + sh xscreensaver.lsm.sh > xscreensaver.lsm.$$$$ ; \ + mv xscreensaver.lsm.$$$$ xscreensaver.lsm ; \ NAME=`sed -n \ 's/[^0-9]*\([0-9]\.[0-9][0-9]*\).*/xscreensaver-\1/p' utils/version.h` ; \ rm -f $$NAME ; ln -s . $$NAME ; \ diff --git a/README b/README index 2133a5e3..021b9f11 100644 --- a/README +++ b/README @@ -86,6 +86,7 @@ window, which are pointed at by the screensaver's default resource settings. bubbles - condensation forms on your monitor, then pops. deco - Generates Brady-Bunch-era wall paneling. moire - Circular interference patterns. + moire2 - More moire. kaleidescope - Groovy, man. swirl - Swirly color-cycling patterns. bouboule - Spinning bubbles on a transparent ball. @@ -121,13 +122,15 @@ window, which are pointed at by the screensaver's default resource settings. ant - A cellular automaton. xjack - Simulates a schizophrenic typist. xlyap - Calculates and displays Lyapunov exponents. - escher - Draws some escher-like scenes (GLX only.) gears - Draws interlocking rotating gears (GLX only.) morph3d - Draws shiny shape-changing 3d forms (GLX only.) superquadrics - More shiny shape-changing 3d forms (GLX only.) pipes - Generates a field of intertwined plumbing (GLX only.) rubik - Solves a Rubik's Cube (GLX only.) sproingies - Marble Madness meets Q-Bert (GLX only.) + stairs - Draws Escher's infinite staircase (GLX only.) + cage - Draws Escher's impossible cage (GLX only.) + moebius - Draws Escher's Moebius Strip II (GLX only.) All of these will pop up their own window unless given that -root option. See their man pages for more details. @@ -160,6 +163,26 @@ http://people.netscape.com/jwz/xscreensaver/. -- Jamie Zawinski +Changes since 2.15: Made `flag' able to do XPM images. + New look for the xscreensaver logo (`xroger'). + Fixed compilation error on Suns with adjunct passwords. + Got multi-architecture builds working again. + Some configure tweaks for building on HPUX and Solaris. + Fixed bug in decayscreen. + Fixed typo i passwd.c. + Made `cynosure' not die when colormap is full. +Changes since 2.14: Added `cynosure' hack. + Added `moire2' hack. + Tweaked `erase.c' some more. + Made unfading a bit smoother. + Added `vidwhacker' hack (not installed by default.) + Added `stairs' hack. + Split `escher' into `cage' and `moebius', as per + xlockmore. + Changed subprocess handling to use sigaction() instead + of signal() if it's available (this is necessary for + SCO but should work fine on other systems too.) + Various other tweaks. Changes since 2.13: Better fix for the Motif drag-and-die lossage. Put in some kludges to work around a LessTif bug. XScreenSaver is known to work with LessTif 0.82 now. diff --git a/config.h.in b/config.h.in index d9d285cb..f8aed556 100644 --- a/config.h.in +++ b/config.h.in @@ -255,6 +255,9 @@ /* Define if you have the fcntl function. */ #undef HAVE_FCNTL +/* Define if you have the sigaction function. */ +#undef HAVE_SIGACTION + /* Define if you have the header file. */ #undef HAVE_UNISTD_H diff --git a/configure b/configure index 6f03ee5c..d5831435 100755 --- a/configure +++ b/configure @@ -52,7 +52,7 @@ ac_help="$ac_help ac_help="$ac_help --with-sgivc-ext Include support for the SGI-VIDEO-CONTROL server extension, if possible (this is the default). - --without-sgivc-ext Do not compile in support for this extension." + --without-sgivc-ext Do not compile in support for this extension." ac_help="$ac_help Toolkit options: @@ -1528,13 +1528,46 @@ EOF fi +echo $ac_n "checking for size_t""... $ac_c" 1>&6 +echo "configure:1533: checking for size_t" >&5 +if eval "test \"`echo '$''{'ac_cv_type_size_t'+set}'`\" = set"; then + echo $ac_n "(cached) $ac_c" 1>&6 +else + cat > conftest.$ac_ext < +#if STDC_HEADERS +#include +#include +#endif +EOF +if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | + egrep "size_t[^a-zA-Z_0-9]" >/dev/null 2>&1; then + rm -rf conftest* + ac_cv_type_size_t=yes +else + rm -rf conftest* + ac_cv_type_size_t=no +fi +rm -f conftest* + +fi +echo "$ac_t""$ac_cv_type_size_t" 1>&6 +if test $ac_cv_type_size_t = no; then + cat >> confdefs.h <<\EOF +#define size_t unsigned +EOF + +fi + echo $ac_n "checking return type of signal handlers""... $ac_c" 1>&6 -echo "configure:1533: checking return type of signal handlers" >&5 +echo "configure:1566: checking return type of signal handlers" >&5 if eval "test \"`echo '$''{'ac_cv_type_signal'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #include @@ -1551,7 +1584,7 @@ int main() { int i; ; return 0; } EOF -if { (eval echo configure:1555: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:1588: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_type_signal=void else @@ -1569,48 +1602,14 @@ cat >> confdefs.h <&6 -echo "configure:1574: checking for size_t" >&5 -if eval "test \"`echo '$''{'ac_cv_type_size_t'+set}'`\" = set"; then - echo $ac_n "(cached) $ac_c" 1>&6 -else - cat > conftest.$ac_ext < -#if STDC_HEADERS -#include -#include -#endif -EOF -if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | - egrep "size_t[^a-zA-Z_0-9]" >/dev/null 2>&1; then - rm -rf conftest* - ac_cv_type_size_t=yes -else - rm -rf conftest* - ac_cv_type_size_t=no -fi -rm -f conftest* - -fi -echo "$ac_t""$ac_cv_type_size_t" 1>&6 -if test $ac_cv_type_size_t = no; then - cat >> confdefs.h <<\EOF -#define size_t unsigned -EOF - -fi - - echo $ac_n "checking how to call gettimeofday""... $ac_c" 1>&6 -echo "configure:1609: checking how to call gettimeofday" >&5 +echo "configure:1608: checking how to call gettimeofday" >&5 if eval "test \"`echo '$''{'ac_cv_gettimeofday_args'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < #include @@ -1618,7 +1617,7 @@ int main() { struct timeval tv; gettimeofday(&tv); ; return 0; } EOF -if { (eval echo configure:1622: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:1621: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_gettimeofday_args=1 else @@ -1626,7 +1625,7 @@ else cat conftest.$ac_ext >&5 rm -rf conftest* cat > conftest.$ac_ext < #include @@ -1635,7 +1634,7 @@ struct timeval tv; struct timezone tzp; gettimeofday(&tv, &tzp); ; return 0; } EOF -if { (eval echo configure:1639: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:1638: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_gettimeofday_args=2 else @@ -1675,12 +1674,12 @@ fi for ac_func in select fcntl uname nice setpriority getcwd getwd putenv do echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 -echo "configure:1679: checking for $ac_func" >&5 +echo "configure:1678: checking for $ac_func" >&5 if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:1706: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_func_$ac_func=yes" else @@ -1727,21 +1726,77 @@ else fi done +for ac_func in sigaction +do +echo $ac_n "checking for $ac_func""... $ac_c" 1>&6 +echo "configure:1733: checking for $ac_func" >&5 +if eval "test \"`echo '$''{'ac_cv_func_$ac_func'+set}'`\" = set"; then + echo $ac_n "(cached) $ac_c" 1>&6 +else + cat > conftest.$ac_ext < +/* Override any gcc2 internal prototype to avoid an error. */ +/* We use char because int might match the return type of a gcc2 + builtin and then its argument prototype would still apply. */ +char $ac_func(); + +int main() { + +/* The GNU C library defines this for functions which it implements + to always fail with ENOSYS. Some functions are actually named + something starting with __ and the normal name is an alias. */ +#if defined (__stub_$ac_func) || defined (__stub___$ac_func) +choke me +#else +$ac_func(); +#endif + +; return 0; } +EOF +if { (eval echo configure:1761: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then + rm -rf conftest* + eval "ac_cv_func_$ac_func=yes" +else + echo "configure: failed program was:" >&5 + cat conftest.$ac_ext >&5 + rm -rf conftest* + eval "ac_cv_func_$ac_func=no" +fi +rm -f conftest* +fi + +if eval "test \"`echo '$ac_cv_func_'$ac_func`\" = yes"; then + echo "$ac_t""yes" 1>&6 + ac_tr_func=HAVE_`echo $ac_func | tr 'abcdefghijklmnopqrstuvwxyz' 'ABCDEFGHIJKLMNOPQRSTUVWXYZ'` + cat >> confdefs.h <&6 +fi +done + + for ac_hdr in unistd.h do ac_safe=`echo "$ac_hdr" | sed 'y%./+-%__p_%'` echo $ac_n "checking for $ac_hdr""... $ac_c" 1>&6 -echo "configure:1735: checking for $ac_hdr" >&5 +echo "configure:1790: checking for $ac_hdr" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:1745: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:1800: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -1793,7 +1848,7 @@ fi # Uses ac_ vars as temps to allow command line to override cache and checks. # --without-x overrides everything else, but does not touch the cache. echo $ac_n "checking for X""... $ac_c" 1>&6 -echo "configure:1797: checking for X" >&5 +echo "configure:1852: checking for X" >&5 # Check whether --with-x or --without-x was given. if test "${with_x+set}" = set; then @@ -1855,12 +1910,12 @@ if test "$ac_x_includes" = NO; then # First, try using that file with no special directory specified. cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:1864: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:1919: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -1929,14 +1984,14 @@ if test "$ac_x_libraries" = NO; then ac_save_LIBS="$LIBS" LIBS="-l$x_direct_test_library $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:1995: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* LIBS="$ac_save_LIBS" # We can link X programs with no special library path. @@ -2042,17 +2097,17 @@ else case "`(uname -sr) 2>/dev/null`" in "SunOS 5"*) echo $ac_n "checking whether -R must be followed by a space""... $ac_c" 1>&6 -echo "configure:2046: checking whether -R must be followed by a space" >&5 +echo "configure:2101: checking whether -R must be followed by a space" >&5 ac_xsave_LIBS="$LIBS"; LIBS="$LIBS -R$x_libraries" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2111: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* ac_R_nospace=yes else @@ -2068,14 +2123,14 @@ rm -f conftest* else LIBS="$ac_xsave_LIBS -R $x_libraries" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2134: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* ac_R_space=yes else @@ -2107,7 +2162,7 @@ rm -f conftest* # libraries were built with DECnet support. And karl@cs.umb.edu says # the Alpha needs dnet_stub (dnet does not exist). echo $ac_n "checking for dnet_ntoa in -ldnet""... $ac_c" 1>&6 -echo "configure:2111: checking for dnet_ntoa in -ldnet" >&5 +echo "configure:2166: checking for dnet_ntoa in -ldnet" >&5 ac_lib_var=`echo dnet'_'dnet_ntoa | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2115,7 +2170,7 @@ else ac_save_LIBS="$LIBS" LIBS="-ldnet $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2185: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2148,7 +2203,7 @@ fi if test $ac_cv_lib_dnet_dnet_ntoa = no; then echo $ac_n "checking for dnet_ntoa in -ldnet_stub""... $ac_c" 1>&6 -echo "configure:2152: checking for dnet_ntoa in -ldnet_stub" >&5 +echo "configure:2207: checking for dnet_ntoa in -ldnet_stub" >&5 ac_lib_var=`echo dnet_stub'_'dnet_ntoa | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2156,7 +2211,7 @@ else ac_save_LIBS="$LIBS" LIBS="-ldnet_stub $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2226: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2196,12 +2251,12 @@ fi # The nsl library prevents programs from opening the X display # on Irix 5.2, according to dickey@clark.net. echo $ac_n "checking for gethostbyname""... $ac_c" 1>&6 -echo "configure:2200: checking for gethostbyname" >&5 +echo "configure:2255: checking for gethostbyname" >&5 if eval "test \"`echo '$''{'ac_cv_func_gethostbyname'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2283: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_func_gethostbyname=yes" else @@ -2245,7 +2300,7 @@ fi if test $ac_cv_func_gethostbyname = no; then echo $ac_n "checking for gethostbyname in -lnsl""... $ac_c" 1>&6 -echo "configure:2249: checking for gethostbyname in -lnsl" >&5 +echo "configure:2304: checking for gethostbyname in -lnsl" >&5 ac_lib_var=`echo nsl'_'gethostbyname | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2253,7 +2308,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lnsl $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2323: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2294,12 +2349,12 @@ fi # -lsocket must be given before -lnsl if both are needed. # We assume that if connect needs -lnsl, so does gethostbyname. echo $ac_n "checking for connect""... $ac_c" 1>&6 -echo "configure:2298: checking for connect" >&5 +echo "configure:2353: checking for connect" >&5 if eval "test \"`echo '$''{'ac_cv_func_connect'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2381: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_func_connect=yes" else @@ -2343,7 +2398,7 @@ fi if test $ac_cv_func_connect = no; then echo $ac_n "checking for connect in -lsocket""... $ac_c" 1>&6 -echo "configure:2347: checking for connect in -lsocket" >&5 +echo "configure:2402: checking for connect in -lsocket" >&5 ac_lib_var=`echo socket'_'connect | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2351,7 +2406,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lsocket $X_EXTRA_LIBS $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2421: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2386,12 +2441,12 @@ fi # gomez@mi.uni-erlangen.de says -lposix is necessary on A/UX. echo $ac_n "checking for remove""... $ac_c" 1>&6 -echo "configure:2390: checking for remove" >&5 +echo "configure:2445: checking for remove" >&5 if eval "test \"`echo '$''{'ac_cv_func_remove'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2473: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_func_remove=yes" else @@ -2435,7 +2490,7 @@ fi if test $ac_cv_func_remove = no; then echo $ac_n "checking for remove in -lposix""... $ac_c" 1>&6 -echo "configure:2439: checking for remove in -lposix" >&5 +echo "configure:2494: checking for remove in -lposix" >&5 ac_lib_var=`echo posix'_'remove | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2443,7 +2498,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lposix $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2513: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2478,12 +2533,12 @@ fi # BSDI BSD/OS 2.1 needs -lipc for XOpenDisplay. echo $ac_n "checking for shmat""... $ac_c" 1>&6 -echo "configure:2482: checking for shmat" >&5 +echo "configure:2537: checking for shmat" >&5 if eval "test \"`echo '$''{'ac_cv_func_shmat'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2565: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_func_shmat=yes" else @@ -2527,7 +2582,7 @@ fi if test $ac_cv_func_shmat = no; then echo $ac_n "checking for shmat in -lipc""... $ac_c" 1>&6 -echo "configure:2531: checking for shmat in -lipc" >&5 +echo "configure:2586: checking for shmat in -lipc" >&5 ac_lib_var=`echo ipc'_'shmat | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2535,7 +2590,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lipc $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2605: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2579,7 +2634,7 @@ fi # libraries we check for below, so use a different variable. # --interran@uluru.Stanford.EDU, kb@cs.umb.edu. echo $ac_n "checking for IceConnectionNumber in -lICE""... $ac_c" 1>&6 -echo "configure:2583: checking for IceConnectionNumber in -lICE" >&5 +echo "configure:2638: checking for IceConnectionNumber in -lICE" >&5 ac_lib_var=`echo ICE'_'IceConnectionNumber | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2587,7 +2642,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lICE $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2657: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2635,7 +2690,7 @@ fi echo $ac_n "checking for X app-defaults directory""... $ac_c" 1>&6 -echo "configure:2639: checking for X app-defaults directory" >&5 +echo "configure:2694: checking for X app-defaults directory" >&5 if eval "test \"`echo '$''{'ac_cv_x_app_defaults'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -2762,7 +2817,7 @@ APPDEFAULTS=$ac_x_app_defaults fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < EOF @@ -2783,7 +2838,7 @@ rm -f conftest* # Check for the availability of the XPointer typedef, and define it otherwise. # echo $ac_n "checking for XPointer""... $ac_c" 1>&6 -echo "configure:2787: checking for XPointer" >&5 +echo "configure:2842: checking for XPointer" >&5 if eval "test \"`echo '$''{'ac_cv_xpointer'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -2794,14 +2849,14 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < int main() { XPointer foo = (XPointer) 0; ; return 0; } EOF -if { (eval echo configure:2805: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:2860: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_xpointer=yes else @@ -2853,7 +2908,7 @@ case "$host" in # Some versions of Slowlaris Motif require -lgen. But not all. Why? echo $ac_n "checking for regcmp in -lgen""... $ac_c" 1>&6 -echo "configure:2857: checking for regcmp in -lgen" >&5 +echo "configure:2912: checking for regcmp in -lgen" >&5 ac_lib_var=`echo gen'_'regcmp | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -2861,7 +2916,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lgen $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:2931: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -2909,17 +2964,17 @@ have_xmu=no CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/Xmu/Error.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/Xmu/Error.h""... $ac_c" 1>&6 -echo "configure:2913: checking for X11/Xmu/Error.h" >&5 +echo "configure:2968: checking for X11/Xmu/Error.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:2923: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:2978: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -2963,7 +3018,7 @@ if test $have_xmu = yes ; then case "$host" in *-sunos4*) echo $ac_n "checking for the SunOS 4.1.x _get_wmShellWidgetClass bug""... $ac_c" 1>&6 -echo "configure:2967: checking for the SunOS 4.1.x _get_wmShellWidgetClass bug" >&5 +echo "configure:3022: checking for the SunOS 4.1.x _get_wmShellWidgetClass bug" >&5 if eval "test \"`echo '$''{'ac_cv_sunos_xmu_bug'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -2976,14 +3031,14 @@ else # with X libraries because we know it's SunOS. LDFLAGS="$LDFLAGS -lXmu -lXt -lX11 -lXext -lm" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:3042: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* ac_cv_sunos_xmu_bug=no else @@ -2999,21 +3054,21 @@ fi echo "$ac_t""$ac_cv_sunos_xmu_bug" 1>&6 if test $ac_cv_sunos_xmu_bug = yes ; then echo $ac_n "checking whether the compiler understands -static""... $ac_c" 1>&6 -echo "configure:3003: checking whether the compiler understands -static" >&5 +echo "configure:3058: checking whether the compiler understands -static" >&5 if eval "test \"`echo '$''{'ac_cv_ld_static'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else ac_save_LDFLAGS="$LDFLAGS" LDFLAGS="$LDFLAGS -static" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:3072: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* ac_cv_ld_static=yes else @@ -3059,17 +3114,17 @@ if test $with_sgi = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/extensions/XScreenSaver.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/extensions/XScreenSaver.h""... $ac_c" 1>&6 -echo "configure:3063: checking for X11/extensions/XScreenSaver.h" >&5 +echo "configure:3118: checking for X11/extensions/XScreenSaver.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3073: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3128: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3124,17 +3179,17 @@ if test $have_sgi != yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/extensions/scrnsaver.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/extensions/scrnsaver.h""... $ac_c" 1>&6 -echo "configure:3128: checking for X11/extensions/scrnsaver.h" >&5 +echo "configure:3183: checking for X11/extensions/scrnsaver.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3138: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3193: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3178,7 +3233,7 @@ fi LDFLAGS="$LDFLAGS -L$x_libraries" fi echo $ac_n "checking for XScreenSaverRegister in -lXext""... $ac_c" 1>&6 -echo "configure:3182: checking for XScreenSaverRegister in -lXext" >&5 +echo "configure:3237: checking for XScreenSaverRegister in -lXext" >&5 ac_lib_var=`echo Xext'_'XScreenSaverRegister | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -3186,7 +3241,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lXext -lm $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:3256: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -3248,7 +3303,7 @@ fi LDFLAGS="$LDFLAGS -L$x_libraries" fi echo $ac_n "checking for XScreenSaverRegister in -lXExExt""... $ac_c" 1>&6 -echo "configure:3252: checking for XScreenSaverRegister in -lXExExt" >&5 +echo "configure:3307: checking for XScreenSaverRegister in -lXExExt" >&5 ac_lib_var=`echo XExExt'_'XScreenSaverRegister | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -3256,7 +3311,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lXExExt -lX11 -lXext -lm $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:3326: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -3313,7 +3368,7 @@ fi LDFLAGS="$LDFLAGS -L$x_libraries" fi echo $ac_n "checking for XScreenSaverRegister in -lXss""... $ac_c" 1>&6 -echo "configure:3317: checking for XScreenSaverRegister in -lXss" >&5 +echo "configure:3372: checking for XScreenSaverRegister in -lXss" >&5 ac_lib_var=`echo Xss'_'XScreenSaverRegister | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -3321,7 +3376,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lXss -lX11 -lXext -lm $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:3391: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -3393,17 +3448,17 @@ if test $with_xidle = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/extensions/xidle.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/extensions/xidle.h""... $ac_c" 1>&6 -echo "configure:3397: checking for X11/extensions/xidle.h" >&5 +echo "configure:3452: checking for X11/extensions/xidle.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3407: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3462: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3458,17 +3513,17 @@ if test $with_xshm = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/extensions/XShm.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/extensions/XShm.h""... $ac_c" 1>&6 -echo "configure:3462: checking for X11/extensions/XShm.h" >&5 +echo "configure:3517: checking for X11/extensions/XShm.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3472: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3527: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3502,17 +3557,17 @@ fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "sys/ipc.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for sys/ipc.h""... $ac_c" 1>&6 -echo "configure:3506: checking for sys/ipc.h" >&5 +echo "configure:3561: checking for sys/ipc.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3516: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3571: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3547,17 +3602,17 @@ fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "sys/shm.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for sys/shm.h""... $ac_c" 1>&6 -echo "configure:3551: checking for sys/shm.h" >&5 +echo "configure:3606: checking for sys/shm.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3561: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3616: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3618,17 +3673,17 @@ if test $with_sgivc = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/extensions/XSGIvc.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/extensions/XSGIvc.h""... $ac_c" 1>&6 -echo "configure:3622: checking for X11/extensions/XSGIvc.h" >&5 +echo "configure:3677: checking for X11/extensions/XSGIvc.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3632: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3687: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3671,7 +3726,7 @@ fi LDFLAGS="$LDFLAGS -L$x_libraries" fi echo $ac_n "checking for XSGIvcQueryGammaMap in -lXsgivc""... $ac_c" 1>&6 -echo "configure:3675: checking for XSGIvcQueryGammaMap in -lXsgivc" >&5 +echo "configure:3730: checking for XSGIvcQueryGammaMap in -lXsgivc" >&5 ac_lib_var=`echo Xsgivc'_'XSGIvcQueryGammaMap | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -3679,7 +3734,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lXsgivc -lXext -lX11 $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:3749: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -3793,17 +3848,17 @@ check_motif() { CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "Xm/Xm.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for Xm/Xm.h""... $ac_c" 1>&6 -echo "configure:3797: checking for Xm/Xm.h" >&5 +echo "configure:3852: checking for Xm/Xm.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3807: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3862: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3841,17 +3896,17 @@ check_athena() { CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/Xaw/Dialog.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/Xaw/Dialog.h""... $ac_c" 1>&6 -echo "configure:3845: checking for X11/Xaw/Dialog.h" >&5 +echo "configure:3900: checking for X11/Xaw/Dialog.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:3855: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:3910: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -3926,7 +3981,7 @@ fi # XawViewportSetCoordinates in Viewport.h (R3 (or R4?) don't.) if test $have_athena = yes ; then echo $ac_n "checking for XawViewportSetCoordinates in Viewport.h""... $ac_c" 1>&6 -echo "configure:3930: checking for XawViewportSetCoordinates in Viewport.h" >&5 +echo "configure:3985: checking for XawViewportSetCoordinates in Viewport.h" >&5 if eval "test \"`echo '$''{'ac_cv_have_XawViewportSetCoordinates'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3938,7 +3993,7 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < EOF @@ -3967,7 +4022,7 @@ fi have_lesstif=no if test $have_motif = yes ; then echo $ac_n "checking whether Motif is really LessTif""... $ac_c" 1>&6 -echo "configure:3971: checking whether Motif is really LessTif" >&5 +echo "configure:4026: checking whether Motif is really LessTif" >&5 if eval "test \"`echo '$''{'ac_cv_have_lesstif'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -3978,14 +4033,14 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < int main() { long vers = LesstifVersion; ; return 0; } EOF -if { (eval echo configure:3989: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4044: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_have_lesstif=yes else @@ -4010,7 +4065,7 @@ if test $have_lesstif = yes ; then # It must be at least "GNU Lesstif 0.82". # #### If you change this, also sync the warning message lower down. echo $ac_n "checking whether LessTif is of a recent enough vintage""... $ac_c" 1>&6 -echo "configure:4014: checking whether LessTif is of a recent enough vintage" >&5 +echo "configure:4069: checking whether LessTif is of a recent enough vintage" >&5 if eval "test \"`echo '$''{'ac_cv_good_lesstif'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4025,12 +4080,12 @@ else ac_cv_good_lesstif=yes else cat > conftest.$ac_ext < int main() { exit(LesstifVersion < 82); } EOF -if { (eval echo configure:4034: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest && (./conftest; exit) 2>/dev/null +if { (eval echo configure:4089: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest && (./conftest; exit) 2>/dev/null then ac_cv_good_lesstif=yes else @@ -4071,17 +4126,17 @@ if test $with_xpm = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/xpm.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/xpm.h""... $ac_c" 1>&6 -echo "configure:4075: checking for X11/xpm.h" >&5 +echo "configure:4130: checking for X11/xpm.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4085: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4140: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -4136,17 +4191,17 @@ if test $with_gl = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "GL/gl.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for GL/gl.h""... $ac_c" 1>&6 -echo "configure:4140: checking for GL/gl.h" >&5 +echo "configure:4195: checking for GL/gl.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4150: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4205: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -4177,17 +4232,17 @@ fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "GL/glx.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for GL/glx.h""... $ac_c" 1>&6 -echo "configure:4181: checking for GL/glx.h" >&5 +echo "configure:4236: checking for GL/glx.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4191: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4246: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -4227,7 +4282,7 @@ EOF fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < EOF @@ -4277,17 +4332,17 @@ if test $with_readdisplay = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "X11/extensions/readdisplay.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for X11/extensions/readdisplay.h""... $ac_c" 1>&6 -echo "configure:4281: checking for X11/extensions/readdisplay.h" >&5 +echo "configure:4336: checking for X11/extensions/readdisplay.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4291: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4346: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -4339,17 +4394,17 @@ if test $with_sgivideo = yes; then CPPFLAGS="$CPPFLAGS $X_CFLAGS" ac_safe=`echo "dmedia/vl.h" | sed 'y%./+-%__p_%'` echo $ac_n "checking for dmedia/vl.h""... $ac_c" 1>&6 -echo "configure:4343: checking for dmedia/vl.h" >&5 +echo "configure:4398: checking for dmedia/vl.h" >&5 if eval "test \"`echo '$''{'ac_cv_header_$ac_safe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else cat > conftest.$ac_ext < EOF ac_try="$ac_cpp conftest.$ac_ext >/dev/null 2>conftest.out" -{ (eval echo configure:4353: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } +{ (eval echo configure:4408: \"$ac_try\") 1>&5; (eval $ac_try) 2>&5; } ac_err=`grep -v '^ *+' conftest.out` if test -z "$ac_err"; then rm -rf conftest* @@ -4374,7 +4429,7 @@ fi if test $have_sgivideo = yes; then have_sgivideo=no echo $ac_n "checking for vlOpenVideo in -lvl""... $ac_c" 1>&6 -echo "configure:4378: checking for vlOpenVideo in -lvl" >&5 +echo "configure:4433: checking for vlOpenVideo in -lvl" >&5 ac_lib_var=`echo vl'_'vlOpenVideo | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4382,7 +4437,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lvl $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:4452: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -4414,7 +4469,7 @@ else fi if test $have_sgivideo = yes; then - SGI_VIDEO_OBJS="$(UTILS_SRC)/sgivideo.o" + SGI_VIDEO_OBJS="$(UTILS_BIN)/sgivideo.o" SGI_VIDEO_LIBS="-lvl" cat >> confdefs.h <<\EOF #define HAVE_SGI_VIDEO 1 @@ -4461,7 +4516,7 @@ if test -n "$with_zippy_req" ; then case "$with_zippy_req" in /*) echo $ac_n "checking for $with_zippy_req""... $ac_c" 1>&6 -echo "configure:4465: checking for $with_zippy_req" >&5 +echo "configure:4520: checking for $with_zippy_req" >&5 if test -x "$with_zippy_req" ; then echo "$ac_t""yes" 1>&6 else @@ -4475,7 +4530,7 @@ echo "configure:4465: checking for $with_zippy_req" >&5 # Extract the first word of "$with_zippy_req", so it can be a program name with args. set dummy $with_zippy_req; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4479: checking for $ac_word" >&5 +echo "configure:4534: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_zip2'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4521,7 +4576,7 @@ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4525: checking for $ac_word" >&5 +echo "configure:4580: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_emacs_exe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4554,7 +4609,7 @@ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4558: checking for $ac_word" >&5 +echo "configure:4613: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_xemacs_exe'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4588,7 +4643,7 @@ done if test -n "$emacs_exe" ; then echo $ac_n "checking for emacs yow""... $ac_c" 1>&6 -echo "configure:4592: checking for emacs yow" >&5 +echo "configure:4647: checking for emacs yow" >&5 # # get emacs to tell us where the libexec directory is. # @@ -4610,7 +4665,7 @@ echo "configure:4592: checking for emacs yow" >&5 if test -z "$ac_cv_zippy_program" ; then echo $ac_n "checking for xemacs yow""... $ac_c" 1>&6 -echo "configure:4614: checking for xemacs yow" >&5 +echo "configure:4669: checking for xemacs yow" >&5 if test -n "$xemacs_exe" ; then # # get xemacs to tell us where the libexec directory is. @@ -4656,7 +4711,7 @@ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4660: checking for $ac_word" >&5 +echo "configure:4715: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_prog_fortune'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4691,7 +4746,7 @@ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo $ac_n "checking for $ac_word""... $ac_c" 1>&6 -echo "configure:4695: checking for $ac_word" >&5 +echo "configure:4750: checking for $ac_word" >&5 if eval "test \"`echo '$''{'ac_cv_path_fortune'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4770,7 +4825,7 @@ fi if test $with_kerberos = yes; then echo $ac_n "checking for Kerberos""... $ac_c" 1>&6 -echo "configure:4774: checking for Kerberos" >&5 +echo "configure:4829: checking for Kerberos" >&5 if eval "test \"`echo '$''{'ac_cv_kerberos'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4781,14 +4836,14 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < int main() { ; return 0; } EOF -if { (eval echo configure:4792: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4847: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_kerberos=yes else @@ -4838,7 +4893,7 @@ fi # if test $passwd_cruft_done = no ; then echo $ac_n "checking for Sun-style shadow passwords""... $ac_c" 1>&6 -echo "configure:4842: checking for Sun-style shadow passwords" >&5 +echo "configure:4897: checking for Sun-style shadow passwords" >&5 if eval "test \"`echo '$''{'ac_cv_sun_adjunct'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4849,7 +4904,7 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < #include @@ -4862,7 +4917,7 @@ struct passwd_adjunct *p = getpwanam("nobody"); const char *pw = p->pwa_passwd; ; return 0; } EOF -if { (eval echo configure:4866: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4921: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_sun_adjunct=yes else @@ -4891,7 +4946,7 @@ EOF # if test $passwd_cruft_done = no ; then echo $ac_n "checking for DEC-style shadow passwords""... $ac_c" 1>&6 -echo "configure:4895: checking for DEC-style shadow passwords" >&5 +echo "configure:4950: checking for DEC-style shadow passwords" >&5 if eval "test \"`echo '$''{'ac_cv_enhanced_passwd'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -4902,7 +4957,7 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < #include @@ -4919,7 +4974,7 @@ struct pr_passwd *p; pw = p->ufld.fd_encrypt; ; return 0; } EOF -if { (eval echo configure:4923: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:4978: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_enhanced_passwd=yes else @@ -4945,7 +5000,7 @@ EOF # On SCO, getprpwnam() is in -lprot (which uses nap() from -lx) # (I'm told it needs -lcurses too, but I don't understand why.) echo $ac_n "checking for getprpwnam in -lprot""... $ac_c" 1>&6 -echo "configure:4949: checking for getprpwnam in -lprot" >&5 +echo "configure:5004: checking for getprpwnam in -lprot" >&5 ac_lib_var=`echo prot'_'getprpwnam | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4953,7 +5008,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lprot -lx $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5023: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -4984,7 +5039,7 @@ else echo "$ac_t""no" 1>&6 # On DEC, getprpwnam() is in -lsecurity echo $ac_n "checking for getprpwnam in -lsecurity""... $ac_c" 1>&6 -echo "configure:4988: checking for getprpwnam in -lsecurity" >&5 +echo "configure:5043: checking for getprpwnam in -lsecurity" >&5 ac_lib_var=`echo security'_'getprpwnam | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -4992,7 +5047,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lsecurity $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5062: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5032,7 +5087,7 @@ fi # if test $passwd_cruft_done = no ; then echo $ac_n "checking for HP-style shadow passwords""... $ac_c" 1>&6 -echo "configure:5036: checking for HP-style shadow passwords" >&5 +echo "configure:5091: checking for HP-style shadow passwords" >&5 if eval "test \"`echo '$''{'ac_cv_hpux_passwd'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5043,7 +5098,7 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < #include @@ -5056,7 +5111,7 @@ struct s_passwd *p = getspwnam("nobody"); const char *pw = p->pw_passwd; ; return 0; } EOF -if { (eval echo configure:5060: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5115: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_hpux_passwd=yes else @@ -5081,7 +5136,7 @@ EOF # on HPUX, bigcrypt is in -lsec echo $ac_n "checking for bigcrypt in -lsec""... $ac_c" 1>&6 -echo "configure:5085: checking for bigcrypt in -lsec" >&5 +echo "configure:5140: checking for bigcrypt in -lsec" >&5 ac_lib_var=`echo sec'_'bigcrypt | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5089,7 +5144,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lsec $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5159: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5127,7 +5182,7 @@ fi # if test $passwd_cruft_done = no ; then echo $ac_n "checking for generic shadow passwords""... $ac_c" 1>&6 -echo "configure:5131: checking for generic shadow passwords" >&5 +echo "configure:5186: checking for generic shadow passwords" >&5 if eval "test \"`echo '$''{'ac_cv_shadow'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 else @@ -5138,7 +5193,7 @@ else fi CPPFLAGS="$CPPFLAGS $X_CFLAGS" cat > conftest.$ac_ext < #include @@ -5150,7 +5205,7 @@ struct spwd *p = getspnam("nobody"); const char *pw = p->sp_pwdp; ; return 0; } EOF -if { (eval echo configure:5154: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then +if { (eval echo configure:5209: \"$ac_compile\") 1>&5; (eval $ac_compile) 2>&5; }; then rm -rf conftest* ac_cv_shadow=yes else @@ -5176,7 +5231,7 @@ EOF # On some systems (UnixWare 2.1), getspnam() is in -lgen instead of -lc. have_getspnam=no echo $ac_n "checking for getspnam in -lc""... $ac_c" 1>&6 -echo "configure:5180: checking for getspnam in -lc" >&5 +echo "configure:5235: checking for getspnam in -lc" >&5 ac_lib_var=`echo c'_'getspnam | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5184,7 +5239,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lc $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5254: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5217,7 +5272,7 @@ fi if test $have_getspnam = no ; then echo $ac_n "checking for getspnam in -lgen""... $ac_c" 1>&6 -echo "configure:5221: checking for getspnam in -lgen" >&5 +echo "configure:5276: checking for getspnam in -lgen" >&5 ac_lib_var=`echo gen'_'getspnam | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5225,7 +5280,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lgen $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5295: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5263,7 +5318,7 @@ fi # On some systems (UnixWare 2.1), crypt() is in -lcrypt instead of -lc. have_crypt=no echo $ac_n "checking for crypt in -lc""... $ac_c" 1>&6 -echo "configure:5267: checking for crypt in -lc" >&5 +echo "configure:5322: checking for crypt in -lc" >&5 ac_lib_var=`echo c'_'crypt | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5271,7 +5326,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lc $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5341: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else @@ -5304,7 +5359,7 @@ fi if test $have_crypt = no ; then echo $ac_n "checking for crypt in -lcrypt""... $ac_c" 1>&6 -echo "configure:5308: checking for crypt in -lcrypt" >&5 +echo "configure:5363: checking for crypt in -lcrypt" >&5 ac_lib_var=`echo crypt'_'crypt | sed 'y%./+-%__p_%'` if eval "test \"`echo '$''{'ac_cv_lib_$ac_lib_var'+set}'`\" = set"; then echo $ac_n "(cached) $ac_c" 1>&6 @@ -5312,7 +5367,7 @@ else ac_save_LIBS="$LIBS" LIBS="-lcrypt $LIBS" cat > conftest.$ac_ext <&5; (eval $ac_link) 2>&5; } && test -s conftest; then +if { (eval echo configure:5382: \"$ac_link\") 1>&5; (eval $ac_link) 2>&5; } && test -s conftest; then rm -rf conftest* eval "ac_cv_lib_$ac_lib_var=yes" else diff --git a/configure.in b/configure.in index 76ce4d2e..e614456e 100644 --- a/configure.in +++ b/configure.in @@ -60,9 +60,8 @@ AC_HEADER_DIRENT AC_TYPE_MODE_T AC_TYPE_PID_T -AC_TYPE_SIGNAL AC_TYPE_SIZE_T - +AC_TYPE_SIGNAL AC_MSG_CHECKING(how to call gettimeofday) AC_CACHE_VAL(ac_cv_gettimeofday_args, @@ -91,6 +90,8 @@ fi AC_CHECK_FUNCS(select fcntl uname nice setpriority getcwd getwd putenv) +AC_CHECK_FUNCS(sigaction) + AC_CHECK_HEADERS(unistd.h) dnl /usr/local/src/ssh-1.2.17/putenv.c -- AC_REPLACE_FUNCS(putenv) @@ -331,15 +332,22 @@ case "$host" in if test -d /usr/contrib/X11R6/include ; then X_CFLAGS="-I/usr/contrib/X11R6/include $X_CFLAGS" X_LIBS="-L/usr/contrib/X11R6/lib $X_LIBS" + elif test -d /usr/X11R6/include ; then + X_CFLAGS="-I/usr/X11R6/include $X_CFLAGS" + X_LIBS="-L/usr/X11R6/lib $X_LIBS" elif test -d /usr/contrib/X11R5/include ; then X_CFLAGS="-I/usr/contrib/X11R5/include $X_CFLAGS" X_LIBS="-L/usr/contrib/X11R5/lib $X_LIBS" + elif test -d /usr/X11R5/include ; then + X_CFLAGS="-I/usr/X11R5/include $X_CFLAGS" + X_LIBS="-L/usr/X11R5/lib $X_LIBS" fi ;; *-solaris*) # Same to you, pinheads. (Is this really the standard location now? # What happened to the joke that this kind of thing went in /opt?) + # cthomp says "answer: CDE (Common Disorganized Environment)" if test -f /usr/dt/include/Xm/Xm.h ; then X_CFLAGS="$X_CFLAGS -I/usr/dt/include" X_LIBS="$X_LIBS -L/usr/dt/lib -R:/usr/dt/lib" @@ -816,7 +824,7 @@ if test $with_sgivideo = yes; then have_sgivideo=no AC_CHECK_LIB(vl, vlOpenVideo, have_sgivideo=yes) if test $have_sgivideo = yes; then - SGI_VIDEO_OBJS="$(UTILS_SRC)/sgivideo.o" + SGI_VIDEO_OBJS="$(UTILS_BIN)/sgivideo.o" SGI_VIDEO_LIBS="-lvl" AC_DEFINE(HAVE_SGI_VIDEO) fi diff --git a/driver/Makefile.in b/driver/Makefile.in index 7164ecce..56b7f618 100644 --- a/driver/Makefile.in +++ b/driver/Makefile.in @@ -38,14 +38,14 @@ X_LIBS = @X_LIBS@ X_PRE_LIBS = @X_PRE_LIBS@ X_EXTRA_LIBS = @X_EXTRA_LIBS@ -XLIBS = $(X_LIBS) $(X_PRE_LIBS) -lX11 -lXext $(X_EXTRA_LIBS) +XLIBS = $(X_PRE_LIBS) -lX11 -lXext $(X_EXTRA_LIBS) AD_DIR = @APPDEFAULTS@ UTILS_SRC = $(srcdir)/../utils UTILS_BIN = ../utils -INCLUDES = -I. -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) @INCLUDES@ +INCLUDES = -I. -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) -I.. @INCLUDES@ PASSWD_LIBS = @PASSWD_LIBS@ MOTIF_SRCS = dialogs-Xm.c @@ -73,10 +73,12 @@ LOCK_OBJS = @LOCK_OBJS@ UTIL_SRCS = $(UTILS_SRC)/fade.c $(UTILS_SRC)/overlay.c \ $(UTILS_SRC)/resources.c $(UTILS_SRC)/usleep.c \ $(UTILS_SRC)/visual.c $(UTILS_SRC)/xroger.c \ + $(UTILS_SRC)/spline.c \ $(UTILS_SRC)/yarandom.c @XMU_SRCS@ UTIL_OBJS = $(UTILS_BIN)/fade.o $(UTILS_BIN)/overlay.o \ $(UTILS_BIN)/resources.o $(UTILS_BIN)/usleep.o \ $(UTILS_BIN)/visual.o $(UTILS_BIN)/xroger.o \ + $(UTILS_BIN)/spline.o \ $(UTILS_BIN)/yarandom.o @XMU_OBJS@ SAVER_SRCS_1 = demo.c stderr.c subprocs.c timers.c windows.c \ @@ -86,11 +88,11 @@ SAVER_OBJS_1 = demo.o stderr.o subprocs.o timers.o windows.o \ SAVER_SRCS = $(SAVER_SRCS_1) $(DIALOG_SRCS) $(LOCK_SRCS) $(UTIL_SRCS) SAVER_OBJS = $(SAVER_OBJS_1) $(DIALOG_OBJS) $(LOCK_OBJS) $(UTIL_OBJS) -SAVER_LIBS = @SAVER_LIBS@ -lXt $(XLIBS) $(PASSWD_LIBS) $(LIBS) +SAVER_LIBS = $(X_LIBS) @SAVER_LIBS@ -lXt $(XLIBS) $(PASSWD_LIBS) $(LIBS) CMD_SRCS = xscreensaver-command.c CMD_OBJS = xscreensaver-command.o -CMD_LIBS = $(XLIBS) $(LIBS) +CMD_LIBS = $(X_LIBS) $(XLIBS) $(LIBS) EXES = xscreensaver xscreensaver-command @@ -132,7 +134,7 @@ install-program: $$e " must run 'make install' as 'root', not as '$$me'." ;\ $$e "" ;\ $$e " For now, xscreensaver will be installed non-setuid, which" ;\ - $$e " means that locking may not work." ;\ + $$e " means that locking might not work." ;\ $$e "" ;\ fi ; \ fi ; \ @@ -196,7 +198,8 @@ distdepend: update_ad_version XScreenSaver_ad.h sed -e 's@ \./@ @g;s@ /[^ ]*@@g;/^.*:$$/d' \ -e 's@\.\./utils@$$(UTILS_SRC)@g' \ -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \ - -e 's@$$.*\(XScreenSaver_ad\)@\1@g' ; \ + -e 's@$$.*\(XScreenSaver_ad\)@\1@g' \ + -e 's@ $$(srcdir)/\(.*config\.h\)@ \1@g' ; \ echo '' \ ) > /tmp/distdepend.$$$$ && \ mv Makefile.in Makefile.in.bak && \ @@ -242,6 +245,7 @@ $(UTILS_BIN)/usleep.o: $(UTILS_SRC)/usleep.c $(UTILS_BIN)/visual.o: $(UTILS_SRC)/visual.c $(UTILS_BIN)/xmu.o: $(UTILS_SRC)/xmu.c $(UTILS_BIN)/xroger.o: $(UTILS_SRC)/xroger.c +$(UTILS_BIN)/spline.o: $(UTILS_SRC)/spline.c $(UTILS_BIN)/yarandom.o: $(UTILS_SRC)/yarandom.c $(UTIL_OBJS): @@ -271,31 +275,31 @@ xscreensaver-command: $(CMD_OBJS) # # DO NOT DELETE: updated by make distdepend -demo.o: $(srcdir)/../config.h +demo.o: ../config.h demo.o: $(srcdir)/xscreensaver.h demo.o: $(UTILS_SRC)/resources.h -stderr.o: $(srcdir)/../config.h +stderr.o: ../config.h stderr.o: $(srcdir)/xscreensaver.h stderr.o: $(UTILS_SRC)/resources.h stderr.o: $(UTILS_SRC)/visual.h -subprocs.o: $(srcdir)/../config.h +subprocs.o: ../config.h subprocs.o: $(srcdir)/xscreensaver.h subprocs.o: $(UTILS_SRC)/yarandom.h -timers.o: $(srcdir)/../config.h +timers.o: ../config.h timers.o: $(srcdir)/xscreensaver.h -windows.o: $(srcdir)/../config.h +windows.o: ../config.h windows.o: $(srcdir)/xscreensaver.h windows.o: $(UTILS_SRC)/visual.h windows.o: $(UTILS_SRC)/fade.h -xscreensaver.o: $(srcdir)/../config.h +xscreensaver.o: ../config.h xscreensaver.o: $(srcdir)/xscreensaver.h xscreensaver.o: $(UTILS_SRC)/version.h xscreensaver.o: $(UTILS_SRC)/yarandom.h xscreensaver.o: $(UTILS_SRC)/resources.h xscreensaver.o: $(UTILS_SRC)/visual.h xscreensaver.o: XScreenSaver_ad.h -xset.o: $(srcdir)/../config.h +xset.o: ../config.h xset.o: $(srcdir)/xscreensaver.h -xscreensaver-command.o: $(srcdir)/../config.h +xscreensaver-command.o: ../config.h xscreensaver-command.o: $(UTILS_SRC)/version.h diff --git a/driver/XScreenSaver.ad.in b/driver/XScreenSaver.ad.in index 6e02a532..72f79d4b 100644 --- a/driver/XScreenSaver.ad.in +++ b/driver/XScreenSaver.ad.in @@ -4,7 +4,7 @@ ! a screen saver and locker for the X window system ! by Jamie Zawinski ! -! version 2.14 +! version 2.16 ! ! See "man xscreensaver" for more info. The latest version is always ! available at http://people.netscape.com/jwz/xscreensaver/ @@ -90,6 +90,7 @@ lmorph -root \n\ deco -root \n\ moire -root \n\ + moire2 -root \n\ lightning -root \n\ strange -root \n\ spiral -root \n\ @@ -125,6 +126,7 @@ kaleidescope -root \n\ xjack -root \n\ xlyap -root -random \n\ + cynosure -root \n\ \ mono: rocks -root \n\ color: rocks -root -fg darksalmon \n\ @@ -147,7 +149,9 @@ @GL_KLUDGE_2@ gears -root \n\ @GL_KLUDGE_2@ superquadrics -root \n\ @GL_KLUDGE_2@ morph3d -root \n\ -@GL_KLUDGE_2@ escher -root \n\ +@GL_KLUDGE_2@ cage -root \n\ +@GL_KLUDGE_2@ moebius -root \n\ +@GL_KLUDGE_2@ stairs -root \n\ @GL_KLUDGE_2@ pipes -root \n\ @GL_KLUDGE_2@ sproingies -root \n\ @GL_KLUDGE_2@ rubik -root \n @@ -157,11 +161,11 @@ ! If your vendor doesn't provide real OpenGL, you might want to consider ! building MesaGL, which is a free implementation -- GL is way cool. ! -! Note that those hacks (gears, superquadratics, morph3d, escher, pipes, -! sproingies, and rubik) tend to work best on a visual *half* as deep as the -! depth of the screen, since that way, they can do double-buffering -- try it -! and see, but you will probably find that you should specify the deepest -! visual that is half as deep as the screen. +! Note that those hacks (gears, superquadratics, morph3d, cage, moebius, +! stairs, pipes, sproingies, and rubik) tend to work best on a visual *half* +! as deep as the depth of the screen, since that way, they can do +! double-buffering -- try it and see, but you will probably find that you +! should specify the deepest visual that is half as deep as the screen. ! ! For example, on a screen that supports both 24-bit TrueColor and 12-bit ! PseudoColor, the 12-bit visual will probably work best (this is true of @@ -287,8 +291,8 @@ *label1.labelString: XScreenSaver %s *label1.label: XScreenSaver %s -*label2.labelString: Copyright © 1991-1997 by Jamie Zawinski -*label2.label: Copyright © 1991-1997 by Jamie Zawinski +*label2.labelString: Copyright © 1991-1998 by Jamie Zawinski +*label2.label: Copyright © 1991-1998 by Jamie Zawinski *demoList.visibleItemCount: 10 *demoList.automaticSelection: True *next.labelString: Run Next diff --git a/driver/XScreenSaver_ad.h b/driver/XScreenSaver_ad.h index efdd8a61..41251ece 100644 --- a/driver/XScreenSaver_ad.h +++ b/driver/XScreenSaver_ad.h @@ -43,6 +43,7 @@ lmorph -root \\n\ deco -root \\n\ moire -root \\n\ + moire2 -root \\n\ lightning -root \\n\ strange -root \\n\ spiral -root \\n\ @@ -78,6 +79,7 @@ kaleidescope -root \\n\ xjack -root \\n\ xlyap -root -random \\n\ + cynosure -root \\n\ \ mono: rocks -root \\n\ color: rocks -root -fg darksalmon \\n\ @@ -100,7 +102,9 @@ gears -root \\n\ superquadrics -root \\n\ morph3d -root \\n\ - escher -root \\n\ + cage -root \\n\ + moebius -root \\n\ + stairs -root \\n\ pipes -root \\n\ sproingies -root \\n\ rubik -root \\n", @@ -125,8 +129,8 @@ "*demoDialog.maxWidth: 600", "*label1.labelString: XScreenSaver %s", "*label1.label: XScreenSaver %s", -"*label2.labelString: Copyright © 1991-1997 by Jamie Zawinski ", -"*label2.label: Copyright © 1991-1997 by Jamie Zawinski ", +"*label2.labelString: Copyright © 1991-1998 by Jamie Zawinski ", +"*label2.label: Copyright © 1991-1998 by Jamie Zawinski ", "*demoList.visibleItemCount: 10", "*demoList.automaticSelection: True", "*next.labelString: Run Next", diff --git a/driver/passwd.c b/driver/passwd.c index cc121221..b0a4b8ad 100644 --- a/driver/passwd.c +++ b/driver/passwd.c @@ -1,5 +1,5 @@ /* passwd.c --- verifying typed passwords with the OS. - * xscreensaver, Copyright (c) 1993-1997 Jamie Zawinski + * xscreensaver, Copyright (c) 1993-1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -61,7 +61,7 @@ # include # include -# define PRTYPE passwd_adjunct * +# define PWTYPE struct passwd_adjunct * # define PWPSLOT pwa_passwd # define GETPW getpwanam @@ -70,7 +70,7 @@ # include # include -# define PRTYPE struct s_passwd * +# define PWTYPE struct s_passwd * # define PWPSLOT pw_passwd # define GETPW getspwnam # define crypt bigcrypt diff --git a/driver/subprocs.c b/driver/subprocs.c index ce3661e2..9070b81b 100644 --- a/driver/subprocs.c +++ b/driver/subprocs.c @@ -1,5 +1,5 @@ /* subprocs.c --- choosing, spawning, and killing screenhacks. - * xscreensaver, Copyright (c) 1991, 1992, 1993, 1995, 1997 + * xscreensaver, Copyright (c) 1991, 1992, 1993, 1995, 1997, 1998 * Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its @@ -427,12 +427,12 @@ static int block_sigchld_handler = 0; static void block_sigchld (void) { -#ifdef USE_SIGACTION +#ifdef HAVE_SIGACTION sigset_t child_set; sigemptyset (&child_set); sigaddset (&child_set, SIGCHLD); sigprocmask (SIG_BLOCK, &child_set, 0); -#endif /* USE_SIGACTION */ +#endif /* HAVE_SIGACTION */ block_sigchld_handler++; } @@ -440,12 +440,13 @@ block_sigchld (void) static void unblock_sigchld (void) { -#ifdef USE_SIGACTION +#ifdef HAVE_SIGACTION sigset_t child_set; sigemptyset(&child_set); sigaddset(&child_set, SIGCHLD); sigprocmask(SIG_UNBLOCK, &child_set, 0); -#endif /* USE_SIGACTION */ +#endif /* HAVE_SIGACTION */ + block_sigchld_handler--; } @@ -536,7 +537,7 @@ sigchld_handler (int sig) if (si->prefs.debug_p) fprintf(stderr, "%s: got SIGCHLD%s\n", progname, (block_sigchld_handler ? " (blocked)" : "")); -#endif +#endif /* DEBUG */ if (block_sigchld_handler < 0) abort(); @@ -549,7 +550,7 @@ sigchld_handler (int sig) init_sigchld(); } -#endif +#endif /* SIGCHLD */ #ifndef VMS @@ -570,7 +571,7 @@ await_dying_children (saver_info *si) (long) kid, errno); else fprintf (stderr, "%s: waitpid(-1) ==> %ld\n", progname, (long) kid); -#endif +#endif /* DEBUG */ /* 0 means no more children to reap. -1 means error -- except "interrupted system call" isn't a "real" @@ -670,7 +671,7 @@ init_sigchld (void) { #ifdef SIGCHLD -# ifdef USE_SIGACTION /* Thanks to Tom Kelly */ +# ifdef HAVE_SIGACTION /* Thanks to Tom Kelly */ static Bool sigchld_initialized_p = 0; if (!sigchld_initialized_p) @@ -690,7 +691,7 @@ init_sigchld (void) sigchld_initialized_p = True; } -# else /* !USE_SIGACTION */ +# else /* !HAVE_SIGACTION */ if (((long) signal (SIGCHLD, sigchld_handler)) == -1L) { @@ -698,8 +699,8 @@ init_sigchld (void) sprintf (buf, "%s: couldn't catch SIGCHLD", progname); perror (buf); } -# endif /* !USE_SIGACTION */ -#endif +# endif /* !HAVE_SIGACTION */ +#endif /* SIGCHLD */ } @@ -893,7 +894,7 @@ emergency_kill_subproc (saver_info *si) int i; #ifdef SIGCHLD signal (SIGCHLD, SIG_IGN); -#endif +#endif /* SIGCHLD */ for (i = 0; i < si->nscreens; i++) { @@ -1053,6 +1054,7 @@ hack_uid (saver_info *si) si->locking_disabled_p = True; si->nolock_reason = "running as root"; p = getpwnam ("nobody"); + if (! p) p = getpwnam ("noaccess"); if (! p) p = getpwnam ("daemon"); if (! p) p = getpwnam ("bin"); if (! p) p = getpwnam ("sys"); @@ -1088,13 +1090,14 @@ hack_uid (saver_info *si) } } } -#ifndef NO_LOCKING +# ifndef NO_LOCKING else /* disable locking if already being run as "someone else" */ { struct passwd *p = getpwuid (getuid ()); if (!p || !strcmp (p->pw_name, "root") || !strcmp (p->pw_name, "nobody") || + !strcmp (p->pw_name, "noaccess") || !strcmp (p->pw_name, "daemon") || !strcmp (p->pw_name, "bin") || !strcmp (p->pw_name, "sys")) @@ -1104,7 +1107,7 @@ hack_uid (saver_info *si) sprintf (si->nolock_reason, "running as %s", p->pw_name); } } -#endif /* NO_LOCKING */ +# endif /* !NO_LOCKING */ } void diff --git a/driver/windows.c b/driver/windows.c index 06c0bb4e..7a938c5a 100644 --- a/driver/windows.c +++ b/driver/windows.c @@ -1,5 +1,5 @@ /* windows.c --- turning the screen black; dealing with visuals, virtual roots. - * xscreensaver, Copyright (c) 1991-1997 Jamie Zawinski + * xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -822,6 +822,10 @@ raise_window (saver_info *si, current_maps[i] = (between_hacks_p ? ssi->cmap : DefaultColormapOfScreen (ssi->screen)); + /* Ensure that the default background of the window is really black, + not a pixmap or something. (This does not clear the window.) */ + XSetWindowBackground (si->dpy, ssi->screensaver_window, + ssi->black_pixel); } if (p->verbose_p) fprintf (stderr, "%s: fading... ", progname); @@ -941,11 +945,17 @@ unblank_screen (saver_info *si) { saver_screen_info *ssi = &si->screens[i]; current_windows[i] = ssi->screensaver_window; + /* Ensure that the default background of the window is really black, + not a pixmap or something. (This does not clear the window.) */ + XSetWindowBackground (si->dpy, ssi->screensaver_window, + ssi->black_pixel); } if (p->verbose_p) fprintf (stderr, "%s: unfading... ", progname); + XSync (si->dpy, False); XGrabServer (si->dpy); + XSync (si->dpy, False); for (i = 0; i < si->nscreens; i++) { saver_screen_info *ssi = &si->screens[i]; @@ -955,6 +965,7 @@ unblank_screen (saver_info *si) clear_stderr (ssi); } XUngrabServer (si->dpy); + XSync (si->dpy, False); fade_screens (si->dpy, 0, current_windows, p->fade_seconds, p->fade_ticks, @@ -1025,6 +1036,13 @@ unblank_screen (saver_info *si) } #endif + /* Unmap the windows a second time, dammit -- just to avoid a race + with the screen-grabbing hacks. (I'm not sure if this is really + necessary; I'm stabbing in the dark now.) + */ + for (i = 0; i < si->nscreens; i++) + XUnmapWindow (si->dpy, si->screens[i].screensaver_window); + si->screen_blanked_p = False; } diff --git a/driver/xscreensaver.c b/driver/xscreensaver.c index 24e40f28..d820d0ab 100644 --- a/driver/xscreensaver.c +++ b/driver/xscreensaver.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1991-1997 Jamie Zawinski +/* xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -193,7 +193,7 @@ static void do_help (saver_info *si) { printf ("\ -xscreensaver %s, copyright (c) 1991-1997 by Jamie Zawinski \n\ +xscreensaver %s, copyright (c) 1991-1998 by Jamie Zawinski \n\ The standard Xt command-line options are accepted; other options include:\n\ \n\ -timeout When the screensaver should activate.\n\ @@ -663,7 +663,7 @@ initialize (saver_info *si, int argc, char **argv) if (p->verbose_p) printf ("\ -%s %s, copyright (c) 1991-1997 by Jamie Zawinski \n\ +%s %s, copyright (c) 1991-1998 by Jamie Zawinski \n\ pid = %d.\n", progname, si->version, (int) getpid ()); @@ -820,7 +820,7 @@ main_loop (saver_info *si) if (si->demo_mode_p) demo_mode (si); else -#endif +#endif /* !NO_DEMO_MODE */ { if (p->verbose_p) printf ("%s: user is idle; waking up at %s.\n", progname, @@ -839,7 +839,7 @@ main_loop (saver_info *si) si->lock_id = XtAppAddTimeOut (si->app, p->lock_timeout, activate_lock_timer, (XtPointer) si); -#endif +#endif /* !NO_LOCKING */ PASSWD_INVALID: @@ -889,21 +889,27 @@ main_loop (saver_info *si) goto PASSWD_INVALID; si->locked_p = False; } -#endif - unblank_screen (si); +#endif /* !NO_LOCKING */ + + /* Let's kill it before unblanking, to get it to stop drawing as + soon as possible... */ kill_screenhack (si); + unblank_screen (si); + if (si->cycle_id) { XtRemoveTimeOut (si->cycle_id); si->cycle_id = 0; } + #ifndef NO_LOCKING if (si->lock_id) { XtRemoveTimeOut (si->lock_id); si->lock_id = 0; } -#endif +#endif /* !NO_LOCKING */ + if (p->verbose_p) printf ("%s: user is active; going to sleep at %s.\n", progname, timestring ()); diff --git a/driver/xscreensaver.man b/driver/xscreensaver.man index dab3595c..bff441a5 100644 --- a/driver/xscreensaver.man +++ b/driver/xscreensaver.man @@ -11,7 +11,7 @@ .if n .sp 1 .if t .sp .5 .. -.TH XScreenSaver 1 "31-May-97" "X Version 11" +.TH XScreenSaver 1 "16-Jan-98" "X Version 11" .SH NAME xscreensaver - graphics hack and screen locker, launched when the user is idle .SH SYNOPSIS @@ -517,11 +517,11 @@ Edit the file \fI~/.dt/sessions/sessionetc\fP and add to it the line This will cause \fIxscreensaver\fP to be launched when you log in. (As always, make sure that xscreensaver and the graphics demos are on -your \fB$PATH\fP; this needs to be set in \fI.cshrc\fP and/or \fI.dtprofile\fP, -not \fI.login\fP.) +your \fB$PATH\fP; the path needs to be set in \fI.cshrc\fP +and/or \fI.dtprofile\fP, not \fI.login\fP.) .TP 3 \fB3: Create XScreenSaver.dt\fP -Create a file called \fI~/.dt/sessions/XScreenSaver.dt\fP with the following +Create a file called \fI~/.dt/types/XScreenSaver.dt\fP with the following contents: ACTION XScreenSaver @@ -537,7 +537,7 @@ This defines a ``lock'' command for the CDE front panel, that knows how to talk to \fIxscreensaver\fP. .TP 3 \fB4: Create Lock.fp\fP -Create a file called \fI~/.dt/sessions/Lock.fp\fP with the following +Create a file called \fI~/.dt/types/Lock.fp\fP with the following contents: CONTROL Lock @@ -558,7 +558,7 @@ we just defined in step 3. .TP 3 \fB5: Restart\fP Select ``\fIRestart Workspace Manager\fP'' from the popup menu to make -your changes take effect. If things seem not to be working, the +your changes take effect. If things seem not to be working, check the file \fI~/.dt/errorlog\fP for error messages. .RE .PP @@ -645,7 +645,7 @@ continue using your old password to unlock the screen until xscreensaver is restarted. This turns out to be kind of hard to fix. (But remember, kids! Unix security doesn't do much more than keep honest people honest...) .TP 8 -TWM and Colormaps +Colormap lossage: TWM The \fBinstallColormap\fP option doesn't work very well with the .BR twm (1) window manager and its descendants. @@ -670,6 +670,20 @@ it regularly if the screensaver is activated from a menu item, but seems to not do it if the screensaver comes on of its own volition, or is activated from another console. Any thoughts on this problem are welcome... .TP 8 +Colormap lossage: XV, XAnim, XEarth +Some programs don't operate properly on visuals other than the default one, +or with colormaps other than the default one. See the discussion of the +magic "default-n" visual name in the section about the \fBprograms\fP +resource. When programs only work with the default colormap, you need to +use a syntax like this: + + default-n: xv -root image-1.gif -quit \\n\\ + default-n: xearth -nostars -wait 0 \\n\\ + +It would also work to turn off the \fBinstallColormap\fP option altogether, +but that would deny extra colors to those programs that \fIcan\fP take +advantage of them. +.TP 8 XView Clients Apparently there are some problems with XView programs getting confused and thinking that the screensaver window is the real root window even when @@ -698,6 +712,11 @@ If you compiled against the Athena widget toolkit, the dialog boxes are pretty ugly, especially the password dialog. Use Motif! If you don't have OSF Motif, use GNU LessTif, it's free: http://www.lesstif.org/ .TP 8 +SGI Power Saver +If you're running Irix 6.3, you might find that your monitor is powering down +after an hour or two even if you've told it not to. This is fixed by SGI +patches 2447 and 2537. +.TP 8 Red Hot Lava There need to be a lot more graphics hacks. In particular, there should be a simulation of a Lavalite (tm). @@ -727,11 +746,12 @@ http://people.netscape.com/jwz/xscreensaver/ .BR bouboule (1), .BR braid (1), .BR bubbles (1), +.BR cage (1), .BR coral (1), +.BR cynosure (1), .BR decayscreen (1), .BR deco (1), .BR drift (1), -.BR escher (1), .BR fadeplot (1), .BR flag (1), .BR flame (1), @@ -755,7 +775,9 @@ http://people.netscape.com/jwz/xscreensaver/ .BR lissie (1), .BR lmorph (1), .BR maze (1), +.BR moebius (1), .BR moire (1), +.BR moire2 (1), .BR morph3d (1), .BR mountain (1), .BR munch (1), @@ -777,6 +799,7 @@ http://people.netscape.com/jwz/xscreensaver/ .BR sphere (1), .BR spiral (1), .BR sproingies (1), +.BR stairs (1), .BR starfish (1), .BR strange (1), .BR superquadrics (1), @@ -801,19 +824,20 @@ http://people.netscape.com/jwz/xscreensaver/ .BR xv (1), .BR xwave (1). .SH COPYRIGHT -Copyright \(co 1991, 1992, 1993, 1994, 1995, 1996, 1997 by Jamie Zawinski. -Permission to use, copy, modify, distribute, and sell this software and its -documentation for any purpose is hereby granted without fee, provided that -the above copyright notice appear in all copies and that both that copyright -notice and this permission notice appear in supporting documentation. No -representations are made about the suitability of this software for any -purpose. It is provided "as is" without express or implied warranty. +Copyright \(co 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998 +by Jamie Zawinski. Permission to use, copy, modify, distribute, and sell +this software and its documentation for any purpose is hereby granted without +fee, provided that the above copyright notice appear in all copies and that +both that copyright notice and this permission notice appear in supporting +documentation. No representations are made about the suitability of this +software for any purpose. It is provided "as is" without express or implied +warranty. .SH AUTHOR Jamie Zawinski . Written in late 1991; first posted to comp.sources.x on 13-Aug-1992. Please let me know if you find any bugs or make any improvements. - +.SH ACKNOWLEDGEMENTS Thanks to David Wojtowicz for implementing \fIlockTimeout\fP. Thanks to Martin Kraemer for adding support for shadow passwords and diff --git a/driver/xset.c b/driver/xset.c index c4fb6d6b..0c6f6f89 100644 --- a/driver/xset.c +++ b/driver/xset.c @@ -1,5 +1,5 @@ /* xset.c --- interacting with server extensions and the builtin screensaver. - * xscreensaver, Copyright (c) 1991-1997 Jamie Zawinski + * xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -157,32 +157,16 @@ disable_builtin_screensaver (saver_info *si, Bool turn_off_p) /* On SGIs, if interval is non-zero, it is the number of seconds after screen saving starts at which the monitor should be powered down. - Obviously I don't want that, so make sure it's a large positive number. + Obviously I don't want that, so set it to 0 (meaning "never".) Power saving is disabled if DontPreferBlanking, but in that case, we don't get extension events either. So we can't turn it off that way. - The man page for `XSetScreenSaver' says that setting interval to 0 will - disable powering down of the monitor, but this turns out not to be the - case on Irix 6.3 (O2); the monitor powers down anyway. It didn't do - this on 6.2, so someone screwed up. - - Extra Sucky Factoid #2: the number can't be more than 15 bits, which - is only a bit over nine hours. So there's just *no fucking way* to make - an SGI O2 leave its monitor powered on and idle for more than nine hours. - You fucking losers! - - [...Later...] Ok, it's worse than that. The above doesn't work either. - Setting it to a small number will cause it to power down early; but even - if you set it to a large number, it still seems to power down in about - an hour. You fucking fucking fucking losers! + Note: if you're running Irix 6.3 (O2), you may find that your monitor is + powering down anyway, regardless of the xset settings. This is fixed by + installing SGI patches 2447 and 2537. */ -#ifdef HAVE_SGI_SAVER_EXTENSION - if (p->use_sgi_saver_extension) - desired_server_interval = 32767; - else -#endif - desired_server_interval = 0; + desired_server_interval = 0; /* I suspect (but am not sure) that DontAllowExposures might have something to do with powering off the monitor as well. */ diff --git a/hacks/Makefile.in b/hacks/Makefile.in index 6bb37acd..68714534 100644 --- a/hacks/Makefile.in +++ b/hacks/Makefile.in @@ -48,7 +48,7 @@ SGI_VIDEO_LIBS = @SGI_VIDEO_LIBS@ UTILS_SRC = $(srcdir)/../utils UTILS_BIN = ../utils -INCLUDES = -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) @INCLUDES@ +INCLUDES = -I$(srcdir) -I$(srcdir)/.. -I$(UTILS_SRC) -I.. @INCLUDES@ UTIL_SRCS = $(UTILS_SRC)/alpha.c $(UTILS_SRC)/colors.c \ $(UTILS_SRC)/grabscreen.c $(UTILS_SRC)/hsv.c \ @@ -56,15 +56,15 @@ UTIL_SRCS = $(UTILS_SRC)/alpha.c $(UTILS_SRC)/colors.c \ $(UTILS_SRC)/usleep.c $(UTILS_SRC)/visual.c \ $(UTILS_SRC)/xroger.c $(UTILS_SRC)/yarandom.c \ $(UTILS_SRC)/erase.c $(UTILS_SRC)/sgivideo.c -UTIL_OBJS = $(UTILS_SRC)/alpha.o $(UTILS_SRC)/colors.o \ - $(UTILS_SRC)/grabscreen.o $(UTILS_SRC)/hsv.o \ - $(UTILS_SRC)/resources.o $(UTILS_SRC)/spline.o \ - $(UTILS_SRC)/usleep.o $(UTILS_SRC)/visual.o \ - $(UTILS_SRC)/xroger.o $(UTILS_SRC)/yarandom.o \ - $(UTILS_SRC)/erase.o $(UTILS_SRC)/sgivideo.o +UTIL_OBJS = $(UTILS_BIN)/alpha.o $(UTILS_BIN)/colors.o \ + $(UTILS_BIN)/grabscreen.o $(UTILS_BIN)/hsv.o \ + $(UTILS_BIN)/resources.o $(UTILS_BIN)/spline.o \ + $(UTILS_BIN)/usleep.o $(UTILS_BIN)/visual.o \ + $(UTILS_BIN)/xroger.o $(UTILS_BIN)/yarandom.o \ + $(UTILS_BIN)/erase.o $(UTILS_BIN)/sgivideo.o SRCS = attraction.c blitspin.c bouboule.c braid.c bubbles.c \ - bubbles_default.c decayscreen.c deco.c drift.c flag.c \ + bubbles-default.c decayscreen.c deco.c drift.c flag.c \ flame.c forest.c vines.c galaxy.c grav.c greynetic.c \ halo.c helix.c hopalong.c hypercube.c ifs.c imsmap.c \ julia.c kaleidescope.c laser.c lightning.c lisa.c lmorph.c \ @@ -73,10 +73,11 @@ SRCS = attraction.c blitspin.c bouboule.c braid.c bubbles.c \ slip.c sphere.c spiral.c strange.c swirl.c xlockmore.c \ xroger-hack.c goop.c starfish.c munch.c fadeplot.c \ rd-bomb.c coral.c mountain.c triangle.c lissie.c worm.c \ - rotor.c ant.c xjack.c xlyap.c puzzle.c xscreensaver-sgigl.c + rotor.c ant.c xjack.c xlyap.c puzzle.c xscreensaver-sgigl.c \ + cynosure.c moire2.c OBJS = attraction.o blitspin.o bouboule.o braid.o bubbles.o \ - bubbles_default.o decayscreen.o deco.o drift.o flag.o \ + bubbles-default.o decayscreen.o deco.o drift.o flag.o \ flame.o forest.o vines.o galaxy.o grav.o greynetic.o \ halo.o helix.o hopalong.o hypercube.o ifs.o imsmap.o \ julia.o kaleidescope.o laser.o lightning.o lisa.o lmorph.o \ @@ -85,7 +86,8 @@ OBJS = attraction.o blitspin.o bouboule.o braid.o bubbles.o \ slip.o sphere.o spiral.o strange.o swirl.o xlockmore.o \ xroger-hack.o goop.o starfish.o munch.o fadeplot.o \ rd-bomb.o coral.o mountain.o triangle.o lissie.o worm.o \ - rotor.o ant.o xjack.o xlyap.o puzzle.o xscreensaver-sgigl.o + rotor.o ant.o xjack.o xlyap.o puzzle.o xscreensaver-sgigl.o \ + cynosure.o moire2.o EXES = attraction blitspin bouboule braid bubbles decayscreen deco \ drift flag flame forest vines galaxy grav greynetic halo \ @@ -94,7 +96,7 @@ EXES = attraction blitspin bouboule braid bubbles decayscreen deco \ penrose pyro qix rocks rorschach sierpinski slidescreen \ slip sphere spiral strange swirl xroger goop starfish munch \ fadeplot rd-bomb coral mountain triangle lissie worm rotor \ - ant xjack xlyap puzzle + ant xjack xlyap puzzle cynosure moire2 HACK_OBJS_1 = $(UTILS_BIN)/resources.o $(UTILS_BIN)/visual.o \ $(UTILS_BIN)/usleep.o $(UTILS_BIN)/yarandom.o @XMU_OBJS@ @@ -118,13 +120,14 @@ MEN = attraction.man blitspin.man bouboule.man braid.man \ xroger.man goop.man starfish.man munch.man rd-bomb.man \ xjack.man xlyap.man puzzle.man STAR = * -EXTRAS = README Makefile.in xlock.h default.xbm bob.xbm .gdbinit \ - noses/nose-$(STAR).xbm noses/nose-$(STAR).xpm \ - pieces/$(STAR).xbm \ - bubbles-tools/bubbles$(STAR) \ - bubbles-tools/xpm$(STAR) \ - bubbles-sources/$(STAR).pov \ - bubbles-samples/$(STAR).bub.gz +EXTRAS = README Makefile.in xlock.h .gdbinit \ + vidwhacker \ + images/$(STAR).xbm \ + images/bubbles/$(STAR).pov \ + images/bubbles/$(STAR).xpm \ + images/noseguy/$(STAR).xbm \ + images/noseguy/$(STAR).xpm \ + images/puzzle/$(STAR).xbm \ VMSFILES = compile_axp.com compile_decc.com link_axp.com link_decc.com \ vms_axp.opt vms_axp_12.opt vms_decc.opt vms_decc_12.opt @@ -141,13 +144,16 @@ install-strip: $(MAKE) INSTALL_PROGRAM='$(INSTALL_PROGRAM) -s' install install-program: - @for program in $(EXES); do \ + @if [ ! -d $(HACKDIR) ]; then mkdir $(HACKDIR) ; fi ; \ + for program in $(EXES); do \ echo $(INSTALL_PROGRAM) $$program $(HACKDIR)/$$program ; \ $(INSTALL_PROGRAM) $$program $(HACKDIR)/$$program ; \ done install-man: - @men="$(MEN)" ; \ + @if [ ! -d $(mandir) ]; then mkdir $(mandir) ; fi ; \ + if [ ! -d $(man1dir) ]; then mkdir $(man1dir) ; fi ; \ + men="$(MEN)" ; \ for man in $$men; do \ instname=`echo $$man | sed 's/\.man$$/\.$(mansuffix)/'` ; \ echo $(INSTALL_DATA) $(srcdir)/$$man $(man1dir)/$$instname ; \ @@ -195,7 +201,8 @@ distdepend:: awk '/^# .*Makefile.in ---/,/^# DO .*distdepend/' < Makefile.in ; \ sed -e 's@ \./@ @g;s@ /[^ ]*@@g;/^.*:$$/d' \ -e 's@\.\./utils@$$(UTILS_SRC)@g' \ - -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' ; \ + -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \ + -e 's@ $$(srcdir)/\(.*config.h\)@ \1@g' ; \ echo '' \ ) > /tmp/distdepend.$$$$ && \ mv Makefile.in Makefile.in.bak && \ @@ -298,7 +305,7 @@ screenhack-xlock.o: screenhack.c ALP = $(HSV) $(UTILS_BIN)/alpha.o HSV = $(UTILS_BIN)/hsv.o SPL = $(UTILS_BIN)/spline.o -XROG = $(UTILS_BIN)/xroger.o +XROG = $(UTILS_BIN)/xroger.o $(SPL) GRAB = $(GRAB_OBJS) ERASE = $(UTILS_BIN)/erase.o COL = $(COLOR_OBJS) @@ -322,8 +329,8 @@ attraction: $(HACK_OBJS) attraction.o $(COL) $(SPL) blitspin: $(HACK_OBJS) blitspin.o $(GRAB) $(CC_HACK) -o $@ $(HACK_OBJS) blitspin.o $(GRAB) $(XPM_LIBS) $(GRAB_LIBS) -bubbles: $(HACK_OBJS) bubbles.o bubbles_default.o - $(CC_HACK) -o $@ $(HACK_OBJS) bubbles.o bubbles_default.o $(XPM_LIBS) +bubbles: $(HACK_OBJS) bubbles.o bubbles-default.o + $(CC_HACK) -o $@ $(HACK_OBJS) bubbles.o bubbles-default.o $(XPM_LIBS) decayscreen: $(HACK_OBJS) decayscreen.o $(GRAB) $(CC_HACK) -o $@ $(HACK_OBJS) decayscreen.o $(GRAB) $(HACK_LIBS) $(GRAB_LIBS) @@ -355,12 +362,15 @@ kaleidescope: $(HACK_OBJS) kaleidescope.o lmorph: $(HACK_OBJS) lmorph.o $(CC_HACK) -o $@ $(HACK_OBJS) lmorph.o $(HACK_LIBS) -maze: $(HACK_OBJS) maze.o $(ERASE) $(UTILS_BIN)/xroger.o - $(CC_HACK) -o $@ $(HACK_OBJS) maze.o $(ERASE) $(UTILS_BIN)/xroger.o $(HACK_LIBS) +maze: $(HACK_OBJS) maze.o $(ERASE) $(XROG) + $(CC_HACK) -o $@ $(HACK_OBJS) maze.o $(ERASE) $(XROG) $(HACK_LIBS) moire: $(HACK_OBJS) moire.o $(COL) $(CC_HACK) -o $@ $(HACK_OBJS) moire.o $(COL) $(HACK_LIBS) +moire2: $(HACK_OBJS) moire2.o $(COL) + $(CC_HACK) -o $@ $(HACK_OBJS) moire2.o $(COL) $(HACK_LIBS) + noseguy: $(HACK_OBJS) noseguy.o $(CC_HACK) -o $@ $(HACK_OBJS) noseguy.o $(XPM_LIBS) @@ -409,6 +419,9 @@ xlyap: $(HACK_OBJS) xlyap.o $(COL) puzzle: $(HACK_OBJS) puzzle.o $(GRAB) $(CC_HACK) -o $@ $(HACK_OBJS) puzzle.o $(GRAB) $(HACK_LIBS) $(GRAB_LIBS) +cynosure: $(HACK_OBJS) cynosure.o $(COL) + $(CC_HACK) -o $@ $(HACK_OBJS) cynosure.o $(COL) $(HACK_LIBS) + # The rules for those hacks which follow the `xlockmore' API. # @@ -423,7 +436,7 @@ drift: drift.o $(XLOCK_OBJS) $(ERASE) $(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(ERASE) $(HACK_LIBS) flag: flag.o $(XLOCK_OBJS) - $(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(HACK_LIBS) + $(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(XPM_LIBS) forest: forest.o $(XLOCK_OBJS) $(ERASE) $(CC_HACK) -o $@ $@.o $(XLOCK_OBJS) $(ERASE) $(HACK_LIBS) @@ -503,7 +516,7 @@ ant: ant.o $(XLOCK_OBJS) $(ERASE) # DO NOT DELETE: updated by make distdepend attraction.o: $(srcdir)/screenhack.h -attraction.o: $(srcdir)/../config.h +attraction.o: ../config.h attraction.o: $(UTILS_SRC)/yarandom.h attraction.o: $(UTILS_SRC)/usleep.h attraction.o: $(UTILS_SRC)/resources.h @@ -513,7 +526,7 @@ attraction.o: $(UTILS_SRC)/grabscreen.h attraction.o: $(UTILS_SRC)/visual.h attraction.o: $(UTILS_SRC)/spline.h blitspin.o: $(srcdir)/screenhack.h -blitspin.o: $(srcdir)/../config.h +blitspin.o: ../config.h blitspin.o: $(UTILS_SRC)/yarandom.h blitspin.o: $(UTILS_SRC)/usleep.h blitspin.o: $(UTILS_SRC)/resources.h @@ -521,9 +534,9 @@ blitspin.o: $(UTILS_SRC)/hsv.h blitspin.o: $(UTILS_SRC)/colors.h blitspin.o: $(UTILS_SRC)/grabscreen.h blitspin.o: $(UTILS_SRC)/visual.h -blitspin.o: $(srcdir)/default.xbm +blitspin.o: $(srcdir)/images/som.xbm bouboule.o: $(srcdir)/xlockmore.h -bouboule.o: $(srcdir)/../config.h +bouboule.o: ../config.h bouboule.o: $(srcdir)/xlockmoreI.h bouboule.o: $(srcdir)/screenhack.h bouboule.o: $(UTILS_SRC)/yarandom.h @@ -534,7 +547,7 @@ bouboule.o: $(UTILS_SRC)/colors.h bouboule.o: $(UTILS_SRC)/grabscreen.h bouboule.o: $(UTILS_SRC)/visual.h braid.o: $(srcdir)/xlockmore.h -braid.o: $(srcdir)/../config.h +braid.o: ../config.h braid.o: $(srcdir)/xlockmoreI.h braid.o: $(srcdir)/screenhack.h braid.o: $(UTILS_SRC)/yarandom.h @@ -546,7 +559,7 @@ braid.o: $(UTILS_SRC)/grabscreen.h braid.o: $(UTILS_SRC)/visual.h braid.o: $(UTILS_SRC)/erase.h bubbles.o: $(srcdir)/screenhack.h -bubbles.o: $(srcdir)/../config.h +bubbles.o: ../config.h bubbles.o: $(UTILS_SRC)/yarandom.h bubbles.o: $(UTILS_SRC)/usleep.h bubbles.o: $(UTILS_SRC)/resources.h @@ -555,10 +568,55 @@ bubbles.o: $(UTILS_SRC)/colors.h bubbles.o: $(UTILS_SRC)/grabscreen.h bubbles.o: $(UTILS_SRC)/visual.h bubbles.o: $(srcdir)/bubbles.h -bubbles_default.o: $(srcdir)/../config.h -bubbles_default.o: $(srcdir)/bubbles.h +bubbles-default.o: ../config.h +bubbles-default.o: $(srcdir)/bubbles.h +bubbles-default.o: $(UTILS_SRC)/yarandom.h +bubbles-default.o: $(srcdir)/images/bubbles/blood1.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood2.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood3.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood4.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood5.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood6.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood7.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood8.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood9.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood10.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blood11.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue1.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue2.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue3.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue4.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue5.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue6.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue7.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue8.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue9.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue10.xpm +bubbles-default.o: $(srcdir)/images/bubbles/blue11.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass1.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass2.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass3.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass4.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass5.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass6.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass7.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass8.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass9.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass10.xpm +bubbles-default.o: $(srcdir)/images/bubbles/glass11.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade1.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade2.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade3.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade4.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade5.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade6.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade7.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade8.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade9.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade10.xpm +bubbles-default.o: $(srcdir)/images/bubbles/jade11.xpm decayscreen.o: $(srcdir)/screenhack.h -decayscreen.o: $(srcdir)/../config.h +decayscreen.o: ../config.h decayscreen.o: $(UTILS_SRC)/yarandom.h decayscreen.o: $(UTILS_SRC)/usleep.h decayscreen.o: $(UTILS_SRC)/resources.h @@ -567,7 +625,7 @@ decayscreen.o: $(UTILS_SRC)/colors.h decayscreen.o: $(UTILS_SRC)/grabscreen.h decayscreen.o: $(UTILS_SRC)/visual.h deco.o: $(srcdir)/screenhack.h -deco.o: $(srcdir)/../config.h +deco.o: ../config.h deco.o: $(UTILS_SRC)/yarandom.h deco.o: $(UTILS_SRC)/usleep.h deco.o: $(UTILS_SRC)/resources.h @@ -576,7 +634,7 @@ deco.o: $(UTILS_SRC)/colors.h deco.o: $(UTILS_SRC)/grabscreen.h deco.o: $(UTILS_SRC)/visual.h drift.o: $(srcdir)/xlockmore.h -drift.o: $(srcdir)/../config.h +drift.o: ../config.h drift.o: $(srcdir)/xlockmoreI.h drift.o: $(srcdir)/screenhack.h drift.o: $(UTILS_SRC)/yarandom.h @@ -588,7 +646,7 @@ drift.o: $(UTILS_SRC)/grabscreen.h drift.o: $(UTILS_SRC)/visual.h drift.o: $(UTILS_SRC)/erase.h flag.o: $(srcdir)/xlockmore.h -flag.o: $(srcdir)/../config.h +flag.o: ../config.h flag.o: $(srcdir)/xlockmoreI.h flag.o: $(srcdir)/screenhack.h flag.o: $(UTILS_SRC)/yarandom.h @@ -598,9 +656,9 @@ flag.o: $(UTILS_SRC)/hsv.h flag.o: $(UTILS_SRC)/colors.h flag.o: $(UTILS_SRC)/grabscreen.h flag.o: $(UTILS_SRC)/visual.h -flag.o: $(srcdir)/bob.xbm +flag.o: $(srcdir)/images/bob.xbm flame.o: $(srcdir)/screenhack.h -flame.o: $(srcdir)/../config.h +flame.o: ../config.h flame.o: $(UTILS_SRC)/yarandom.h flame.o: $(UTILS_SRC)/usleep.h flame.o: $(UTILS_SRC)/resources.h @@ -609,7 +667,7 @@ flame.o: $(UTILS_SRC)/colors.h flame.o: $(UTILS_SRC)/grabscreen.h flame.o: $(UTILS_SRC)/visual.h forest.o: $(srcdir)/xlockmore.h -forest.o: $(srcdir)/../config.h +forest.o: ../config.h forest.o: $(srcdir)/xlockmoreI.h forest.o: $(srcdir)/screenhack.h forest.o: $(UTILS_SRC)/yarandom.h @@ -621,7 +679,7 @@ forest.o: $(UTILS_SRC)/grabscreen.h forest.o: $(UTILS_SRC)/visual.h forest.o: $(UTILS_SRC)/erase.h vines.o: $(srcdir)/xlockmore.h -vines.o: $(srcdir)/../config.h +vines.o: ../config.h vines.o: $(srcdir)/xlockmoreI.h vines.o: $(srcdir)/screenhack.h vines.o: $(UTILS_SRC)/yarandom.h @@ -633,7 +691,7 @@ vines.o: $(UTILS_SRC)/grabscreen.h vines.o: $(UTILS_SRC)/visual.h vines.o: $(UTILS_SRC)/erase.h galaxy.o: $(srcdir)/xlockmore.h -galaxy.o: $(srcdir)/../config.h +galaxy.o: ../config.h galaxy.o: $(srcdir)/xlockmoreI.h galaxy.o: $(srcdir)/screenhack.h galaxy.o: $(UTILS_SRC)/yarandom.h @@ -644,7 +702,7 @@ galaxy.o: $(UTILS_SRC)/colors.h galaxy.o: $(UTILS_SRC)/grabscreen.h galaxy.o: $(UTILS_SRC)/visual.h grav.o: $(srcdir)/xlockmore.h -grav.o: $(srcdir)/../config.h +grav.o: ../config.h grav.o: $(srcdir)/xlockmoreI.h grav.o: $(srcdir)/screenhack.h grav.o: $(UTILS_SRC)/yarandom.h @@ -655,7 +713,7 @@ grav.o: $(UTILS_SRC)/colors.h grav.o: $(UTILS_SRC)/grabscreen.h grav.o: $(UTILS_SRC)/visual.h greynetic.o: $(srcdir)/screenhack.h -greynetic.o: $(srcdir)/../config.h +greynetic.o: ../config.h greynetic.o: $(UTILS_SRC)/yarandom.h greynetic.o: $(UTILS_SRC)/usleep.h greynetic.o: $(UTILS_SRC)/resources.h @@ -664,7 +722,7 @@ greynetic.o: $(UTILS_SRC)/colors.h greynetic.o: $(UTILS_SRC)/grabscreen.h greynetic.o: $(UTILS_SRC)/visual.h halo.o: $(srcdir)/screenhack.h -halo.o: $(srcdir)/../config.h +halo.o: ../config.h halo.o: $(UTILS_SRC)/yarandom.h halo.o: $(UTILS_SRC)/usleep.h halo.o: $(UTILS_SRC)/resources.h @@ -673,7 +731,7 @@ halo.o: $(UTILS_SRC)/colors.h halo.o: $(UTILS_SRC)/grabscreen.h halo.o: $(UTILS_SRC)/visual.h helix.o: $(srcdir)/screenhack.h -helix.o: $(srcdir)/../config.h +helix.o: ../config.h helix.o: $(UTILS_SRC)/yarandom.h helix.o: $(UTILS_SRC)/usleep.h helix.o: $(UTILS_SRC)/resources.h @@ -683,7 +741,7 @@ helix.o: $(UTILS_SRC)/grabscreen.h helix.o: $(UTILS_SRC)/visual.h helix.o: $(UTILS_SRC)/erase.h hopalong.o: $(srcdir)/xlockmore.h -hopalong.o: $(srcdir)/../config.h +hopalong.o: ../config.h hopalong.o: $(srcdir)/xlockmoreI.h hopalong.o: $(srcdir)/screenhack.h hopalong.o: $(UTILS_SRC)/yarandom.h @@ -695,7 +753,7 @@ hopalong.o: $(UTILS_SRC)/grabscreen.h hopalong.o: $(UTILS_SRC)/visual.h hopalong.o: $(UTILS_SRC)/erase.h hypercube.o: $(srcdir)/screenhack.h -hypercube.o: $(srcdir)/../config.h +hypercube.o: ../config.h hypercube.o: $(UTILS_SRC)/yarandom.h hypercube.o: $(UTILS_SRC)/usleep.h hypercube.o: $(UTILS_SRC)/resources.h @@ -704,7 +762,7 @@ hypercube.o: $(UTILS_SRC)/colors.h hypercube.o: $(UTILS_SRC)/grabscreen.h hypercube.o: $(UTILS_SRC)/visual.h ifs.o: $(srcdir)/xlockmore.h -ifs.o: $(srcdir)/../config.h +ifs.o: ../config.h ifs.o: $(srcdir)/xlockmoreI.h ifs.o: $(srcdir)/screenhack.h ifs.o: $(UTILS_SRC)/yarandom.h @@ -715,7 +773,7 @@ ifs.o: $(UTILS_SRC)/colors.h ifs.o: $(UTILS_SRC)/grabscreen.h ifs.o: $(UTILS_SRC)/visual.h imsmap.o: $(srcdir)/screenhack.h -imsmap.o: $(srcdir)/../config.h +imsmap.o: ../config.h imsmap.o: $(UTILS_SRC)/yarandom.h imsmap.o: $(UTILS_SRC)/usleep.h imsmap.o: $(UTILS_SRC)/resources.h @@ -724,7 +782,7 @@ imsmap.o: $(UTILS_SRC)/colors.h imsmap.o: $(UTILS_SRC)/grabscreen.h imsmap.o: $(UTILS_SRC)/visual.h julia.o: $(srcdir)/xlockmore.h -julia.o: $(srcdir)/../config.h +julia.o: ../config.h julia.o: $(srcdir)/xlockmoreI.h julia.o: $(srcdir)/screenhack.h julia.o: $(UTILS_SRC)/yarandom.h @@ -736,7 +794,7 @@ julia.o: $(UTILS_SRC)/grabscreen.h julia.o: $(UTILS_SRC)/visual.h kaleidescope.o: $(UTILS_SRC)/spline.h kaleidescope.o: $(srcdir)/screenhack.h -kaleidescope.o: $(srcdir)/../config.h +kaleidescope.o: ../config.h kaleidescope.o: $(UTILS_SRC)/yarandom.h kaleidescope.o: $(UTILS_SRC)/usleep.h kaleidescope.o: $(UTILS_SRC)/resources.h @@ -745,7 +803,7 @@ kaleidescope.o: $(UTILS_SRC)/colors.h kaleidescope.o: $(UTILS_SRC)/grabscreen.h kaleidescope.o: $(UTILS_SRC)/visual.h laser.o: $(srcdir)/xlockmore.h -laser.o: $(srcdir)/../config.h +laser.o: ../config.h laser.o: $(srcdir)/xlockmoreI.h laser.o: $(srcdir)/screenhack.h laser.o: $(UTILS_SRC)/yarandom.h @@ -756,7 +814,7 @@ laser.o: $(UTILS_SRC)/colors.h laser.o: $(UTILS_SRC)/grabscreen.h laser.o: $(UTILS_SRC)/visual.h lightning.o: $(srcdir)/xlockmore.h -lightning.o: $(srcdir)/../config.h +lightning.o: ../config.h lightning.o: $(srcdir)/xlockmoreI.h lightning.o: $(srcdir)/screenhack.h lightning.o: $(UTILS_SRC)/yarandom.h @@ -767,7 +825,7 @@ lightning.o: $(UTILS_SRC)/colors.h lightning.o: $(UTILS_SRC)/grabscreen.h lightning.o: $(UTILS_SRC)/visual.h lisa.o: $(srcdir)/xlockmore.h -lisa.o: $(srcdir)/../config.h +lisa.o: ../config.h lisa.o: $(srcdir)/xlockmoreI.h lisa.o: $(srcdir)/screenhack.h lisa.o: $(UTILS_SRC)/yarandom.h @@ -778,7 +836,7 @@ lisa.o: $(UTILS_SRC)/colors.h lisa.o: $(UTILS_SRC)/grabscreen.h lisa.o: $(UTILS_SRC)/visual.h lmorph.o: $(srcdir)/screenhack.h -lmorph.o: $(srcdir)/../config.h +lmorph.o: ../config.h lmorph.o: $(UTILS_SRC)/yarandom.h lmorph.o: $(UTILS_SRC)/usleep.h lmorph.o: $(UTILS_SRC)/resources.h @@ -787,7 +845,7 @@ lmorph.o: $(UTILS_SRC)/colors.h lmorph.o: $(UTILS_SRC)/grabscreen.h lmorph.o: $(UTILS_SRC)/visual.h maze.o: $(srcdir)/screenhack.h -maze.o: $(srcdir)/../config.h +maze.o: ../config.h maze.o: $(UTILS_SRC)/yarandom.h maze.o: $(UTILS_SRC)/usleep.h maze.o: $(UTILS_SRC)/resources.h @@ -797,7 +855,7 @@ maze.o: $(UTILS_SRC)/grabscreen.h maze.o: $(UTILS_SRC)/visual.h maze.o: $(UTILS_SRC)/erase.h moire.o: $(srcdir)/screenhack.h -moire.o: $(srcdir)/../config.h +moire.o: ../config.h moire.o: $(UTILS_SRC)/yarandom.h moire.o: $(UTILS_SRC)/usleep.h moire.o: $(UTILS_SRC)/resources.h @@ -806,7 +864,7 @@ moire.o: $(UTILS_SRC)/colors.h moire.o: $(UTILS_SRC)/grabscreen.h moire.o: $(UTILS_SRC)/visual.h noseguy.o: $(srcdir)/screenhack.h -noseguy.o: $(srcdir)/../config.h +noseguy.o: ../config.h noseguy.o: $(UTILS_SRC)/yarandom.h noseguy.o: $(UTILS_SRC)/usleep.h noseguy.o: $(UTILS_SRC)/resources.h @@ -814,16 +872,16 @@ noseguy.o: $(UTILS_SRC)/hsv.h noseguy.o: $(UTILS_SRC)/colors.h noseguy.o: $(UTILS_SRC)/grabscreen.h noseguy.o: $(UTILS_SRC)/visual.h -noseguy.o: $(srcdir)/noses/nose-f1.xpm -noseguy.o: $(srcdir)/noses/nose-f2.xpm -noseguy.o: $(srcdir)/noses/nose-f3.xpm -noseguy.o: $(srcdir)/noses/nose-f4.xpm -noseguy.o: $(srcdir)/noses/nose-l1.xpm -noseguy.o: $(srcdir)/noses/nose-l2.xpm -noseguy.o: $(srcdir)/noses/nose-r1.xpm -noseguy.o: $(srcdir)/noses/nose-r2.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-f1.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-f2.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-f3.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-f4.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-l1.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-l2.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-r1.xpm +noseguy.o: $(srcdir)/images/noseguy/nose-r2.xpm pedal.o: $(srcdir)/screenhack.h -pedal.o: $(srcdir)/../config.h +pedal.o: ../config.h pedal.o: $(UTILS_SRC)/yarandom.h pedal.o: $(UTILS_SRC)/usleep.h pedal.o: $(UTILS_SRC)/resources.h @@ -832,7 +890,7 @@ pedal.o: $(UTILS_SRC)/colors.h pedal.o: $(UTILS_SRC)/grabscreen.h pedal.o: $(UTILS_SRC)/visual.h penrose.o: $(srcdir)/xlockmore.h -penrose.o: $(srcdir)/../config.h +penrose.o: ../config.h penrose.o: $(srcdir)/xlockmoreI.h penrose.o: $(srcdir)/screenhack.h penrose.o: $(UTILS_SRC)/yarandom.h @@ -843,7 +901,7 @@ penrose.o: $(UTILS_SRC)/colors.h penrose.o: $(UTILS_SRC)/grabscreen.h penrose.o: $(UTILS_SRC)/visual.h pyro.o: $(srcdir)/screenhack.h -pyro.o: $(srcdir)/../config.h +pyro.o: ../config.h pyro.o: $(UTILS_SRC)/yarandom.h pyro.o: $(UTILS_SRC)/usleep.h pyro.o: $(UTILS_SRC)/resources.h @@ -852,7 +910,7 @@ pyro.o: $(UTILS_SRC)/colors.h pyro.o: $(UTILS_SRC)/grabscreen.h pyro.o: $(UTILS_SRC)/visual.h qix.o: $(srcdir)/screenhack.h -qix.o: $(srcdir)/../config.h +qix.o: ../config.h qix.o: $(UTILS_SRC)/yarandom.h qix.o: $(UTILS_SRC)/usleep.h qix.o: $(UTILS_SRC)/resources.h @@ -862,7 +920,7 @@ qix.o: $(UTILS_SRC)/grabscreen.h qix.o: $(UTILS_SRC)/visual.h qix.o: $(UTILS_SRC)/alpha.h rocks.o: $(srcdir)/screenhack.h -rocks.o: $(srcdir)/../config.h +rocks.o: ../config.h rocks.o: $(UTILS_SRC)/yarandom.h rocks.o: $(UTILS_SRC)/usleep.h rocks.o: $(UTILS_SRC)/resources.h @@ -871,7 +929,7 @@ rocks.o: $(UTILS_SRC)/colors.h rocks.o: $(UTILS_SRC)/grabscreen.h rocks.o: $(UTILS_SRC)/visual.h rorschach.o: $(srcdir)/screenhack.h -rorschach.o: $(srcdir)/../config.h +rorschach.o: ../config.h rorschach.o: $(UTILS_SRC)/yarandom.h rorschach.o: $(UTILS_SRC)/usleep.h rorschach.o: $(UTILS_SRC)/resources.h @@ -882,7 +940,7 @@ rorschach.o: $(UTILS_SRC)/visual.h rorschach.o: $(UTILS_SRC)/erase.h screenhack.o: $(UTILS_SRC)/xmu.h screenhack.o: $(srcdir)/screenhack.h -screenhack.o: $(srcdir)/../config.h +screenhack.o: ../config.h screenhack.o: $(UTILS_SRC)/yarandom.h screenhack.o: $(UTILS_SRC)/usleep.h screenhack.o: $(UTILS_SRC)/resources.h @@ -893,7 +951,7 @@ screenhack.o: $(UTILS_SRC)/visual.h screenhack.o: $(UTILS_SRC)/version.h screenhack.o: $(UTILS_SRC)/vroot.h sierpinski.o: $(srcdir)/xlockmore.h -sierpinski.o: $(srcdir)/../config.h +sierpinski.o: ../config.h sierpinski.o: $(srcdir)/xlockmoreI.h sierpinski.o: $(srcdir)/screenhack.h sierpinski.o: $(UTILS_SRC)/yarandom.h @@ -904,7 +962,7 @@ sierpinski.o: $(UTILS_SRC)/colors.h sierpinski.o: $(UTILS_SRC)/grabscreen.h sierpinski.o: $(UTILS_SRC)/visual.h slidescreen.o: $(srcdir)/screenhack.h -slidescreen.o: $(srcdir)/../config.h +slidescreen.o: ../config.h slidescreen.o: $(UTILS_SRC)/yarandom.h slidescreen.o: $(UTILS_SRC)/usleep.h slidescreen.o: $(UTILS_SRC)/resources.h @@ -913,7 +971,7 @@ slidescreen.o: $(UTILS_SRC)/colors.h slidescreen.o: $(UTILS_SRC)/grabscreen.h slidescreen.o: $(UTILS_SRC)/visual.h slip.o: $(srcdir)/xlockmore.h -slip.o: $(srcdir)/../config.h +slip.o: ../config.h slip.o: $(srcdir)/xlockmoreI.h slip.o: $(srcdir)/screenhack.h slip.o: $(UTILS_SRC)/yarandom.h @@ -924,7 +982,7 @@ slip.o: $(UTILS_SRC)/colors.h slip.o: $(UTILS_SRC)/grabscreen.h slip.o: $(UTILS_SRC)/visual.h sphere.o: $(srcdir)/xlockmore.h -sphere.o: $(srcdir)/../config.h +sphere.o: ../config.h sphere.o: $(srcdir)/xlockmoreI.h sphere.o: $(srcdir)/screenhack.h sphere.o: $(UTILS_SRC)/yarandom.h @@ -935,7 +993,7 @@ sphere.o: $(UTILS_SRC)/colors.h sphere.o: $(UTILS_SRC)/grabscreen.h sphere.o: $(UTILS_SRC)/visual.h spiral.o: $(srcdir)/xlockmore.h -spiral.o: $(srcdir)/../config.h +spiral.o: ../config.h spiral.o: $(srcdir)/xlockmoreI.h spiral.o: $(srcdir)/screenhack.h spiral.o: $(UTILS_SRC)/yarandom.h @@ -946,7 +1004,7 @@ spiral.o: $(UTILS_SRC)/colors.h spiral.o: $(UTILS_SRC)/grabscreen.h spiral.o: $(UTILS_SRC)/visual.h strange.o: $(srcdir)/xlockmore.h -strange.o: $(srcdir)/../config.h +strange.o: ../config.h strange.o: $(srcdir)/xlockmoreI.h strange.o: $(srcdir)/screenhack.h strange.o: $(UTILS_SRC)/yarandom.h @@ -957,7 +1015,7 @@ strange.o: $(UTILS_SRC)/colors.h strange.o: $(UTILS_SRC)/grabscreen.h strange.o: $(UTILS_SRC)/visual.h swirl.o: $(srcdir)/xlockmore.h -swirl.o: $(srcdir)/../config.h +swirl.o: ../config.h swirl.o: $(srcdir)/xlockmoreI.h swirl.o: $(srcdir)/screenhack.h swirl.o: $(UTILS_SRC)/yarandom.h @@ -968,7 +1026,7 @@ swirl.o: $(UTILS_SRC)/colors.h swirl.o: $(UTILS_SRC)/grabscreen.h swirl.o: $(UTILS_SRC)/visual.h xlockmore.o: $(srcdir)/screenhack.h -xlockmore.o: $(srcdir)/../config.h +xlockmore.o: ../config.h xlockmore.o: $(UTILS_SRC)/yarandom.h xlockmore.o: $(UTILS_SRC)/usleep.h xlockmore.o: $(UTILS_SRC)/resources.h @@ -978,7 +1036,7 @@ xlockmore.o: $(UTILS_SRC)/grabscreen.h xlockmore.o: $(UTILS_SRC)/visual.h xlockmore.o: $(srcdir)/xlockmoreI.h xroger-hack.o: $(srcdir)/screenhack.h -xroger-hack.o: $(srcdir)/../config.h +xroger-hack.o: ../config.h xroger-hack.o: $(UTILS_SRC)/yarandom.h xroger-hack.o: $(UTILS_SRC)/usleep.h xroger-hack.o: $(UTILS_SRC)/resources.h @@ -987,7 +1045,7 @@ xroger-hack.o: $(UTILS_SRC)/colors.h xroger-hack.o: $(UTILS_SRC)/grabscreen.h xroger-hack.o: $(UTILS_SRC)/visual.h goop.o: $(srcdir)/screenhack.h -goop.o: $(srcdir)/../config.h +goop.o: ../config.h goop.o: $(UTILS_SRC)/yarandom.h goop.o: $(UTILS_SRC)/usleep.h goop.o: $(UTILS_SRC)/resources.h @@ -998,7 +1056,7 @@ goop.o: $(UTILS_SRC)/visual.h goop.o: $(UTILS_SRC)/spline.h goop.o: $(UTILS_SRC)/alpha.h starfish.o: $(srcdir)/screenhack.h -starfish.o: $(srcdir)/../config.h +starfish.o: ../config.h starfish.o: $(UTILS_SRC)/yarandom.h starfish.o: $(UTILS_SRC)/usleep.h starfish.o: $(UTILS_SRC)/resources.h @@ -1008,7 +1066,7 @@ starfish.o: $(UTILS_SRC)/grabscreen.h starfish.o: $(UTILS_SRC)/visual.h starfish.o: $(UTILS_SRC)/spline.h munch.o: $(srcdir)/screenhack.h -munch.o: $(srcdir)/../config.h +munch.o: ../config.h munch.o: $(UTILS_SRC)/yarandom.h munch.o: $(UTILS_SRC)/usleep.h munch.o: $(UTILS_SRC)/resources.h @@ -1017,7 +1075,7 @@ munch.o: $(UTILS_SRC)/colors.h munch.o: $(UTILS_SRC)/grabscreen.h munch.o: $(UTILS_SRC)/visual.h fadeplot.o: $(srcdir)/xlockmore.h -fadeplot.o: $(srcdir)/../config.h +fadeplot.o: ../config.h fadeplot.o: $(srcdir)/xlockmoreI.h fadeplot.o: $(srcdir)/screenhack.h fadeplot.o: $(UTILS_SRC)/yarandom.h @@ -1028,7 +1086,7 @@ fadeplot.o: $(UTILS_SRC)/colors.h fadeplot.o: $(UTILS_SRC)/grabscreen.h fadeplot.o: $(UTILS_SRC)/visual.h rd-bomb.o: $(srcdir)/screenhack.h -rd-bomb.o: $(srcdir)/../config.h +rd-bomb.o: ../config.h rd-bomb.o: $(UTILS_SRC)/yarandom.h rd-bomb.o: $(UTILS_SRC)/usleep.h rd-bomb.o: $(UTILS_SRC)/resources.h @@ -1037,7 +1095,7 @@ rd-bomb.o: $(UTILS_SRC)/colors.h rd-bomb.o: $(UTILS_SRC)/grabscreen.h rd-bomb.o: $(UTILS_SRC)/visual.h coral.o: $(srcdir)/screenhack.h -coral.o: $(srcdir)/../config.h +coral.o: ../config.h coral.o: $(UTILS_SRC)/yarandom.h coral.o: $(UTILS_SRC)/usleep.h coral.o: $(UTILS_SRC)/resources.h @@ -1047,7 +1105,7 @@ coral.o: $(UTILS_SRC)/grabscreen.h coral.o: $(UTILS_SRC)/visual.h coral.o: $(UTILS_SRC)/erase.h mountain.o: $(srcdir)/xlockmore.h -mountain.o: $(srcdir)/../config.h +mountain.o: ../config.h mountain.o: $(srcdir)/xlockmoreI.h mountain.o: $(srcdir)/screenhack.h mountain.o: $(UTILS_SRC)/yarandom.h @@ -1058,7 +1116,7 @@ mountain.o: $(UTILS_SRC)/colors.h mountain.o: $(UTILS_SRC)/grabscreen.h mountain.o: $(UTILS_SRC)/visual.h triangle.o: $(srcdir)/xlockmore.h -triangle.o: $(srcdir)/../config.h +triangle.o: ../config.h triangle.o: $(srcdir)/xlockmoreI.h triangle.o: $(srcdir)/screenhack.h triangle.o: $(UTILS_SRC)/yarandom.h @@ -1069,7 +1127,7 @@ triangle.o: $(UTILS_SRC)/colors.h triangle.o: $(UTILS_SRC)/grabscreen.h triangle.o: $(UTILS_SRC)/visual.h lissie.o: $(srcdir)/xlockmore.h -lissie.o: $(srcdir)/../config.h +lissie.o: ../config.h lissie.o: $(srcdir)/xlockmoreI.h lissie.o: $(srcdir)/screenhack.h lissie.o: $(UTILS_SRC)/yarandom.h @@ -1080,7 +1138,7 @@ lissie.o: $(UTILS_SRC)/colors.h lissie.o: $(UTILS_SRC)/grabscreen.h lissie.o: $(UTILS_SRC)/visual.h worm.o: $(srcdir)/xlockmore.h -worm.o: $(srcdir)/../config.h +worm.o: ../config.h worm.o: $(srcdir)/xlockmoreI.h worm.o: $(srcdir)/screenhack.h worm.o: $(UTILS_SRC)/yarandom.h @@ -1091,7 +1149,7 @@ worm.o: $(UTILS_SRC)/colors.h worm.o: $(UTILS_SRC)/grabscreen.h worm.o: $(UTILS_SRC)/visual.h rotor.o: $(srcdir)/xlockmore.h -rotor.o: $(srcdir)/../config.h +rotor.o: ../config.h rotor.o: $(srcdir)/xlockmoreI.h rotor.o: $(srcdir)/screenhack.h rotor.o: $(UTILS_SRC)/yarandom.h @@ -1102,7 +1160,7 @@ rotor.o: $(UTILS_SRC)/colors.h rotor.o: $(UTILS_SRC)/grabscreen.h rotor.o: $(UTILS_SRC)/visual.h ant.o: $(srcdir)/xlockmore.h -ant.o: $(srcdir)/../config.h +ant.o: ../config.h ant.o: $(srcdir)/xlockmoreI.h ant.o: $(srcdir)/screenhack.h ant.o: $(UTILS_SRC)/yarandom.h @@ -1114,7 +1172,7 @@ ant.o: $(UTILS_SRC)/grabscreen.h ant.o: $(UTILS_SRC)/visual.h ant.o: $(UTILS_SRC)/erase.h xjack.o: $(srcdir)/screenhack.h -xjack.o: $(srcdir)/../config.h +xjack.o: ../config.h xjack.o: $(UTILS_SRC)/yarandom.h xjack.o: $(UTILS_SRC)/usleep.h xjack.o: $(UTILS_SRC)/resources.h @@ -1123,7 +1181,7 @@ xjack.o: $(UTILS_SRC)/colors.h xjack.o: $(UTILS_SRC)/grabscreen.h xjack.o: $(UTILS_SRC)/visual.h xlyap.o: $(srcdir)/screenhack.h -xlyap.o: $(srcdir)/../config.h +xlyap.o: ../config.h xlyap.o: $(UTILS_SRC)/yarandom.h xlyap.o: $(UTILS_SRC)/usleep.h xlyap.o: $(UTILS_SRC)/resources.h @@ -1133,7 +1191,7 @@ xlyap.o: $(UTILS_SRC)/grabscreen.h xlyap.o: $(UTILS_SRC)/visual.h xlyap.o: $(UTILS_SRC)/vroot.h puzzle.o: $(srcdir)/screenhack.h -puzzle.o: $(srcdir)/../config.h +puzzle.o: ../config.h puzzle.o: $(UTILS_SRC)/yarandom.h puzzle.o: $(UTILS_SRC)/usleep.h puzzle.o: $(UTILS_SRC)/resources.h @@ -1141,41 +1199,59 @@ puzzle.o: $(UTILS_SRC)/hsv.h puzzle.o: $(UTILS_SRC)/colors.h puzzle.o: $(UTILS_SRC)/grabscreen.h puzzle.o: $(UTILS_SRC)/visual.h -puzzle.o: $(srcdir)/pieces/puzzle_a_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_n_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_ne_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_e_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_se_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_s_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_sw_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_w_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_nw_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_n_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_ne_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_e_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_se_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_s_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_sw_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_w_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_nw_h.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_n_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_ne_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_e_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_se_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_s_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_sw_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_w_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_a_nw_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_n_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_ne_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_e_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_se_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_s_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_sw_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_w_f.xbm -puzzle.o: $(srcdir)/pieces/puzzle_b_nw_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_n_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_ne_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_e_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_se_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_s_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_sw_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_w_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_nw_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_n_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_ne_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_e_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_se_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_s_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_sw_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_w_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_nw_h.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_n_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_ne_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_e_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_se_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_s_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_sw_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_w_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_a_nw_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_n_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_ne_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_e_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_se_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_s_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_sw_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_w_f.xbm +puzzle.o: $(srcdir)/images/puzzle/puzzle_b_nw_f.xbm xscreensaver-sgigl.o: $(UTILS_SRC)/vroot.h +cynosure.o: $(srcdir)/screenhack.h +cynosure.o: ../config.h +cynosure.o: $(UTILS_SRC)/yarandom.h +cynosure.o: $(UTILS_SRC)/usleep.h +cynosure.o: $(UTILS_SRC)/resources.h +cynosure.o: $(UTILS_SRC)/hsv.h +cynosure.o: $(UTILS_SRC)/colors.h +cynosure.o: $(UTILS_SRC)/grabscreen.h +cynosure.o: $(UTILS_SRC)/visual.h +moire2.o: $(srcdir)/screenhack.h +moire2.o: ../config.h +moire2.o: $(UTILS_SRC)/yarandom.h +moire2.o: $(UTILS_SRC)/usleep.h +moire2.o: $(UTILS_SRC)/resources.h +moire2.o: $(UTILS_SRC)/hsv.h +moire2.o: $(UTILS_SRC)/colors.h +moire2.o: $(UTILS_SRC)/grabscreen.h +moire2.o: $(UTILS_SRC)/visual.h diff --git a/hacks/ant.c b/hacks/ant.c index 5ceb5fa7..cf019b62 100644 --- a/hacks/ant.c +++ b/hacks/ant.c @@ -61,9 +61,7 @@ static const char sccsid[] = "@(#)ant.c 4.04 97/07/28 xlockmore"; "*count: -3 \n" \ "*cycles: 40000 \n" \ "*size: -7 \n" \ - "*ncolors: 64 \n" \ - "*eraseSpeed: 400 \n" \ - "*eraseMode: -1 \n" + "*ncolors: 64 \n" # include "xlockmore.h" /* in xscreensaver distribution */ # include "erase.h" #else /* STANDALONE */ diff --git a/hacks/blitspin.c b/hacks/blitspin.c index e8ee2653..5b66f7d6 100644 --- a/hacks/blitspin.c +++ b/hacks/blitspin.c @@ -42,7 +42,7 @@ # endif /* VMS */ #endif -#include "default.xbm" +#include "images/som.xbm" static Display *dpy; static Window window; @@ -249,9 +249,9 @@ init (void) if (!strcmp (bitmap_name, "(default)")) { - width = logo_width; - height = logo_height; - bitmap = XCreatePixmapFromBitmapData (dpy, window, (char *) logo_bits, + width = som_width; + height = som_height; + bitmap = XCreatePixmapFromBitmapData (dpy, window, (char *) som_bits, width, height, fg, bg, depth); scale_up = True; /* definitely. */ } diff --git a/hacks/bob.xbm b/hacks/bob.xbm deleted file mode 100644 index f44adda4..00000000 --- a/hacks/bob.xbm +++ /dev/null @@ -1,43 +0,0 @@ -#define bob_width 61 -#define bob_height 75 -static unsigned char bob_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x07,0x00, - 0x00,0x00,0x00,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xfb, - 0x00,0x00,0x00,0xc0,0xff,0xcf,0x9f,0xd1,0x03,0x00,0x00,0xf0,0x7f,0x8c,0x33, - 0x91,0x07,0x00,0x00,0xf8,0xa7,0x18,0x27,0xb1,0x06,0x00,0x00,0xfc,0x47,0x31, - 0x4e,0xa6,0x0e,0x00,0x00,0xfe,0x4f,0x21,0x4c,0xae,0x3d,0x00,0x00,0xff,0xdf, - 0x23,0x8d,0xbe,0x7d,0x00,0x80,0xff,0xff,0x67,0xbd,0xfe,0xff,0x01,0x80,0xff, - 0xff,0x7f,0xbf,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,0xbf,0xff,0xf8,0x07,0xc0, - 0xff,0xff,0xff,0xbf,0x3f,0xf8,0x07,0xc0,0xff,0xff,0xff,0xff,0x07,0xf8,0x0f, - 0xc0,0xff,0xff,0xff,0x3f,0x00,0xf8,0x0f,0xe0,0x7f,0x00,0xf8,0x07,0x00,0xf0, - 0x0f,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00, - 0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf4,0x07,0xe0,0x3f,0x00,0x00,0x00, - 0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00, - 0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe7,0x07,0xe0,0x3f,0x00, - 0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f, - 0x00,0x00,0x00,0x00,0xe6,0x07,0xc0,0x3f,0x00,0x00,0x00,0x78,0xf6,0x07,0xa0, - 0xbf,0xff,0x00,0x00,0xff,0xf7,0x07,0x70,0x9f,0xff,0x01,0x80,0xff,0xef,0x07, - 0xf0,0x1c,0x80,0x03,0xe0,0x01,0xef,0x07,0xf0,0x1f,0xbe,0x07,0xf0,0x3f,0xee, - 0x07,0xe0,0x9d,0x83,0x1f,0xf8,0xe1,0xdc,0x07,0xe0,0xc1,0x7f,0x1f,0xfc,0xff, - 0xc8,0x07,0xe0,0xc1,0x69,0x1e,0x7e,0xca,0xc0,0x03,0xe0,0x81,0xb8,0x1f,0xc0, - 0x0e,0xc0,0x03,0xe0,0x01,0xc0,0x1b,0xc0,0xcf,0xc1,0x03,0xc0,0x03,0xf7,0x11, - 0x00,0x7f,0xc0,0x03,0xc0,0x03,0x7c,0x18,0x00,0x1c,0xc0,0x02,0xc0,0x02,0x30, - 0x08,0x00,0x00,0x40,0x03,0x40,0x03,0x00,0x08,0x00,0x00,0x40,0x02,0x40,0x13, - 0x00,0x0c,0x00,0x00,0x60,0x02,0x40,0x12,0x00,0x0e,0x00,0x00,0xc0,0x03,0x80, - 0x33,0x80,0x0e,0x00,0x00,0xa8,0x01,0x00,0x33,0x40,0x0f,0xa0,0x03,0x2c,0x00, - 0x00,0x74,0x30,0x0f,0x38,0x07,0x2e,0x00,0x00,0x74,0x98,0x1f,0x1e,0x1e,0x2f, - 0x00,0x00,0xfc,0x8f,0xff,0x0f,0xfc,0x2f,0x00,0x00,0xf8,0xe3,0xff,0x03,0xf8, - 0x2f,0x00,0x00,0xf8,0xfd,0xff,0x81,0xff,0x3f,0x00,0x00,0xb8,0xf9,0x1f,0xf8, - 0x0f,0x1e,0x00,0x00,0x30,0xf1,0xf0,0x0f,0x03,0x0e,0x00,0x00,0x30,0xf1,0x01, - 0x80,0x01,0x0f,0x00,0x00,0x20,0xf1,0xf7,0xff,0x00,0x07,0x00,0x00,0x60,0xe3, - 0x01,0x60,0x80,0x07,0x00,0x00,0x60,0xc3,0xef,0x3f,0x80,0x03,0x00,0x00,0x40, - 0xc2,0xff,0x0f,0xc0,0x03,0x00,0x00,0xc0,0xe6,0x1f,0x00,0xc0,0x01,0x00,0x00, - 0x80,0xf4,0xfe,0x3f,0xe0,0x00,0x00,0x00,0x80,0x79,0xfe,0x1f,0xe0,0x00,0x00, - 0xc0,0x01,0x3d,0x3e,0x00,0x70,0x00,0x00,0x30,0x06,0x3e,0x0f,0x00,0x38,0x00, - 0x00,0xc8,0x8c,0x1f,0x07,0x00,0x38,0x00,0x00,0xf4,0xcc,0x8f,0x07,0x00,0x1c, - 0x00,0x00,0x72,0xee,0xf7,0x07,0x00,0x0e,0x00,0x00,0x02,0xff,0xe3,0x07,0x00, - 0x07,0x00,0x00,0x32,0xfe,0xc1,0xff,0x8f,0x03,0x00,0x00,0x3e,0xfe,0x80,0xff, - 0xff,0x01,0x00,0x00,0x7e,0x7c,0x00,0x00,0x7e,0x00,0x00,0x00,0x7c,0x3c,0x00, - 0x00,0x00,0x00,0x00,0x00,0xfc,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x1c, - 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, - 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00}; diff --git a/hacks/braid.c b/hacks/braid.c index 9f25d6db..4bbd93a6 100644 --- a/hacks/braid.c +++ b/hacks/braid.c @@ -35,9 +35,7 @@ static const char sccsid[] = "@(#)braid.c 4.00 97/01/01 xlockmore"; "*size: -7 \n" \ "*cycles: 100 \n" \ "*delay: 1000 \n" \ - "*ncolors: 64 \n" \ - "*eraseSpeed: 400 \n" \ - "*eraseMode: -1 \n" + "*ncolors: 64 \n" # define UNIFORM_COLORS # include "xlockmore.h" /* from the xscreensaver distribution */ # include "erase.h" diff --git a/hacks/bubbles-default.c b/hacks/bubbles-default.c new file mode 100644 index 00000000..8f9058e6 --- /dev/null +++ b/hacks/bubbles-default.c @@ -0,0 +1,151 @@ +/* bubbles_default.c - pick images for bubbles.c + * By Jamie Zawinski , 20-Jan-98. + * + * Permission to use, copy, modify, distribute, and sell this software and its + * documentation for any purpose is hereby granted without fee, provided that + * the above copyright notice appear in all copies and that both that + * copyright notice and this permission notice appear in supporting + * documentation. No representations are made about the suitability of this + * software for any purpose. It is provided "as is" without express or + * implied warranty. + */ + +#ifdef HAVE_CONFIG_H +# include "config.h" +#endif + +#include +#include +#include "bubbles.h" +#include "yarandom.h" + +#ifndef NO_DEFAULT_BUBBLE + +# define BLOOD 0 +# include "images/bubbles/blood1.xpm" +# include "images/bubbles/blood2.xpm" +# include "images/bubbles/blood3.xpm" +# include "images/bubbles/blood4.xpm" +# include "images/bubbles/blood5.xpm" +# include "images/bubbles/blood6.xpm" +# include "images/bubbles/blood7.xpm" +# include "images/bubbles/blood8.xpm" +# include "images/bubbles/blood9.xpm" +# include "images/bubbles/blood10.xpm" +# include "images/bubbles/blood11.xpm" + +# define BLUE 1 +# include "images/bubbles/blue1.xpm" +# include "images/bubbles/blue2.xpm" +# include "images/bubbles/blue3.xpm" +# include "images/bubbles/blue4.xpm" +# include "images/bubbles/blue5.xpm" +# include "images/bubbles/blue6.xpm" +# include "images/bubbles/blue7.xpm" +# include "images/bubbles/blue8.xpm" +# include "images/bubbles/blue9.xpm" +# include "images/bubbles/blue10.xpm" +# include "images/bubbles/blue11.xpm" + +# define GLASS 2 +# include "images/bubbles/glass1.xpm" +# include "images/bubbles/glass2.xpm" +# include "images/bubbles/glass3.xpm" +# include "images/bubbles/glass4.xpm" +# include "images/bubbles/glass5.xpm" +# include "images/bubbles/glass6.xpm" +# include "images/bubbles/glass7.xpm" +# include "images/bubbles/glass8.xpm" +# include "images/bubbles/glass9.xpm" +# include "images/bubbles/glass10.xpm" +# include "images/bubbles/glass11.xpm" + +# define JADE 3 +# include "images/bubbles/jade1.xpm" +# include "images/bubbles/jade2.xpm" +# include "images/bubbles/jade3.xpm" +# include "images/bubbles/jade4.xpm" +# include "images/bubbles/jade5.xpm" +# include "images/bubbles/jade6.xpm" +# include "images/bubbles/jade7.xpm" +# include "images/bubbles/jade8.xpm" +# include "images/bubbles/jade9.xpm" +# include "images/bubbles/jade10.xpm" +# include "images/bubbles/jade11.xpm" + +# define END 4 + + +char **default_bubbles[50]; +int num_default_bubbles; + +void init_default_bubbles(void) +{ + int i = 0; + switch (random() % END) { + case BLOOD: + default_bubbles[i++] = blood1; + default_bubbles[i++] = blood2; + default_bubbles[i++] = blood3; + default_bubbles[i++] = blood4; + default_bubbles[i++] = blood5; + default_bubbles[i++] = blood6; + default_bubbles[i++] = blood7; + default_bubbles[i++] = blood8; + default_bubbles[i++] = blood9; + default_bubbles[i++] = blood10; + default_bubbles[i++] = blood11; + break; + + case BLUE: + default_bubbles[i++] = blue1; + default_bubbles[i++] = blue2; + default_bubbles[i++] = blue3; + default_bubbles[i++] = blue4; + default_bubbles[i++] = blue5; + default_bubbles[i++] = blue6; + default_bubbles[i++] = blue7; + default_bubbles[i++] = blue8; + default_bubbles[i++] = blue9; + default_bubbles[i++] = blue10; + default_bubbles[i++] = blue11; + break; + + case GLASS: + default_bubbles[i++] = glass1; + default_bubbles[i++] = glass2; + default_bubbles[i++] = glass3; + default_bubbles[i++] = glass4; + default_bubbles[i++] = glass5; + default_bubbles[i++] = glass6; + default_bubbles[i++] = glass7; + default_bubbles[i++] = glass8; + default_bubbles[i++] = glass9; + default_bubbles[i++] = glass10; + default_bubbles[i++] = glass11; + break; + + case JADE: + default_bubbles[i++] = jade1; + default_bubbles[i++] = jade2; + default_bubbles[i++] = jade3; + default_bubbles[i++] = jade4; + default_bubbles[i++] = jade5; + default_bubbles[i++] = jade6; + default_bubbles[i++] = jade7; + default_bubbles[i++] = jade8; + default_bubbles[i++] = jade9; + default_bubbles[i++] = jade10; + default_bubbles[i++] = jade11; + break; + + default: + abort(); + break; + } + + default_bubbles[i] = 0; + num_default_bubbles = i; +} + +#endif /* NO_DEFAULT_BUBBLE */ diff --git a/hacks/bubbles-samples/blood.bub.gz b/hacks/bubbles-samples/blood.bub.gz deleted file mode 100644 index b98e8558..00000000 Binary files a/hacks/bubbles-samples/blood.bub.gz and /dev/null differ diff --git a/hacks/bubbles-samples/blue.bub.gz b/hacks/bubbles-samples/blue.bub.gz deleted file mode 100644 index f656079c..00000000 Binary files a/hacks/bubbles-samples/blue.bub.gz and /dev/null differ diff --git a/hacks/bubbles-samples/jade.bub.gz b/hacks/bubbles-samples/jade.bub.gz deleted file mode 100644 index 48424f08..00000000 Binary files a/hacks/bubbles-samples/jade.bub.gz and /dev/null differ diff --git a/hacks/bubbles-sources/blood.pov b/hacks/bubbles-sources/blood.pov deleted file mode 100644 index 8166f4ea..00000000 --- a/hacks/bubbles-sources/blood.pov +++ /dev/null @@ -1,24 +0,0 @@ -#include "colors.inc" -#include "shapes.inc" -#include "textures.inc" - -/* The following make the field of view as wide as it is high - * Thus, you should have the -W and -H command line options - * equal to each other. */ -camera { - location <5.8, 0, 0> - up <0, 1, 0> - right <1, 0, 0> - look_at <0, 0, 0> -} - -sphere { - <0,0,0>, 2.5 - texture { Blood_Marble - scale <2, 2, 2> - rotate <0, 20, 0> } - finish { Dull } -} - -light_source {<6, 1, 0> color White} -/* light_source {<6.1, 1, 0> color White} */ diff --git a/hacks/bubbles-sources/blue.pov b/hacks/bubbles-sources/blue.pov deleted file mode 100644 index 86d1ff8d..00000000 --- a/hacks/bubbles-sources/blue.pov +++ /dev/null @@ -1,22 +0,0 @@ -#include "colors.inc" -#include "shapes.inc" -#include "textures.inc" - -/* The following make the field of view as wide as it is high - * Thus, you should have the -W and -H command line options - * equal to each other. */ -camera { - location <5.8, 0, 0> - up <0, 1, 0> - right <1, 0, 0> - look_at <0, 0, 0> -} - -sphere { - <0,0,0>, 2.5 - texture { Blue_Agate - scale <0.7, 0.7, 0.7> } - finish { phong 1 } -} - -light_source {<6, 1, 0> color White} diff --git a/hacks/bubbles-sources/glass.pov b/hacks/bubbles-sources/glass.pov deleted file mode 100644 index c1897714..00000000 --- a/hacks/bubbles-sources/glass.pov +++ /dev/null @@ -1,27 +0,0 @@ -#include "colors.inc" -#include "shapes.inc" -#include "textures.inc" - -/* The following make the field of view as wide as it is high - * Thus, you should have the -W and -H command line options - * equal to each other. */ -camera { - location <5.8, 0, 0> - up <0, 1, 0> - right <1, 0, 0> - look_at <0, 0, 0> -} - -sphere { - <0,0,0>, 2.5 - texture { Glass - scale <0.7, 0.7, 0.7> - rotate y*clock - normal {bumps 0.4 scale 0.1} - finish { Shiny } -# finish { phong 0.4 } - } -} - -light_source {<6, 7, 0> color White} -light_source {<6.1, 1, 0> color Blue} diff --git a/hacks/bubbles-sources/jade.pov b/hacks/bubbles-sources/jade.pov deleted file mode 100644 index 7c1cb023..00000000 --- a/hacks/bubbles-sources/jade.pov +++ /dev/null @@ -1,24 +0,0 @@ -#include "colors.inc" -#include "shapes.inc" -#include "textures.inc" - -/* The following make the field of view as wide as it is high - * Thus, you should have the -W and -H command line options - * equal to each other. */ -camera { - location <5.8, 0, 0> - up <0, 1, 0> - right <1, 0, 0> - look_at <0, 0, 0> -} - -sphere { - <0,0,0>, 2.5 - texture { Jade - scale <0.7, 0.7, 0.7> - rotate y*clock } - finish { phong 0.4 } -} - -light_source {<6, 1, 0> color White} -light_source {<6.1, 1, 0> color White} diff --git a/hacks/bubbles-tools/bubblestodefault b/hacks/bubbles-tools/bubblestodefault deleted file mode 100755 index 3ad718b8..00000000 --- a/hacks/bubbles-tools/bubblestodefault +++ /dev/null @@ -1,115 +0,0 @@ -#!/usr/bin/perl -# -# $Id: bubblestodefault,v 1.1 1996/09/08 01:35:51 jwz Exp $ -# -#---------------------------------------------------------------------------- -# Copyright (C) 1995-1996 James Macnicol -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by the -# Free Software Foundation; either version 2, or (at your option) any later -# version. -# -# This program is distributed in the hope that it will be useful, but -# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY -# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License -# for more details. -#----------------------------------------------------------------------------- -# -# Contact me (J.Macnicol@student.anu.edu.au) if you have problems. -# -# [ The moral of this story is use a version of rm which safely backs up -# files when you delete them in case you do something stupid like -# "rm * xpm" which trashed all the scripts in this directory so I had -# to write them again. Grrrrrr..... ] -# -#----------------------------------------------------------------------------- -# -# This script takes a set of XPM files (from povbubbles, for example) -# whose names are listed in file with extension .names (of same format -# as output by povbubbles) and puts them together into a file which can -# be used in place of the source file bubbles_default.c which comes with -# bubbles/xscreensaver. -# -# To use it, provide as an argument the base-name of the .names file, -# i.e. if you ran povbubbles on the file foo.pov by typing "povbubbles foo" -# then this created a file "foo.names" so you can now make a new -# bubbles_default.c by typing "bubblestodefault foo". -# - -sub die_help { - print STDERR "Usage: $0 [-help] base-name\n"; - print STDERR " -help gives this message.\n"; - print STDERR " base-name is the name of the file used to generate\n"; - print STDERR " the XPM files, e.g. if you invoked povbubbles with\n"; - print STDERR " \"povbubbles foo\"\n"; - print STDERR " then you should invoke $0 with\n"; - die(" \"$0 foo\"\n"); -} - -sub die_usage { - die "Usage: $0 [-help] base-name\n"; -} - -$infile = undef; - -# Process command line arguments -while ($op = shift) { - if ($op eq "-help") { - &die_help; - } else { - $infile = $op; - # Ignore further arguments - break; - } -} -if ($infile eq undef) { - &die_usage; -} - -$namesfile = $infile . ".names"; - -if (! -f $namesfile) { - die("File list $namesfile doesn't exist\n"); -} - -if (-f "bubbles_default.c") { - print "Backing up bubbles_default.c...\n"; - system("mv -f bubbles_default.c bubbles_default.c.bak"); -} - -open(OUT, ">bubbles_default.c") || die("Couldn't open bubbles_default.c\n"); -print OUT "#include \n"; -print OUT "#include \"bubbles.h\"\n"; -print OUT "\n"; -print OUT "#ifndef NO_DEFAULT_BUBBLE\n"; -print OUT "\n"; - -open(NAMES, $namesfile) || die ("Couldn't open $namesfile\n"); -$numbubbles = 0; -while () { - if (/\s*(\S+)\:(\S+)\s*/) { - $filename = $1; - $xpmname = $2; - $xpmlist = $xpmlist . $xpmname . ", "; - open(CAT, $filename) || die("Couldn't open file $filename listed in\ -$namesfile\n"); - while () { - print OUT; - } - close(CAT); - $numbubbles++; - } else { - print STDERR "Can't understand the line \"$_\"\n"; - print STDERR " in $namesfile. Ignoring...\n"; - } -} -print OUT "char **default_bubbles[] = {$xpmlist"; -print OUT "(char **)0};\n"; -print OUT "\n"; -print OUT "int num_default_bubbles = $numbubbles;\n"; -print OUT "\n"; -print OUT "#endif /* NO_DEFAULT_BUBBLE */\n"; - -close(NAMES); -close(OUT); diff --git a/hacks/bubbles-tools/bubblestofile b/hacks/bubbles-tools/bubblestofile deleted file mode 100755 index 4eaf5c9b..00000000 --- a/hacks/bubbles-tools/bubblestofile +++ /dev/null @@ -1,107 +0,0 @@ -#!/usr/bin/perl -# -# $Id: bubblestofile,v 1.1 1996/09/08 01:35:52 jwz Exp $ -# -#---------------------------------------------------------------------------- -# Copyright (C) 1995-1996 James Macnicol -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by the -# Free Software Foundation; either version 2, or (at your option) any later -# version. -# -# This program is distributed in the hope that it will be useful, but -# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY -# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License -# for more details. -#----------------------------------------------------------------------------- -# -# Contact me (J.Macnicol@student.anu.edu.au) if you have problems. -# -# [ The moral of this story is use a version of rm which safely backs up -# files when you delete them in case you do something stupid like -# "rm * xpm" which trashed all the scripts in this directory so I had -# to write them again. Grrrrrr..... ] -# -#----------------------------------------------------------------------------- -# -# This script takes a set of XPM files (from povbubbles, for example) -# whose names are listed in file with extension .names (of same format -# as output by povbubbles) and puts them together into a file which can -# loaded with the -file option or place in a directory suitable for -# use with the -directory option to bubbles. Note that neither of these -# options are available if you have just compiled bubbles as provided. -# You must edit bubbles.h to enable these. Files generated by this script -# have by default the extension ".bub". -# -# To use it, provide as an argument the base-name of the .names file, -# i.e. if you ran povbubbles on the file foo.pov by typing "povbubbles foo" -# then this created a file "foo.names" so you can now make the loadable file -# "foo.bub" by typing "bubblestofile foo". -# - -sub die_help { - print STDERR "Usage: $0 [-help] base-name\n"; - print STDERR " -help\n"; - print STDERR " gives this message.\n"; - print STDERR " base-name is the name of the file used to generate\n"; - print STDERR " the XPM files, e.g. if you invoked povbubbles with\n"; - print STDERR " \"povbubbles foo\"\n"; - print STDERR " then you should invoke $0 with\n"; - die(" \"$0 foo\"\n"); -} - -sub die_usage { - die "Usage: $0 [-help] base-name\n"; -} - -$infile = undef; - -# Process command line arguments -while ($op = shift) { - if ($op eq "-help") { - &die_help; - } else { - $infile = $op; - # Ignore further arguments - break; - } -} -if ($infile eq undef) { - &die_usage; -} - -$namesfile = $infile . ".names"; -$outfile = $infile . ".bub"; - -if (! -f $namesfile) { - die("File list $namesfile doesn't exist\n"); -} - -if (-f $outfile) { - print "Backing up $outfile\n"; - system("mv -f $outfile $outfile.bak"); -} - -open(OUT, ">$outfile") || die("Couldn't open $outfile\n"); -open(NAMES, $namesfile) || die ("Couldn't open $namesfile\n"); -$numbubbles = 0; -while () { - if (/\s*(\S+)\:(\S+)\s*/) { - $filename = $1; - $xpmname = $2; - open(CAT, $filename) || die("Couldn't open file $filename listed in\ -$namesfile\n"); - while () { - print OUT; - } - close(CAT); - } else { - print STDERR "Can't understand the line \"$_\"\n"; - print STDERR " in $namesfile. Ignoring...\n"; - } -} -close(NAMES); -close(OUT); - - diff --git a/hacks/bubbles-tools/xpm2default b/hacks/bubbles-tools/xpm2default deleted file mode 100755 index b4236089..00000000 --- a/hacks/bubbles-tools/xpm2default +++ /dev/null @@ -1,51 +0,0 @@ -#!/usr/bin/perl -#---------------------------------------------------------------------------- -# Copyright (C) 1995-1996 James Macnicol -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by the -# Free Software Foundation; either version 1, or (at your option) any later -# version. -# -# This program is distributed in the hope that it will be useful, but -# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY -# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License -# for more details. -#----------------------------------------------------------------------------- -# -# Prints to the stdout a file suitable for use as bubbles_default.c for the -# bubbles screensaver (i.e. the default bubble which is compiled into the -# executable). A list of XPMs is expected as input, e.g. output from the -# pov2xpm script in this directory. -# -# Remember to change the path to your perl executable at the top of the -# script if it is wrong. -# -# Examples of usage: -# -# pov2xpm sample.pov | xpm2default > bubbles_default.c -# -# A new set of bubbles is first created with pov2xpm then passed to this -# script which places the C wrapper around the data and finally dumps the -# output into bubbles_default.c. -# -# xpm2default < sample.xpm > bubbles_default.c -# -# Same as the previous example except the XPM data came from a file rather -# than a pipe. -# -$numargs = @ARGV; -print "#include \"bubbles.h\"\n"; -print "\n"; -print "#ifndef NO_DEFAULT_BUBBLE\n"; -print "\n"; -print "char *default_ball_data[] = {\n"; -while () { - chop; - s/"/\\"/g; - print "\"$_\",\n"; -} -print "(char *)0\n"; -print "};\n"; -print "\n"; -print "#endif\n"; diff --git a/hacks/bubbles.c b/hacks/bubbles.c index db87ffe4..99e64b10 100644 --- a/hacks/bubbles.c +++ b/hacks/bubbles.c @@ -1,19 +1,17 @@ /* bubbles.c - frying pan / soft drink in a glass simulation */ -/*$Id: bubbles.c,v 1.10 1997/12/03 10:56:13 jwz Exp $*/ +/*$Id: bubbles.c,v 1.13 1998/02/21 21:55:14 jwz Exp $*/ /* * Copyright (C) 1995-1996 James Macnicol * - * This program is free software; you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by the - * Free Software Foundation; either version 2, or (at your option) any later - * version. - * - * This program is distributed in the hope that it will be useful, but - * WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY - * or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License - * for more details. + * Permission to use, copy, modify, distribute, and sell this software and its + * documentation for any purpose is hereby granted without fee, provided that + * the above copyright notice appear in all copies and that both that + * copyright notice and this permission notice appear in supporting + * documentation. No representations are made about the suitability of this + * software for any purpose. It is provided "as is" without express or + * implied warranty. */ /* @@ -45,20 +43,9 @@ #include "screenhack.h" #include "bubbles.h" -#ifdef BUBBLES_IO -# include -# include -# include -#endif /* BUBBLES_IO */ - #include -#ifdef SIGNAL_NONSENSE /* what's this crap doing in here? */ -#include -#endif /* SIGNAL_NONSENSE */ - #include -#include #include #ifndef VMS @@ -75,34 +62,28 @@ #include "yarandom.h" #ifdef HAVE_XPM -#include +# include #endif /* * Public variables */ -#ifndef NO_DEFAULT_BUBBLE +extern void init_default_bubbles(void); extern int num_default_bubbles; extern char **default_bubbles[]; -#endif /* NO_DEFAULT_BUBBLE */ char *progclass = "Bubbles"; char *defaults [] = { - "*background: black", - "*foreground: white", - "*simple: false", - "*broken: false", - "*delay: 800", -#ifdef BUBBLES_IO - "*file: (default)", - "*directory: (default)", -#endif /* BUBBLES_IO */ - "*quiet: false", - "*nodelay: false", - "*3D: false", - "*geometry: 400x300", + "Bubbles.background: black", + "*foreground: white", + "*simple: false", + "*broken: false", + "*delay: 800", + "*quiet: false", + "*nodelay: false", + "*3D: false", 0 }; @@ -114,10 +95,6 @@ XrmOptionDescRec options [] = { { "-quiet", ".quiet", XrmoptionNoArg, "true" }, { "-nodelay", ".nodelay", XrmoptionNoArg, "true" }, { "-3D", ".3D", XrmoptionNoArg, "true" }, -#ifdef BUBBLES_IO - { "-file", ".file", XrmoptionSepArg, 0 }, - { "-directory", ".directory", XrmoptionSepArg, 0 }, -#endif /* BUBBLES_IO */ { "-delay", ".delay", XrmoptionSepArg, 0 }, { 0, 0, 0, 0 } }; @@ -156,10 +133,6 @@ static GC draw_gc, erase_gc; #ifdef HAVE_XPM static int num_bubble_pixmaps; static Bubble_Step **step_pixmaps; -#ifdef BUBBLES_IO -static char *pixmap_file; -#endif /* BUBBLES_IO */ -static int use_default_bubble; #endif /* HAVE_XPM */ /* Options stuff */ @@ -960,53 +933,6 @@ get_length_of_bubble_list(Bubble *bb) #ifdef HAVE_XPM -static void -free_pixmaps (void) -/* Free resources associated with XPM */ -{ - int i; - -#ifdef DEBUG - if (simple) { - fprintf(stderr, "free_pixmaps() called in simple mode\n"); - exit(1); - } - printf("free_pixmaps()\n"); -#endif /* DEBUG */ - - for(i = 0; i < (num_bubble_pixmaps - 1); i++) { - XFreePixmap(defdsp, step_pixmaps[i]->ball); - XFreePixmap(defdsp, step_pixmaps[i]->shape_mask); - XFreeGC(defdsp, step_pixmaps[i]->draw_gc); - XFreeGC(defdsp, step_pixmaps[i]->erase_gc); - XFreeColors(defdsp, defcmap, step_pixmaps[i]->xpmattrs.pixels, - step_pixmaps[i]->xpmattrs.npixels, 0); - XpmFreeAttributes(&step_pixmaps[i]->xpmattrs); - } -} - -#ifdef SIGNAL_NONSENSE -static void -onintr(int a) -/* This gets called when SIGINT or SIGTERM is received */ -{ - free_pixmaps(); - exit(0); -} - -#ifdef DEBUG -static void -onsegv(int a) -/* Called when SEGV detected. Hmmmmm.... */ -{ - fflush(stdout); - fprintf(stderr, "SEGV detected! : %d\n", a); - exit(1); -} -#endif /* DEBUG */ -#endif /* SIGNAL_NONSENSE */ - - /* * Pixmaps without file I/O (but do have XPM) */ @@ -1118,7 +1044,6 @@ make_pixmap_array(Bubble_Step *list) #endif /* DEBUG */ } -#ifndef NO_DEFAULT_BUBBLE static void make_pixmap_from_default(char **pixmap_data, Bubble_Step *bl) /* Read pixmap data which has been compiled into the program and a pointer @@ -1206,23 +1131,7 @@ default_to_pixmaps (void) Bubble_Step *newpix, *tmppix; char **pixpt; - /* Make sure pixmaps are freed when program is terminated */ - /* This is when I hit ^C */ -#ifdef SIGNAL_NONSENSE - if (signal(SIGINT, SIG_IGN) != SIG_IGN) - signal(SIGINT, onintr); - /* xscreensaver sends SIGTERM */ - if (signal(SIGTERM, SIG_IGN) != SIG_IGN) - signal(SIGTERM, onintr); -#ifdef DEBUG - if (signal(SIGSEGV, SIG_IGN) != SIG_IGN) { - printf("Setting signal handler for SIGSEGV\n"); - signal(SIGSEGV, onsegv); - } else { - printf("Didn't set signal hanlder for SIGSEGV\n"); - } -#endif /* DEBUG */ -#endif /* SIGNAL_NONSENSE */ + init_default_bubbles(); for (i = 0; i < num_default_bubbles; i++) { pixpt = default_bubbles[i]; @@ -1244,408 +1153,8 @@ default_to_pixmaps (void) make_pixmap_array(pixmap_list); } -#endif /* NO_DEFAULT_BUBBLE */ - #endif /* HAVE_XPM */ -/* - * File I/O stuff - */ - -#ifdef BUBBLES_IO - -static DIR * -my_opendir(char *name) -/* Like opendir() but checks for things so we don't have to do it multiple -times in the code. */ -{ - DIR *rv; - - if (name == (char *)NULL) { - fprintf(stderr, "NULL directory name\n"); - return (DIR *)NULL; - } - - if ((rv = opendir(name)) == NULL) { - perror(name); - return (DIR *)NULL; - } - - return rv; -} - -static int -regular_file(char *name) -/* Check to see if we can use the named file. This was broken under Linux -1.3.45 but seems to be okay under 1.3.54. The parameter "name" was being -trashed if the file didn't exist. Yeah, I know 1.3.x are development -kernels.... -*/ -{ - int fd; - - if ((fd = open(name, O_RDONLY)) == -1) { - perror(name); - return 0; - } else { - close(fd); - return 1; - } -} - -static char * -get_random_name(char *dir) -/* Pick an appropriate file at random out of the files in the directory dir */ -{ - STRUCT_DIRENT *dp; - DIR *dfd; - int numentries = 0; - int entnum; - int x; - char buf[PATH_BUF_SIZE]; - char *rv; - - if ((dfd = my_opendir(dir)) == (DIR *)NULL) - return (char *)NULL; - - while ((dp = readdir(dfd)) != NULL) { - if ((strcmp(DIRENT_NAME, ".") == 0) || (strcmp(DIRENT_NAME, "..") == 0)) - continue; - if ((strlen(dir)+strlen(DIRENT_NAME)+2) > 1024) { - fprintf(stderr, "name %s/%s too long\n", dir, DIRENT_NAME); - continue; - } - if (sprintf(buf, "%s/%s", dir, DIRENT_NAME) > (PATH_BUF_SIZE-1)) { - fprintf(stderr, "path buffer overflowed in get_random_name()\n"); - continue; - } - if (regular_file(buf)) - ++numentries; - } - closedir(dfd); - if (numentries == 0) { - fprintf(stderr, "No suitable files found in %s\n", dir); - return (char *)NULL; - } - entnum = ya_random() % numentries; - x = 0; - - if ((dfd = my_opendir(dir)) == (DIR *)NULL) - return (char *)NULL; - while ((dp = readdir(dfd)) != NULL) { - if ((strcmp(DIRENT_NAME, ".") == 0) || (strcmp(DIRENT_NAME, "..") == 0)) - continue; - if ((strlen(dir)+strlen(DIRENT_NAME)+2) > 1024) { - /* We warned about this previously */ - continue; - } - if (sprintf(buf, "%s/%s", dir, DIRENT_NAME) > (PATH_BUF_SIZE-1)) { - fprintf(stderr, "path buffer overflowed in get_random_name()\n"); - continue; - } - if (regular_file(buf)) { - if (x == entnum) { - rv = (char *)xmalloc(1024 * sizeof(char)); - strcpy(rv, buf); - closedir(dfd); - return rv; - } - ++x; - } - } - /* We've screwed up if we reach here - someone must have deleted all the - files while we were counting them... */ - fprintf(stderr, "get_random_name(): Oops!\n"); - exit(1); -} - -static int -read_line(int fd, char **buf, int bufsize) -/* A line is read from fd until a '\n' is found or EOF is reached. (*buf) -is initially of length bufsize and is extended by bufsize chars if need -be (for as many times as it takes). */ -{ - char x; - int pos = 0; - int size = bufsize; - int rv; - char *newbuf; - - while (1) { - rv = read(fd, &x, 1); - if (rv == -1) { - perror("read_line(): "); - return IO_ERROR; - } else if (rv == 0) { - (*buf)[pos] = '\0'; - return EOF_REACHED; - } else if (x == '\n') { - (*buf)[pos] = '\0'; - return LINE_READ; - } else { - (*buf)[pos++] = x; - if (pos == (size - 1)) { - /* We've come to the end of the space */ - newbuf = (char *)xmalloc((size+bufsize) * sizeof(char)); - strncpy(newbuf, *buf, (size - 1)); - free(*buf); - *buf = newbuf; - size += bufsize; - } - } - } -} - -static int -create_temp_file(char **name) -/* Create a temporary file in /tmp and return a filedescriptor to it */ -{ - int rv; - - if (*name != (char *)NULL) - free(*name); - - if ((*name = tempnam("/tmp", "abxdfes")) == (char *)NULL) { - fprintf(stderr, "Couldn't make new temporary file\n"); - exit(1); - } -/* printf("Temp file created : %s\n", *name); */ - if ((rv = creat(*name, 0644)) == -1) { - fprintf(stderr, "Couldn't open temporary file\n"); - exit(1); - } - - return rv; -} - - -#ifdef BUBBLES_IO -static void -make_pixmap_from_file(char *fname, Bubble_Step *bl) -/* Read the pixmap in file fname into structure bl which must already - be allocated. */ -{ - int result; - XGCValues gcv; - - if (bl == (Bubble_Step *)NULL) { - fprintf(stderr, "NULL pointer passed to make_pixmap()\n"); - exit(1); - } - - bl->xpmattrs.closeness = 40000; - bl->xpmattrs.valuemask = XpmColormap | XpmCloseness; - bl->xpmattrs.colormap = defcmap; - - result = XpmReadFileToPixmap(defdsp, defwin, fname, &bl->ball, - &bl->shape_mask, &bl->xpmattrs); - - switch(result) { - case XpmColorError: - fprintf(stderr, "xpm: color substitution performed\n"); - /* fall through */ - case XpmSuccess: - bl->radius = MAX(bl->xpmattrs.width, bl->xpmattrs.height) / 2; - bl->area = calc_bubble_area(bl->radius); - break; - case XpmColorFailed: - fprintf(stderr, "xpm: color allocation failed\n"); - exit(1); - case XpmNoMemory: - fprintf(stderr, "xpm: out of memory\n"); - exit(1); - default: - fprintf(stderr, "xpm: unknown error code %d\n", result); - exit(1); - } - - gcv.plane_mask = AllPlanes; - gcv.foreground = default_fg_pixel; - gcv.function = GXcopy; - bl->draw_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv); - XSetClipMask(defdsp, bl->draw_gc, bl->shape_mask); - - gcv.foreground = default_bg_pixel; - gcv.function = GXcopy; - bl->erase_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv); - XSetClipMask(defdsp, bl->erase_gc, bl->shape_mask); -} -#endif /* BUBBLES_IO */ - -static void -read_file_to_pixmaps(char *fname) -/* Read the pixmaps contained in the file fname into memory. THESE SHOULD -BE UNCOMPRESSED AND READY TO GO! */ -{ - int fd, tmpfd=0, rv; - int inxpm = 0; - int xpmseen = 0; - char *buf = (char *)NULL; - char *tmpname = (char *)NULL; - Bubble_Step *pixmap_list = (Bubble_Step *)NULL; - Bubble_Step *newpix, *tmppix; - - /* We first create a linked list of pixmaps before allocating - memory for the array */ - - if ((fd = open(fname, O_RDONLY)) == -1) { - fprintf(stderr, "Couldn't open %s\n", fname); - exit(1); - } - -#ifdef SIGNAL_NONSENSE - /* Make sure pixmaps are freed when program is terminated */ - /* This is when I hit ^C */ - if (signal(SIGINT, SIG_IGN) != SIG_IGN) - signal(SIGINT, onintr); - /* xscreensaver sends SIGTERM */ - if (signal(SIGTERM, SIG_IGN) != SIG_IGN) - signal(SIGTERM, onintr); -#ifdef DEBUG - if (signal(SIGSEGV, SIGN_IGN) != SIG_IGN) - signal(SIGSEGV, onsegv); -#endif /* DEBUG */ -#endif /* SIGNAL_NONSENSE */ - - while (1) { - if (inxpm == 2) - break; - - buf = (char *)malloc(READ_LINE_BUF_SIZE * sizeof(char)); - - switch ((rv = read_line(fd, &buf, READ_LINE_BUF_SIZE))) { - case IO_ERROR: - fprintf(stderr, "An I/O error occurred\n"); - exit(1); - case EOF_REACHED: - if (inxpm) { - fprintf(stderr, "EOF occurred inside an XPM block\n"); - exit(1); - } else - inxpm = 2; - break; - case LINE_READ: - if (inxpm) { - if (strncmp("};", buf, 2) == 0) { - inxpm = 0; - write(tmpfd, buf, strlen(buf)); - write(tmpfd, "\n", 1); - close(tmpfd); - /* Now process the tmpfile */ - newpix = (Bubble_Step *)xmalloc(sizeof(Bubble_Step)); - make_pixmap_from_file(tmpname, newpix); - /* Now add to list */ - if (pixmap_list == (Bubble_Step *)NULL) { - pixmap_list = newpix; - } else { - tmppix = pixmap_list; - while (tmppix->next != (Bubble_Step *)NULL) - tmppix = tmppix->next; - tmppix->next = newpix; - } - newpix->next = (Bubble_Step *)NULL; - unlink(tmpname); - } else { - write(tmpfd, buf, strlen(buf)); - write(tmpfd, "\n", 1); - } - } else { - if (strncmp("/* XPM */", buf, 9) == 0) { - tmpfd = create_temp_file(&tmpname); -/* This proves XPM's performance is kinda pathetic */ -#ifdef DEBUG - printf("New XPM detected : %s, fd=%d\n", tmpname, tmpfd); -#endif /* DEBUG */ - inxpm = 1; - xpmseen = 1; - } - write(tmpfd, buf, strlen(buf)); - write(tmpfd, "\n", 1); - } - break; - default: - fprintf(stderr, "read_line returned unknown code %d\n", rv); - exit(1); - } - - free(buf); - } - - close(fd); - if (buf != (char *)NULL) - free(buf); - if (tmpname != (char *)NULL) - free(tmpname); - - if (! xpmseen) { - fprintf(stderr, "There was no XPM data in the file %s\n", fname); - exit(1); - } - - /* Finally construct step_pixmaps[] */ - make_pixmap_array(pixmap_list); -} - -static void -shell_exec(char *command) -/* Forks a shell to execute "command" then waits for command to finish */ -{ - int pid, status, wval; - - switch(pid=fork()) { - case 0: - if (execlp(BOURNESH, BOURNESH, "-c", command, (char *)NULL) == -1) { - fprintf(stderr, "Couldn't exec shell %s\n", BOURNESH); - exit(1); - } - /* fall through if execlp() fails */ - case -1: - /* Couldn't fork */ - perror(progname); - exit(1); - default: - while ((wval = wait(&status)) != pid) - if (wval == -1) { - perror(progname); - exit(1); - } - } -} - -static void -uncompress_file(char *current, char *namebuf) -/* If the file current is compressed (i.e. its name ends in .gz or .Z, -no check is made to see if it is actually a compressed file...) then a -new temporary file is created for it and it is decompressed into there, -returning the name of the file to namebuf, else current is returned in -namebuf */ -{ - int fd; - char *tname = (char *)NULL; - char argbuf[COMMAND_BUF_SIZE]; - - if (((strlen(current) >=4) && - (strncmp(¤t[strlen(current)-3], ".gz", 3) == 0)) || - ((strlen(current) >=3) && - (strncmp(¤t[strlen(current)-2], ".Z", 2) == 0))) { - fd = create_temp_file(&tname); - /* close immediately but don't unlink so we should have a zero length - file in /tmp which we can append to */ - close(fd); - if (sprintf(argbuf, "%s -dc %s > %s", GZIP, current, tname) > - (COMMAND_BUF_SIZE-1)) { - fprintf(stderr, "command buffer overflowed in uncompress_file()\n"); - exit(1); - } - shell_exec(argbuf); - strcpy(namebuf, tname); - } else { - strcpy(namebuf, current); - } - return; -} - -#endif /* BUBBLES_IO */ /* * Main stuff @@ -1657,14 +1166,6 @@ get_resources(Display *dpy, Window window) /* Get the appropriate X resources and warn about any inconsistencies. */ { Bool nodelay; -#ifdef BUBBLES_IO -#ifdef HAVE_XPM - char *dirname; -#else - char *foo, *bar; -#endif /* HAVE_XPM */ -#endif /* BUBBLES_IO */ - XWindowAttributes xgwa; Colormap cmap; XGetWindowAttributes (dpy, window, &xgwa); @@ -1703,37 +1204,6 @@ get_resources(Display *dpy, Window window) simple = 1; #else broken = get_boolean_resource("broken", "Boolean"); -#ifdef BUBBLES_IO - pixmap_file = get_string_resource("file", "File"); - dirname = get_string_resource("directory", "Directory"); -#ifdef NO_DEFAULT_BUBBLE - /* Must specify -file or -directory if no default bubble compiled in */ - if (strcmp(pixmap_file, "(default)") != 0) { - } else if (strcmp(dirname, "(default)") != 0) { - if ((pixmap_file = get_random_name(dirname)) == (char *)NULL) { - /* Die if we can't open directory - make it consistent with -file - when it fails, rather than falling back to default. */ - exit(1); - } - } else { - fprintf(stderr, - "No default bubble compiled in - use -file or -directory\n"); - exit(1); - } -#else - if (strcmp(pixmap_file, "(default)") != 0) { - } else if (strcmp(dirname, "(default)") != 0) { - if ((pixmap_file = get_random_name(dirname)) == (char *)NULL) { - exit(1); - } - } else { - /* Use default bubble */ - use_default_bubble = 1; - } -#endif /* NO_DEFAULT_BUBBLE */ -#else - use_default_bubble = 1; -#endif /* BUBBLES_IO */ #endif /* HAVE_XPM */ } } @@ -1744,9 +1214,6 @@ init_bubbles (Display *dpy, Window window) XGCValues gcv; XWindowAttributes xgwa; int i; -#ifdef BUBBLES_IO - char uncompressed[1024]; -#endif /* BUBBLES_IO */ defdsp = dpy; defwin = window; @@ -1799,35 +1266,10 @@ init_bubbles (Display *dpy, Window window) #else /* Make sure all #ifdef sort of things have been taken care of in get_resources(). */ - if (use_default_bubble) { -#ifdef NO_DEFAULT_BUBBLE - fprintf(stderr, - "Bug: use_default_bubble and NO_DEFAULT_BUBBLE both defined\n"); - exit(1); -#else - default_to_pixmaps(); -#endif /* NO_DEFAULT_BUBBLE */ + default_to_pixmaps(); - /* Set mesh length */ - mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3; - } else { -#ifdef BUBBLES_IO - if (! regular_file(pixmap_file)) { - /* perror() in regular_file printed error message */ - exit(1); - } - uncompress_file(pixmap_file, uncompressed); - read_file_to_pixmaps(uncompressed); - if (strcmp(pixmap_file, uncompressed)) - unlink(uncompressed); - - mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3; -#else - fprintf(stderr, - "Bug: use_default_bubble is not defined yet I/O is not compiled in\n"); - exit(1); -#endif /* BUBBLES_IO */ - } + /* Set mesh length */ + mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3; #endif /* HAVE_XPM */ /* Am I missing something in here??? */ diff --git a/hacks/bubbles_default.c b/hacks/bubbles_default.c deleted file mode 100644 index 172abd1f..00000000 --- a/hacks/bubbles_default.c +++ /dev/null @@ -1,2127 +0,0 @@ -#ifdef HAVE_CONFIG_H -# include "config.h" -#endif - -#include -#include "bubbles.h" - -#ifndef NO_DEFAULT_BUBBLE - -/* XPM */ -static char *glass1[] = { -/* width height ncolors chars_per_pixel */ -"10 10 61 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #29293F", -"`c c #2C2C63", -"`d c #353579", -"`e c #242447", -"`f c #222245", -"`g c #25253E", -"`h c #1C1C3F", -"`i c #2B2B47", -"`j c #252544", -"`k c #222251", -"`l c #323264", -"`m c #212146", -"`n c #37374B", -"`o c #22223D", -"`p c #252536", -"`q c #232337", -"`r c #34346C", -"`s c #303068", -"`t c #26264A", -"`u c #5D5D97", -"`v c #363674", -"`w c #2C2C6A", -"`x c #2E2E5B", -"`y c #242451", -"`z c #343464", -"a` c #3C3C6F", -"aa c #353572", -"ab c #38386B", -"ac c #242454", -"ad c #181831", -"ae c #28285B", -"af c #37377A", -"ag c #20203F", -"ah c #26265C", -"ai c #4C4C60", -"aj c #383874", -"ak c #333379", -"al c #444458", -"am c #272756", -"an c #32326E", -"ao c #30306C", -"ap c #40407F", -"aq c #292944", -"ar c #212150", -"as c #323271", -"at c #2D2D76", -"au c #21213F", -"av c #25255A", -"aw c #35356D", -"ax c #313169", -"ay c #2C2C6E", -"az c #18182C", -"b` c #232344", -"ba c #292961", -"bb c #202037", -"bc c #1C1C33", -"bd c #242452", -"be c #45456F", -"bf c #242455", -/* pixels */ -"``````aibebebeal````", -"`````n`zaw`ua``l`n``", -"```i`xab`wasaj`r`x`q", -"``auaean`daf`vao`c`t", -"```haxahayatakbaaeb`", -"``adbfav`wapao`sam`m", -"``azagaracaaae`k`fbc", -"````bb`ybd`aar`e`o``", -"```````paq`j`b`g````", -"````````````````````" -}; -/* XPM */ -static char *glass2[] = { -/* width height ncolors chars_per_pixel */ -"12 12 75 2", -/* colors */ -"`` c None", -"`a c #25254C", -"`b c #23234A", -"`c c #212148", -"`d c #2E2E62", -"`e c #29293F", -"`f c #272754", -"`g c #414188", -"`h c #20202C", -"`i c #2E2E68", -"`j c #242447", -"`k c #25253E", -"`l c #B9B9ED", -"`m c #6767A3", -"`n c #2B2B47", -"`o c #29295C", -"`p c #252544", -"`q c #29295F", -"`r c #1F1F3E", -"`s c #2F2F68", -"`t c #2D2D66", -"`u c #30305F", -"`v c #4C4C6D", -"`w c #2B2B53", -"`x c #2F2F6E", -"`y c #34346C", -"`z c #3B3B55", -"a` c #303068", -"aa c #2C2C64", -"ab c #26264A", -"ac c #5D5D97", -"ad c #363674", -"ae c #3C3C66", -"af c #252556", -"ag c #30306E", -"ah c #3E3E54", -"ai c #2C2C6A", -"aj c #4C4C68", -"ak c #20204A", -"al c #2E2E5B", -"am c #343464", -"an c #16162C", -"ao c #292938", -"ap c #333384", -"aq c #3C3C6F", -"ar c #1E1E37", -"as c #38386B", -"at c #242454", -"au c #31316E", -"av c #181831", -"aw c #232349", -"ax c #272739", -"ay c #23234C", -"az c #37377A", -"b` c #1E1E3D", -"ba c #313174", -"bb c #3C3C78", -"bc c #383874", -"bd c #1B1B33", -"be c #40407F", -"bf c #292944", -"bg c #212150", -"bh c #2D2D76", -"bi c #191937", -"bj c #313169", -"bk c #22224D", -"bl c #18182C", -"bm c #2D2D65", -"bn c #232344", -"bo c #292961", -"bp c #27275F", -"bq c #242452", -"br c #484868", -"bs c #262657", -"bt c #242455", -/* pixels */ -"`````````vajajajbr``````", -"````ahaeae`yacasaq`zah``", -"`````w`f`dagacbb`y`u`u``", -"```naybm`i`mbabcaaamawar", -"``bf`ua`adbpaz`gai`ial`j", -"``bnbgbjaz`xbhapboaa`uav", -"``b`aybtbcaube`x`s`tbqbd", -"``anbiakafbb`l`i`q`o`rbl", -"`````rakbkaf`wbsay`c`k``", -"````ao`pay`aatab`bar`h``", -"````````ax`e`n`kax``````", -"````````````````````````" -}; -/* XPM */ -static char *glass3[] = { -/* width height ncolors chars_per_pixel */ -"14 14 90 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #383858", -"`c c #2E2E62", -"`d c #292967", -"`e c #3535A1", -"`f c #272751", -"`g c #23234D", -"`h c #29293F", -"`i c #353579", -"`j c #272754", -"`k c #20202C", -"`l c #2E2E3D", -"`m c #242447", -"`n c #25253E", -"`o c #3E3E67", -"`p c #1C1C3F", -"`q c #6767A3", -"`r c #2B2B47", -"`s c #29295C", -"`t c #2B2B61", -"`u c #29295F", -"`v c #1F1F3E", -"`w c #2F2F68", -"`x c #2D2D66", -"`y c #222251", -"`z c #2D2D69", -"a` c #33335B", -"aa c #37374B", -"ab c #22223D", -"ac c #28285A", -"ad c #2B2B53", -"ae c #2C2C36", -"af c #424266", -"ag c #232337", -"ah c #525265", -"ai c #32326A", -"aj c #1B1B2F", -"ak c #303068", -"al c #232351", -"am c #363674", -"an c #3C3C66", -"ao c #252556", -"ap c #27275B", -"aq c #363663", -"ar c #4C4C68", -"as c #2E2E5B", -"at c #29294C", -"au c #27274A", -"av c #252548", -"aw c #16162C", -"ax c #292938", -"ay c #353572", -"az c #38386B", -"b` c #4C4C85", -"ba c #2F2F83", -"bb c #20203F", -"bc c #313174", -"bd c #333379", -"be c #444458", -"bf c #272756", -"bg c #47477C", -"bh c #32326E", -"bi c #1B1B33", -"bj c #30306C", -"bk c #40407F", -"bl c #23233E", -"bm c #141422", -"bn c #343473", -"bo c #2D2D76", -"bp c #2E2E6D", -"bq c #40406E", -"br c #21213F", -"bs c #8080BA", -"bt c #25255A", -"bu c #1B1B39", -"bv c #35356D", -"bw c #262651", -"bx c #18182C", -"by c #373786", -"bz c #2B2B63", -"c` c #202037", -"ca c #1C1C33", -"cb c #242452", -"cc c #484868", -"cd c #1F1F43", -"ce c #2C2C5D", -"cf c #3535DD", -"cg c #262657", -"ch c #242455", -/* pixels */ -"``````````arccaharcc````````", -"``````bea``obqbqbqanafaa````", -"`````ladaqbv`qbsbgai`ca``b``", -"````a`a`asaib`bhb`bhakasau``", -"``c``j`c`d`dbd`eb`am`wce`aca", -"``bxasaobt`ibdbycf`iay`u`abx", -"``bl`a`t`ubnbdbocfbcbt`cbwbu", -"``bi`fch`sbhbkbabp`z`u`w`gaj", -"``bm`a`a`u`xbjaibgbzcgbf`paw", -"````agbralazap`t`ucbacbbaj``", -"`````kbrcdcbcbcgbw`y`vab`k``", -"``````axbrauatav`r`m`n`n````", -"``````````ax`h`r`nae````````", -"````````````````````````````" -}; -/* XPM */ -static char *glass4[] = { -/* width height ncolors chars_per_pixel */ -"20 20 151 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #29293F", -"`j c #2C2C63", -"`k c #2A2A61", -"`l c #33334C", -"`m c #353579", -"`n c #272754", -"`o c #20202C", -"`p c #2E2E3D", -"`q c #2E2E68", -"`r c #242447", -"`s c #2C2C66", -"`t c #222245", -"`u c #181824", -"`v c #25253E", -"`w c #B9B9ED", -"`x c #1C1C3F", -"`y c #6767A3", -"`z c #2B2B47", -"a` c #272743", -"aa c #222248", -"ab c #292931", -"ac c #29295C", -"ad c #1D1D39", -"ae c #252544", -"af c #2B2B61", -"ag c #29295F", -"ah c #1F1F3E", -"ai c #2F2F68", -"aj c #2D2D66", -"ak c #30305F", -"al c #2C2C5B", -"am c #11111C", -"an c #262655", -"ao c #31316D", -"ap c #4C4C6D", -"aq c #222251", -"ar c #323264", -"as c #43436E", -"at c #212146", -"au c #37374B", -"av c #22223D", -"aw c #252536", -"ax c #1D1D42", -"ay c #2A2A5C", -"az c #28285A", -"b` c #2B2B53", -"ba c #333372", -"bb c #2F2F6E", -"bc c #2B2B3F", -"bd c #2C2C36", -"be c #232337", -"bf c #34346C", -"bg c #525265", -"bh c #32326A", -"bi c #303068", -"bj c #21214C", -"bk c #2C2C64", -"bl c #292957", -"bm c #232351", -"bn c #26264A", -"bo c #2F2F60", -"bp c #5D5D97", -"bq c #363674", -"br c #3C3C66", -"bs c #252556", -"bt c #30306E", -"bu c #414178", -"bv c #2C2C6A", -"bw c #20204A", -"bx c #2E2E5B", -"by c #29294C", -"bz c #242451", -"c` c #27274A", -"ca c #343464", -"cb c #4F4F64", -"cc c #252548", -"cd c #292938", -"ce c #333384", -"cf c #3C3C6F", -"cg c #353572", -"ch c #1E1E37", -"ci c #38386B", -"cj c #414156", -"ck c #242454", -"cl c #181831", -"cm c #232349", -"cn c #272739", -"co c #4C4C85", -"cp c #2F2F83", -"cq c #28285B", -"cr c #36366C", -"cs c #48486D", -"ct c #23234C", -"cu c #37377A", -"cv c #20203F", -"cw c #26265C", -"cx c #313174", -"cy c #4C4C60", -"cz c #27273F", -"d` c #3C3C78", -"da c #48485C", -"db c #383874", -"dc c #333379", -"dd c #444458", -"de c #272756", -"df c #32326E", -"dg c #1B1B33", -"dh c #1E1E2C", -"di c #30306C", -"dj c #40407F", -"dk c #292944", -"dl c #212150", -"dm c #141422", -"dn c #323271", -"do c #2D2D76", -"dp c #2E2E6D", -"dq c #21213F", -"dr c #8080BA", -"ds c #23232D", -"dt c #25255A", -"du c #35356D", -"dv c #191937", -"dw c #262651", -"dx c #313169", -"dy c #2C2C6E", -"dz c #22224D", -"e` c #18182C", -"ea c #373786", -"eb c #232344", -"ec c #2B2B63", -"ed c #292961", -"ee c #202037", -"ef c #1C1C33", -"eg c #242452", -"eh c #45456F", -"ei c #535380", -"ej c #1F1F43", -"ek c #2C2C5D", -"el c #3535DD", -"em c #262657", -"en c #393963", -"eo c #242455", -/* pixels */ -"``````````````cycyapbgcbcybg````````````", -"``````````dacycsehcsehapehcsddcj````````", -"````````au`cenbraseicibucicibrendd``````", -"``````auau`ccacidudrbpdrcfcrarakau`p````", -"`````p`lbx`nbhbfdxcobpcodjdu`sakalb`bd``", -"`````zbybxbocicgbvbbdn`ydbdfbfekbxbybe``", -"``dh`r`rbl`faidydndn`hd`dnbtecafakdwah`o", -"``dhdqejcqajdfcg`meacu`hbqdfdibi`jblbndh", -"``ch`rbxemaidudnbq`geldcbqdbdn`jafbxbnav", -"``dm`x`bdxdxcwbqdycpdocxdcbvedbkcqalebdg", -"```uccctdzbsag`qbqdpeacxbtaidiagekdwcvdm", -"``dmcl`xeoandtdfbv`wdjcediecbiaydectatch", -"``amdvcm`xaf`kagaodi`qdbbaecanazejdvdv`u", -"````e``xcvandlcqckdtcgagcq`qaqay`tbjef``", -"````dsclaxbwdzdebsckb`acegbjeg`eaaadds``", -"``````eeeeejbzanegdw`abmdl`b`rcnavaw````", -"````````eeczbc`b`dby`dbya``eae`iaw``````", -"``````````bdawa`dkc`aeae`i`i`vab````````", -"``````````````bd`pcdcdbdcdbd````````````", -"````````````````````````````````````````" -}; -/* XPM */ -static char *glass5[] = { -/* width height ncolors chars_per_pixel */ -"24 24 164 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #272751", -"`j c #23234D", -"`k c #29293F", -"`l c #2C2C63", -"`m c #2A2A61", -"`n c #33334C", -"`o c #272754", -"`p c #414188", -"`q c #20202C", -"`r c #2E2E3D", -"`s c #1C1C28", -"`t c #2E2E68", -"`u c #242447", -"`v c #2C2C66", -"`w c #181824", -"`x c #25253E", -"`y c #161622", -"`z c #B9B9ED", -"a` c #3E3E67", -"aa c #1C1C3F", -"ab c #6767A3", -"ac c #2B2B47", -"ad c #222248", -"ae c #292931", -"af c #29295C", -"ag c #252544", -"ah c #1E1E47", -"ai c #2B2B61", -"aj c #29295F", -"ak c #1F1F3E", -"al c #2F2F68", -"am c #2D2D66", -"an c #30305F", -"ao c #2C2C5B", -"ap c #11111C", -"aq c #262655", -"ar c #31316D", -"as c #4C4C6D", -"at c #323264", -"au c #2D2D69", -"av c #33335B", -"aw c #212146", -"ax c #37374B", -"ay c #22223D", -"az c #252536", -"b` c #1D1D42", -"ba c #28285A", -"bb c #2B2B53", -"bc c #333372", -"bd c #2F2F6E", -"be c #2C2C36", -"bf c #424266", -"bg c #232337", -"bh c #2F2FB0", -"bi c #34346C", -"bj c #525265", -"bk c #32326A", -"bl c #1B1B2F", -"bm c #3B3B55", -"bn c #303068", -"bo c #21214C", -"bp c #2C2C64", -"bq c #292957", -"br c #26264A", -"bs c #202044", -"bt c #5D5D97", -"bu c #2B2B5C", -"bv c #363674", -"bw c #3C3C66", -"bx c #252556", -"by c #30306E", -"bz c #3E3E54", -"c` c #2C2C6A", -"ca c #25252E", -"cb c #27275B", -"cc c #363663", -"cd c #4C4C68", -"ce c #20204A", -"cf c #2E2E5B", -"cg c #29294C", -"ch c #242451", -"ci c #27274A", -"cj c #343464", -"ck c #252548", -"cl c #16162C", -"cm c #292938", -"cn c #333384", -"co c #3C3C6F", -"cp c #353572", -"cq c #1E1E37", -"cr c #38386B", -"cs c #414156", -"ct c #242454", -"cu c #31316E", -"cv c #181831", -"cw c #232349", -"cx c #272739", -"cy c #4C4C85", -"cz c #2F2F83", -"d` c #28285B", -"da c #292952", -"db c #48486D", -"dc c #23234C", -"dd c #37377A", -"de c #1E1E3D", -"df c #26265C", -"dg c #313174", -"dh c #4C4C60", -"di c #27273F", -"dj c #3C3C78", -"dk c #48485C", -"dl c white", -"dm c #383874", -"dn c #333379", -"do c #444458", -"dp c #272756", -"dq c #1B1B33", -"dr c #1E1E2C", -"ds c #30306C", -"dt c #40407F", -"du c #292944", -"dv c #212150", -"dw c #23233E", -"dx c #343473", -"dy c #323271", -"dz c #2D2D76", -"e` c #2E2E6D", -"ea c #40406E", -"eb c #21213F", -"ec c #8080BA", -"ed c #23232D", -"ee c #25255A", -"ef c #35356D", -"eg c #191937", -"eh c #262651", -"ei c #313169", -"ej c #2C2C6E", -"ek c #22224D", -"el c #18182C", -"em c #373786", -"en c #2D2D65", -"eo c #232344", -"ep c #2B2B63", -"eq c #292961", -"er c #27275F", -"es c #1C1C33", -"et c #242452", -"eu c #45456F", -"ev c #484868", -"ew c #1F1F43", -"ex c #2C2C5D", -"ey c #3535DD", -"ez c #262657", -"f` c #393963", -"fa c #242455", -/* pixels */ -"``````````````````dkdhbjbjbjbjdh````````````````", -"``````````````csasascdevcdascddbevdh````````````", -"``````````dodobfa`dbeubfeueueacrbfbfcsax````````", -"````````bzcsbwf`bwcrbicobteccratcof`bmbzbz``````", -"```````n`navavanefcjbibt`zcrcobicratccf``nax````", -"``````acbbao`oat`fambycobtdldjbkbialan`can`n````", -"````dicg`icj`fbi`fefdyauarabbybiefbnaicfbbcg`x``", -"````ac`udcbqenbk`tdyabczdgdxdmdtbpcpcjeicwcgcq``", -"```wdq`acfaiefcpe`bydn`hcyeydmc`ambcef`fcf`u`y`s", -"```ydudaandfbnaubvdgerbhdd`h`pdyc`cu`tezcf`b`ubl", -"``elad`abqezbndmdsbccncnczeydnbvdmdxamep`fcgcv`w", -"```weoetdv`leidfdd`gbddzdzdncncneqeebpexan`ucvap", -"``elcwdaexehd`epaubd`hdz`hcz`gdycucueeba`oekcl`w", -"``eldebsdcbxfaeedmejcuemdtcnbdbyalafambuet`bdq`w", -"```yclakboce`fbx`mcper`veccyauei`mbncbaqdpdaesap", -"````clakegbsceetbxdsdjdt`zbt`tctajdvafahakayel``", -"````eldqdeebetboenepetezbnbxencb`lbaeteoaabldr``", -"``````blakb`ceetekambxctbbafezctdcbo`eew`xcq````", -"``````ed`qakbsawekchchchetd``jboceaddwcxesed````", -"````````cmazag`xdcek`bchctetbrci`deocqbg`q``````", -"```````````qbgayckaybr`uacek`beo`x`xazca````````", -"``````````````aecxdi`kagacag`xcxcxcm````````````", -"``````````````````ca`rcmbebebeae````````````````", -"````````````````````````````````````````````````" -}; -/* XPM */ -static char *glass6[] = { -/* width height ncolors chars_per_pixel */ -"30 30 181 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #3535A1", -"`h c #23234D", -"`i c #29293F", -"`j c #2C2C63", -"`k c #2A2A61", -"`l c #33334C", -"`m c #353579", -"`n c #272754", -"`o c #20202C", -"`p c #2E2E3D", -"`q c #1C1C28", -"`r c #2E2E68", -"`s c #242447", -"`t c #2C2C66", -"`u c #222245", -"`v c #181824", -"`w c #25253E", -"`x c #161622", -"`y c #B9B9ED", -"`z c #3E3E67", -"a` c #1C1C3F", -"aa c #6767A3", -"ab c #2B2B47", -"ac c #272743", -"ad c #292931", -"ae c #29295C", -"af c #1D1D39", -"ag c #252544", -"ah c #1E1E47", -"ai c #2B2B61", -"aj c #29295F", -"ak c #1F1F3E", -"al c #2F2F68", -"am c #2D2D66", -"an c #30305F", -"ao c #2C2C5B", -"ap c #11111C", -"aq c #262655", -"ar c #31316D", -"as c #4C4C6D", -"at c #222251", -"au c #323264", -"av c #2D2D69", -"aw c #33335B", -"ax c #43436E", -"ay c #2B2B67", -"az c #212146", -"b` c #37374B", -"ba c #22223D", -"bb c #252536", -"bc c #1D1D42", -"bd c #28285A", -"be c #2B2B53", -"bf c #333372", -"bg c #2F2F6E", -"bh c #2C2C36", -"bi c #424266", -"bj c #232337", -"bk c #2F2FB0", -"bl c #34346C", -"bm c #525265", -"bn c #32326A", -"bo c #1B1B2F", -"bp c #3B3B55", -"bq c #303068", -"br c #21214C", -"bs c #2C2C64", -"bt c #292957", -"bu c #232351", -"bv c #26264A", -"bw c #2F2F60", -"bx c #202044", -"by c #5D5D97", -"bz c #2B2B5C", -"c` c #363674", -"ca c #3C3C66", -"cb c #252556", -"cc c #30306E", -"cd c #3E3E54", -"ce c #414178", -"cf c #2C2C6A", -"cg c #2F2F4F", -"ch c #25252E", -"ci c #27275B", -"cj c #363663", -"ck c #4C4C68", -"cl c #20204A", -"cm c #2E2E5B", -"cn c #29294C", -"co c #242451", -"cp c #27274A", -"cq c #343464", -"cr c #4F4F64", -"cs c #252548", -"ct c #16162C", -"cu c #292938", -"cv c #333384", -"cw c #3C3C6F", -"cx c #353572", -"cy c #1E1E37", -"cz c #38386B", -"d` c #414156", -"da c #242454", -"db c #31316E", -"dc c #181831", -"dd c #232349", -"de c #272739", -"df c #393979", -"dg c #4C4C85", -"dh c #2F2F83", -"di c #28285B", -"dj c #292952", -"dk c #36366C", -"dl c #48486D", -"dm c #23234C", -"dn c #37377A", -"do c #20203F", -"dp c #1E1E3D", -"dq c #26265C", -"dr c #313174", -"ds c #4C4C60", -"dt c #27273F", -"du c #3C3C78", -"dv c #48485C", -"dw c white", -"dx c #383874", -"dy c #333379", -"dz c #444458", -"e` c #272756", -"ea c #47477C", -"eb c #32326E", -"ec c #1E1E2C", -"ed c #30306C", -"ee c #40407F", -"ef c #292944", -"eg c #212150", -"eh c #23233E", -"ei c #141422", -"ej c #343473", -"ek c #323271", -"el c #2D2D76", -"em c #2E2E6D", -"en c #40406E", -"eo c #21213F", -"ep c #272731", -"eq c #8080BA", -"er c #23232D", -"es c #25255A", -"et c #1B1B39", -"eu c #35356D", -"ev c #191937", -"ew c #262651", -"ex c #313169", -"ey c #2C2C6E", -"ez c #22224D", -"f` c #18182C", -"fa c #373786", -"fb c #2D2D65", -"fc c #232344", -"fd c #2B2B63", -"fe c #292961", -"ff c #27275F", -"fg c #202037", -"fh c #1C1C33", -"fi c #242452", -"fj c #45456F", -"fk c #484868", -"fl c #535380", -"fm c #1F1F43", -"fn c #2C2C5D", -"fo c #353573", -"fp c #262657", -"fq c #393963", -"fr c #242455", -/* pixels */ -"````````````````````````bmbmbmbmbmbmbm``````````````````````", -"``````````````````dscrasasascrckasasasfkckbm````````````````", -"````````````````dsdsdzbifjfjfjfjaxaxfjfjckdzdv``````````````", -"````````````d`dvfqdzenfkfjencaendlaxaxcabibi`zdvb```````````", -"``````````cd`zaw`cfqcacaceflczbydg`zencjcwca`cbpbpcd````````", -"````````d`cdb``cawcqczdkeubycwbyczdwcwczcqaucaawb`b`b```````", -"````````b``lcmcqaoczaublbndgeqdfeqczdgbn`jcmanfnawcg`l``````", -"``````cu`w`wcmcmcqblardxeu`yceareqdueualbleuexdjcmbeba`p````", -"````chabcg`acmbwbqczaiebcfdfdgekeqdudxebcxblbncmcm`ababjer``", -"`````o`aeodmaobdalbn`rcfdf`mdhdrdyeaejdubscxffbwbwdd`b`w`q``", -"````fhbadjcmbq`jcxcxekemeydr`gdy`geeekek`t`rexe`e``ndjdcdc``", -"```q`veocnbtdialbleb`rfo`medfadnelbkc`bffeedeufn`jcmfmbvfg`x", -"``ecbo`sbze`feaeayexavbgej`gbkdyeydhdudnemdbfdal`kfna``udc`v", -"```xeieodjbtfpexfbc`avekbg`gbkelfa`g`gdxcxcfdxamfpbtcpfcdoap", -"```vcya`btegex`kbldqdncfeycvdyelcv`gdycvfefeebaedianfmfcdc`q", -"``fhcyetahfncobdbs`tbncfdybgcf`gdhcfavavav`tfraifnbtbteteoei", -"```xdpaz`bbtcl`fesfbedfdekelbkdhaaavbgcf`jfe`fesbwez`bbxdcei", -"```xfhdcbx`hfratbresfdedcfee`meedffded`t`tbqdiaee``nazazdcap", -"`````vdp`sew`bbqaifpfpdbbsccdxdfekbyee`j`jdialbzfidmazafct``", -"`````vbodpevbcaqbdatcb`tfdamar`ydg`taicbaje`dadaahaketevbo``", -"`````qf`bjakdobdezegfbaidacibncxdgbddiajalatfibz`ubccyfh`q``", -"``````chbjbcbcfmbdaediatcbfpfpajfpdaesfpbudmco`h`eewfhf`````", -"`````````ocydp`waz`e`baqfiesfpdjfpfiaidacpewah`wafdpbb``````", -"````````chfgfgfmddcofibdfi`bfi`ada`hegbu`h`seodtbafhec``````", -"``````````cuepdo`wefdmfidd`b`hdae``bbvcn`dagakbabj`o````````", -"````````````erbbdeefcsefcpabezcp`habef`sbx`wehbber``````````", -"````````````````chbbba`ief`iacagabef`i`wba`wcu``````````````", -"``````````````````chbb`p`p`w`w`pcu`p`icucuch````````````````", -"````````````````````````adadcudeepadbh``````````````````````", -"````````````````````````````````````````````````````````````" -}; -/* XPM */ -static char *glass7[] = { -/* width height ncolors chars_per_pixel */ -"36 36 187 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #272751", -"`j c #23234D", -"`k c #29293F", -"`l c #2C2C63", -"`m c #2A2A61", -"`n c #33334C", -"`o c #353579", -"`p c #272754", -"`q c #414188", -"`r c #20202C", -"`s c #2E2E3D", -"`t c #1C1C28", -"`u c #2E2E68", -"`v c #242447", -"`w c #2C2C66", -"`x c #222245", -"`y c #181824", -"`z c #25253E", -"a` c #161622", -"aa c #B9B9ED", -"ab c #3E3E67", -"ac c #1C1C3F", -"ad c #6767A3", -"ae c #2B2B47", -"af c #272743", -"ag c #222248", -"ah c #292931", -"ai c #29295C", -"aj c #1D1D39", -"ak c #252544", -"al c #1E1E47", -"am c #2B2B61", -"an c #29295F", -"ao c #1F1F3E", -"ap c #2F2F68", -"aq c #2D2D66", -"ar c #30305F", -"as c #2C2C5B", -"at c #11111C", -"au c #262655", -"av c #31316D", -"aw c #4C4C6D", -"ax c #222251", -"ay c #323264", -"az c #2D2D69", -"b` c #33335B", -"ba c #43436E", -"bb c #2B2B67", -"bc c #212146", -"bd c #37374B", -"be c #22223D", -"bf c #252536", -"bg c #1D1D42", -"bh c #2A2A5C", -"bi c #28285A", -"bj c #2B2B53", -"bk c #333372", -"bl c #2F2F6E", -"bm c #2B2B3F", -"bn c #2C2C36", -"bo c #424266", -"bp c #232337", -"bq c #2F2FB0", -"br c #34346C", -"bs c #525265", -"bt c #32326A", -"bu c #1B1B2F", -"bv c #3B3B55", -"bw c #303068", -"bx c #21214C", -"by c #2C2C64", -"bz c #292957", -"c` c #232351", -"ca c #26264A", -"cb c #2F2F60", -"cc c #202044", -"cd c #5D5D97", -"ce c #2B2B5C", -"cf c #363674", -"cg c #3C3C66", -"ch c #252556", -"ci c #30306E", -"cj c #3E3E54", -"ck c #414178", -"cl c #2C2C6A", -"cm c #2F2F4F", -"cn c #25252E", -"co c #27275B", -"cp c #363663", -"cq c #4C4C68", -"cr c #20204A", -"cs c #2E2E5B", -"ct c #29294C", -"cu c #242451", -"cv c #27274A", -"cw c #343464", -"cx c #4F4F64", -"cy c #252548", -"cz c #16162C", -"d` c #292938", -"da c #333384", -"db c #3C3C6F", -"dc c #353572", -"dd c #1E1E37", -"de c #38386B", -"df c #414156", -"dg c #242454", -"dh c #31316E", -"di c #181831", -"dj c #232349", -"dk c #272739", -"dl c #393979", -"dm c #4C4C85", -"dn c #2F2F83", -"do c #28285B", -"dp c #292952", -"dq c #48486D", -"dr c #23234C", -"ds c #37377A", -"dt c #1E1E3D", -"du c #26265C", -"dv c #313174", -"dw c #4C4C60", -"dx c #27273F", -"dy c #3C3C78", -"dz c #48485C", -"e` c white", -"ea c #383874", -"eb c #333379", -"ec c #444458", -"ed c #272756", -"ee c #47477C", -"ef c #32326E", -"eg c #1B1B33", -"eh c #1E1E2C", -"ei c #30306C", -"ej c #40407F", -"ek c #292944", -"el c #212150", -"em c #23233E", -"en c #141422", -"eo c #343473", -"ep c #323271", -"eq c #2D2D76", -"er c #2E2E6D", -"es c #40406E", -"et c #21213F", -"eu c #272731", -"ev c #8080BA", -"ew c #23232D", -"ex c #25255A", -"ey c #1B1B39", -"ez c #35356D", -"f` c #191937", -"fa c #262651", -"fb c #313169", -"fc c #2C2C6E", -"fd c #22224D", -"fe c #18182C", -"ff c #373786", -"fg c #2D2D65", -"fh c #232344", -"fi c #2B2B63", -"fj c #292961", -"fk c #27275F", -"fl c #202037", -"fm c #1C1C33", -"fn c #242452", -"fo c #45456F", -"fp c #484868", -"fq c #535380", -"fr c #1F1F43", -"fs c #2C2C5D", -"ft c #3535DD", -"fu c #353573", -"fv c #262657", -"fw c #393963", -"fx c #242455", -/* pixels */ -"````````````````````````````````bsbsbsdwbs``````````````````````````````", -"````````````````````````dwbsdwcqcxbscqdwcqcxdzcxbs``````````````````````", -"````````````````````fpcxawcqawcqawawcqawfocqcqawfpcqcx``````````````````", -"``````````````````ececfpfpbofodqdqdqesbababadqfobafpeccj````````````````", -"``````````````dfeccjabcgesbobaabadcgabbaeefobaesbob`cgdfcjcj````````````", -"````````````cjdfbvcgfwfwcgcgesbrevdbcdeeesdedbfwdbcgcpbvbvdfcj``````````", -"``````````bdbvbvcg`ccpcwdecwayckcdeecddydcbrezdecpayfwb`ar`ncjbd````````", -"```````````saecmcscpcscwbwaqayeaevfqdyckbtdefbcpeicscbcscpb`cmae````````", -"`````````scvbjcmar`pcsfb`fbt`fcidmdecdcdefdyezaqbraz`farasasarek`s``````", -"``````bnaecmdjayb`fscsbwaqfbbwdyaacddheacdfudbfbbrbtfbaqbzcsdpafcmcn````", -"```````s`zbj`basfs`fbr`f`wdcepeqcfcdfue`dmdvcdbkbkbrfb`fbwbjcaaect`z````", -"`````taeaoccdrcsfdfgbwbr`ubb`oadebdndvebe`eadsejbyavfgcwbtcsdjbjaeddbf``", -"````eudidjbzdp`pbzbwbbefeperfjdabldadada`qcfdveofi`wfb`fay`ped`aeteg`k``", -"`````yflfadpcsfs`lbrdcav`wcfeoepdsda`qbqebdydsepfiaveabwbz`maybc`abufe``", -"````fmek`aararaiambwbyefcfcfbqfkeqejds`gft`qeofuclfkbw`ubibtcs`bcv`vfe``", -"```ydi`v`xdpbzamaxaqfkavererbkfffcfc`hdaeqdscffudcclbkfgapanayaodpczeg`t", -"``atbpao`adpbzdo`mfgbtepereperfcbqft`g`hffbqbkdlfucleiaqfbdg`bctfrfmfea`", -"```yetfh`xdpelfbfsfbaz`mdsci`gblffdneqftebda`hdafjfjfgbybwdgardr`xdia`at", -"``ateheycccredfsaxfgcibbeffjejdafc`g`heqblfjepclazazap`wfscbbz`jacfrflat", -"``atczey`v`afsacfsdgco`lbb`gebffereqft`qffdaer`wfgfifififjbzcu`i`adda`at", -"````a`dtcy`xdrcrexfxfvfgeabkbbdhffadejdndnblclepapdubhaqfvcefn`xdtegfe``", -"````a`dieybxfnbx`jfsfxfkfgfgdheoev`qdncdfcdlfjfi`wfiapcuchaubzaceydiat``", -"````atdifr`abz`bbzbranaifneifufidyckejepckffepfibyaianancu`bbgbgagegen``", -"````atczegeyf`bgascrcrelchanefdyfieaaa`qaq`uexduanbhfxaicecraoemajfea```", -"```````tfebedtccaled`dcoaqdoamdeaiandydyaifi`mfbaqfdfnbh`pagfrddfmfe````", -"```````t`reydidjagbzaxchanfnaianchch`lbhcoaichauc`chdoelbgbgbcegfm`r````", -"`````````reyaoacetcrfn`afd`ffvchc`fvbjaianfvco`bdrdgbz`e`vbe`zeyeg``````", -"```````````regacem`vccfnbxc`cu`jbifnfvcoc`bi`ich`adjac`xflajemew````````", -"``````````ewbpbpdtaobcbc`jchbic``ac``afafafnfd`jfncybcdxdkbedd`r````````", -"````````````d`ddbeakfh`kdrfd`b`b`jcudged`bcacvct`dcyccddewd``r``````````", -"``````````````eubndddxdxakaecvcaae`ecaagaecvafcabcfhbp`keucn````````````", -"``````````````````d`flem`z`s`v`kbc`bekaeagaeetafekd`bmbf````````````````", -"`````````````````````s`zdk`zae`kdxakaeekek`zekbfdkd`bn``````````````````", -"````````````````````````bnbmd`dkdk`sbndxd`bmbfbnah``````````````````````", -"````````````````````````````````cnbneu`sah``````````````````````````````", -"````````````````````````````````````````````````````````````````````````" -}; -/* XPM */ -static char *glass8[] = { -/* width height ncolors chars_per_pixel */ -"44 44 189 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #272751", -"`j c #23234D", -"`k c #29293F", -"`l c #2C2C63", -"`m c #2A2A61", -"`n c #33334C", -"`o c #353579", -"`p c #272754", -"`q c #414188", -"`r c #20202C", -"`s c #2E2E3D", -"`t c #1C1C28", -"`u c #2E2E68", -"`v c #242447", -"`w c #2C2C66", -"`x c #222245", -"`y c #181824", -"`z c #25253E", -"a` c #161622", -"aa c #B9B9ED", -"ab c #3E3E67", -"ac c #1C1C3F", -"ad c #6767A3", -"ae c #2B2B47", -"af c #272743", -"ag c #222248", -"ah c #292931", -"ai c #29295C", -"aj c #1D1D39", -"ak c #252544", -"al c #1E1E47", -"am c #2B2B61", -"an c #29295F", -"ao c #1F1F3E", -"ap c #2F2F68", -"aq c #2D2D66", -"ar c #30305F", -"as c #2C2C5B", -"at c #11111C", -"au c #262655", -"av c #31316D", -"aw c #4C4C6D", -"ax c #222251", -"ay c #323264", -"az c #2D2D69", -"b` c #33335B", -"ba c #43436E", -"bb c #2B2B67", -"bc c #212146", -"bd c #37374B", -"be c #22223D", -"bf c #252536", -"bg c #1D1D42", -"bh c #2A2A5C", -"bi c #28285A", -"bj c #2B2B53", -"bk c #333372", -"bl c #2F2F6E", -"bm c #2B2B3F", -"bn c #2C2C36", -"bo c #424266", -"bp c #232337", -"bq c #2F2FB0", -"br c #34346C", -"bs c #525265", -"bt c #32326A", -"bu c #1B1B2F", -"bv c #3B3B55", -"bw c #303068", -"bx c #21214C", -"by c #2C2C64", -"bz c #292957", -"c` c #232351", -"ca c #26264A", -"cb c #2F2F60", -"cc c #202044", -"cd c #5D5D97", -"ce c #2B2B5C", -"cf c #363674", -"cg c #3C3C66", -"ch c #252556", -"ci c #30306E", -"cj c #3E3E54", -"ck c #414178", -"cl c #2C2C6A", -"cm c #2F2F4F", -"cn c #25252E", -"co c #27275B", -"cp c #363663", -"cq c #4C4C68", -"cr c #20204A", -"cs c #2E2E5B", -"ct c #29294C", -"cu c #242451", -"cv c #27274A", -"cw c #343464", -"cx c #4F4F64", -"cy c #252548", -"cz c #16162C", -"d` c #292938", -"da c #333384", -"db c #3C3C6F", -"dc c #353572", -"dd c #1E1E37", -"de c #38386B", -"df c #414156", -"dg c #242454", -"dh c #31316E", -"di c #181831", -"dj c #232349", -"dk c #272739", -"dl c #393979", -"dm c #4C4C85", -"dn c #2F2F83", -"do c #28285B", -"dp c #292952", -"dq c #36366C", -"dr c #48486D", -"ds c #23234C", -"dt c #37377A", -"du c #20203F", -"dv c #1E1E3D", -"dw c #26265C", -"dx c #313174", -"dy c #4C4C60", -"dz c #27273F", -"e` c #3C3C78", -"ea c #48485C", -"eb c white", -"ec c #383874", -"ed c #333379", -"ee c #444458", -"ef c #272756", -"eg c #47477C", -"eh c #32326E", -"ei c #1B1B33", -"ej c #1E1E2C", -"ek c #30306C", -"el c #40407F", -"em c #292944", -"en c #212150", -"eo c #23233E", -"ep c #141422", -"eq c #343473", -"er c #323271", -"es c #2D2D76", -"et c #2E2E6D", -"eu c #40406E", -"ev c #21213F", -"ew c #272731", -"ex c #8080BA", -"ey c #23232D", -"ez c #25255A", -"f` c #1B1B39", -"fa c #35356D", -"fb c #191937", -"fc c #262651", -"fd c #313169", -"fe c #2C2C6E", -"ff c #22224D", -"fg c #18182C", -"fh c #373786", -"fi c #2D2D65", -"fj c #232344", -"fk c #2B2B63", -"fl c #292961", -"fm c #27275F", -"fn c #202037", -"fo c #1C1C33", -"fp c #242452", -"fq c #45456F", -"fr c #484868", -"fs c #535380", -"ft c #1F1F43", -"fu c #2C2C5D", -"fv c #3535DD", -"fw c #353573", -"fx c #262657", -"fy c #393963", -"fz c #242455", -/* pixels */ -"````````````````````````````````````````````bs``````````````````````````````````````````", -"````````````````````````````````dybseabsawbsbscxawcxbsdybs``````````````````````````````", -"````````````````````````````eedycqcqcqdrcxawcqawawawawfrfrcxcq``````````````````````````", -"````````````````````````eadyfrdybafrfqawawfqdrawawfrfrdrawcqeaeeee``````````````````````", -"````````````````````eeeebofrboawbofqdrbadrfqeufqfqbababafqfrbobobocjee``````````````````", -"``````````````````dfeebvfybvcgbaboeueueueuababfqdefqegeuabeufybocgdfeacj````````````````", -"````````````````bvbo`nfydffybocgcgdedbegfsfqeuegexeudbdqdedbdeabfybvcjdfcj``````````````", -"``````````````bdcjbvfyfyb`defyfydedbckexexebckdmaqdbdbdbayaydeaycpbvab`ccjbd````````````", -"`````````````s`ccjb`b`b`b`ardededeaydcexadckaddbdbaadqdqbrbtbrayb`cpb``c`ccm`n``````````", -"```````````n`n`ncmcsb`cpascpegfi`ucwbrcdcdebehaddbbrdmfaayaqcbb`arcscs`ccmb`ae`s````````", -"``````````aeafcmaeasfu`paraycbbtfd`lavecckegcdcdaaec`qfa`ufa`f`ubwarbzb`cscs`kbm````````", -"````````ewaectfjbzcsb`arcwbtdcapec`fdcaadmcd`ueqaddmekecav`fapbtecbwdparbjcmaoct`n``````", -"````````bddzcmbjdparcscb`fdbfdfidcdlcieqbbdlciebexeletegbwbk`ubtbwfufucsdpcm`zctbm``````", -"```````ycmdjdpctauaramefcsbwapehekereddleledcfdmdmdmerelecaqaqbrehcbbzarfc`vbjcyem`r````", -"``````bpaobefjccbzasenbw`ufafdblcl`oeldldnbqededdtcdbkdldlet`lekamcbbw`fbjauctdp`zfn````", -"`````yfoaj`bbzeodsfibhbrekavcfcletfldneddxeddadtdadmbkerercleh`ubwbwcbbzarbhdpfjdiei`t``", -"````atfoemfcdpbzasfi`ffadcekbkazeqerbkerdadtdmfhbqdldleddxfkfdapdcfdfcam`pbz`e`ifoepa```", -"````a`dd`v`bbzbjefdw`lbwbtehdceccf`hfeerbqfhedesbqfvdlcifwcifldhbrficbficsefcc`v`xajbp``", -"````fnfgeo`vfubzbwdwco`ufm`m`ucfbler`ofh`hfveddndnbqdldldtcffmbkbwapbwaiefaybgctczfgei``", -"`````yczacaodpbjayfxcobwapbkehdhblerdtdnfe`hbqfhbqfedtcfeqecaqeqbwfiapanbhbr`zdjbcaofo``", -"````atczf``bbzbzbhax`laqbwaqdhciblfeclfhfhdafmbqdabqdacidldtdhflcf`wby`fauef`vccakev`y``", -"``ata`fnagccbzenbhfiaifdehezdhdlet`geteddnbqesfvedbqesdndabbfmfmbtbyamfufuasbcccdidiepat", -"````fgfgao`dbg`e`falcobwfkfmdh`o`gcidnesdn`gdabqed`geteretblekazfk`u`fdocb`j`abgf`ev`y``", -"`````yeicv`v`b`pamfcbhfxfidwetazazdx`q`heted`qfveder`get`wciekehchcodgbhffefeffcczbu`y``", -"````epdvfjfj`acubzenanbifxbyaqci`w`gereleddnesehdnazdxbkcl`wfmfm`f`lfmayenau`bfceidia```", -"`````ybuev`xcc`j`pfzaxau`jezekcferblcifhfhdmdmdldtfmblekdhekaq`fbififzbzftbidudvdifgbu``", -"````atfgfoaobgal`pc`auamaxcoekapdcfwaqe`edeldnele`ekelfm`manapaqficubi`pdjfcacf`bgdvep``", -"`````ya`f`ag`bdpasbcfubraibifmfmdhcfanekdcdmdtdhflexblcifkbyfiaifian`pau`pagbgbceicza```", -"``````epdif`dubcefbgauenaxfmco`f`mecekfied`uavexfkbbaqfmdwanapcubifxffbgacftbef`di`y````", -"``````a`czbuf`ddddbcfffcfcdgdoancofdezbwecfkap`wehaifmbtfiandwaxenbibzagf`ccbpaj`t`y````", -"`````````yfoeyaceoevenfpffbx`mam`mbifpdwchapehaicocoamaibibtezfxdgfxeffjccfpeiddfg``````", -"````````ej`rdidvaobzalbzfp`mauchfpfkezfkau`f`fdechchchfzbic`axbxfpauff`ebg`pejej`t``````", -"```````````tf`f`ajal`zcrfpendsffaycochfzdgfzbjcoancofpdo`ben`affce`edjbcbebef`di````````", -"```````````t`rf`dvaoeobcdu`ece`bfpencucofxbic`auc`dgficuef`bbxffbg`ebedddvaobfew````````", -"````````````cnejbpaodvftdj`jcr`pcoen`j`jcu`ifcbifx`jc``jen`bbx`vccbe`z`zddddcn``````````", -"``````````````ewbpddfbddaccycr`dfp`jfpca`jcu`dc`cacv`dff`d`d`x`dft`z`zbeejcn````````````", -"````````````````fgfneoduembmfj`vag`act`bds`ac``j`j`acv`bbcagak`xdudvbpcn`t``````````````", -"``````````````````ewd`fnaeakemcyaecvdjaeaecrcvdsakaeakafcy`jao`zfnd`cn`t````````````````", -"````````````````````d`dkfndzd``zbm`v`k`b`ecvemaeca`vaedudz`zafew`kbfey``````````````````", -"````````````````````````bfdkd`dz`kafdzae`vemcyafakakaedzdzbed`dkcn``````````````````````", -"````````````````````````````ahdkbnbnbm`z`sdk`s`zd`bm`safd`bn`s``````````````````````````", -"````````````````````````````````bnbn`sd`d`dk`sbmbnah`s`sah``````````````````````````````", -"````````````````````````````````````````````cn``````````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````" -}; -/* XPM */ -static char *glass9[] = { -/* width height ncolors chars_per_pixel */ -"50 50 188 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #272751", -"`j c #23234D", -"`k c #29293F", -"`l c #2C2C63", -"`m c #2A2A61", -"`n c #33334C", -"`o c #353579", -"`p c #272754", -"`q c #414188", -"`r c #20202C", -"`s c #2E2E3D", -"`t c #1C1C28", -"`u c #2E2E68", -"`v c #242447", -"`w c #2C2C66", -"`x c #222245", -"`y c #181824", -"`z c #25253E", -"a` c #161622", -"aa c #B9B9ED", -"ab c #3E3E67", -"ac c #1C1C3F", -"ad c #6767A3", -"ae c #2B2B47", -"af c #272743", -"ag c #222248", -"ah c #292931", -"ai c #29295C", -"aj c #1D1D39", -"ak c #252544", -"al c #1E1E47", -"am c #2B2B61", -"an c #29295F", -"ao c #1F1F3E", -"ap c #2F2F68", -"aq c #2D2D66", -"ar c #30305F", -"as c #2C2C5B", -"at c #11111C", -"au c #262655", -"av c #31316D", -"aw c #4C4C6D", -"ax c #222251", -"ay c #323264", -"az c #2D2D69", -"b` c #33335B", -"ba c #43436E", -"bb c #2B2B67", -"bc c #212146", -"bd c #37374B", -"be c #22223D", -"bf c #252536", -"bg c #1D1D42", -"bh c #2A2A5C", -"bi c #28285A", -"bj c #2B2B53", -"bk c #333372", -"bl c #2F2F6E", -"bm c #2B2B3F", -"bn c #2C2C36", -"bo c #424266", -"bp c #232337", -"bq c #2F2FB0", -"br c #34346C", -"bs c #525265", -"bt c #32326A", -"bu c #1B1B2F", -"bv c #3B3B55", -"bw c #303068", -"bx c #21214C", -"by c #292957", -"bz c #232351", -"c` c #26264A", -"ca c #2F2F60", -"cb c #202044", -"cc c #5D5D97", -"cd c #2B2B5C", -"ce c #363674", -"cf c #3C3C66", -"cg c #252556", -"ch c #30306E", -"ci c #3E3E54", -"cj c #414178", -"ck c #2C2C6A", -"cl c #2F2F4F", -"cm c #25252E", -"cn c #27275B", -"co c #363663", -"cp c #4C4C68", -"cq c #20204A", -"cr c #2E2E5B", -"cs c #29294C", -"ct c #242451", -"cu c #27274A", -"cv c #343464", -"cw c #4F4F64", -"cx c #252548", -"cy c #16162C", -"cz c #292938", -"d` c #333384", -"da c #3C3C6F", -"db c #353572", -"dc c #1E1E37", -"dd c #38386B", -"de c #414156", -"df c #242454", -"dg c #31316E", -"dh c #181831", -"di c #232349", -"dj c #272739", -"dk c #393979", -"dl c #4C4C85", -"dm c #2F2F83", -"dn c #28285B", -"do c #292952", -"dp c #36366C", -"dq c #48486D", -"dr c #23234C", -"ds c #37377A", -"dt c #20203F", -"du c #1E1E3D", -"dv c #26265C", -"dw c #313174", -"dx c #4C4C60", -"dy c #27273F", -"dz c #3C3C78", -"e` c #48485C", -"ea c white", -"eb c #383874", -"ec c #333379", -"ed c #444458", -"ee c #272756", -"ef c #47477C", -"eg c #32326E", -"eh c #1B1B33", -"ei c #1E1E2C", -"ej c #30306C", -"ek c #40407F", -"el c #292944", -"em c #212150", -"en c #23233E", -"eo c #141422", -"ep c #343473", -"eq c #323271", -"er c #2D2D76", -"es c #2E2E6D", -"et c #40406E", -"eu c #21213F", -"ev c #272731", -"ew c #8080BA", -"ex c #23232D", -"ey c #25255A", -"ez c #1B1B39", -"f` c #35356D", -"fa c #191937", -"fb c #262651", -"fc c #313169", -"fd c #2C2C6E", -"fe c #22224D", -"ff c #18182C", -"fg c #373786", -"fh c #2D2D65", -"fi c #232344", -"fj c #2B2B63", -"fk c #292961", -"fl c #27275F", -"fm c #202037", -"fn c #1C1C33", -"fo c #242452", -"fp c #45456F", -"fq c #484868", -"fr c #535380", -"fs c #1F1F43", -"ft c #2C2C5D", -"fu c #3535DD", -"fv c #353573", -"fw c #262657", -"fx c #393963", -"fy c #242455", -/* pixels */ -"````````````````````````````````````````````````````````````````````````````````````````````````````", -"``````````````````````````````````````e`bscwbscwbsbsbsbsbsbsbscw````````````````````````````````````", -"````````````````````````````````bse`bscpbse`awawcwbsbsdqawawbsdxdxcwcw``````````````````````````````", -"````````````````````````````e`eddxfqcwcpfqfqawawdqawdqawawfqcwawawfqfqe`cw``````````````````````````", -"````````````````````````cie`e`dxfqboboawfpfpdqfpbafpawfpdqbofpabdqfqfqedcfdee```````````````````````", -"``````````````````````edede`cifqbodqabfpfpbabobaccbabafpbaddbaetfpfqabbobobodee`````````````````````", -"````````````````````deedbvbvfxfxcfetboetfpcfewetddetetdaefetbaetabetbofxabcfedcici``````````````````", -"``````````````````bdedbd`cabdefxababfxddetddcccjefbacjeaetddddcfdpdaddababb``cdeedde````````````````", -"````````````````bvbdbvfx`cb`fxcfcffxdddaddefccaaeaefewbwdldadaddcoayddcvcfb``cbvbdbvci``````````````", -"```````````````s`cbvbdb`b`b`cocvdddaddayf`braadlfrccdldzewdddaebddfcbwayfxcfb``cbd`cbd`s````````````", -"````````````bd`sclclbjb`crb`arcofr`ubtbtfcdkaaewewdlcjdabtdabtcvddebayaycadoarb``c`n`ncl`s``````````", -"``````````bdbv`c`ccub`b`b`ascrdp`fcadzaqbwfjebcjeaccewaaccdlfrdlegbw`f`lcab`crcrcrclclelbpbd````````", -"``````````bnbmcuclclcrb``pararcv`ff`fcegf`dzewcjcjeqdleabkavf`fc`mbrcaegfcaycabjararcrae`sbm````````", -"````````evaedycragcacvb`apcrasbwf``faybtavekewaddleqdkccccdkbrdzfcavapbrfhf`biascac`bjcuel`kbf``````", -"````````aeae`vcldo`acrcacr`fbtddaqapebceckbleqdzdseqaaadekdwebdkavceapbrbt`fftamcrbybjaeclbpbp``````", -"```````rfnbeakdocubzarfw`faiarbraqegejbkcheqeqekd``oefekewdzchekbkaqfhbtbkapcrcacr`j`vdocbbpfn`t````", -"``````cz`zdoakbccbbyasdr`fap`uf`fcejck`obkdl`odmfudwecdwaadzbkdzdbaz`legaqftar`fcadofbdobjafdccm````", -"``````bfehdc`aeefifbftaiambw`gavbkblck`gckd`eqecec`hfgd`addsepbkfvfkapazavf`fw`fbycrcd`a`vehbubp````", -"`````tbuehdyfbasdocaapayayebebbteq`geqchfvdwecbqdkaddsfudwdzbkckdwfjbrapf`bwf`byfwbyasdr`iezbucy`t``", -"`````yfnfieu`bdi`abydn`mfcf`f`egdbavdbec`odwcefgecdsd`dmbqepceeqf`az`wejdbbrambi`lcdft`bcbc``va`ei``", -"````a`eoenfifsaycrbyfl`mfc`uan`webceebdmer`gdwbqdsdsdmdmbqekdkeccechckfkejegfhbiftarby`a`v`vfiffbu``", -"````fmcycxdidt`iardpdnemanavflejazeqesepcefgblerfud`fgfderfgdkdsdkdzfkeqbkapapbt`lctfceuas`vcydhfn``", -"````ehdheudtagbybjcabidnapapfcebejblchcheqer`hbqbqerbqfufgecdsebcedkbkbleqf`fjambicaaycu`vcxa`du`y``", -"````fnfndhdtbgdobybifocnbwameqckdgeqeqfdesfdfgfgdwflfddmfufudwch`odschflejebdvayby`pee`vcbacfndcbu``", -"````bube`vacfe`iembyfc`f`ufc`wdveqdkeqflfddwfudm`her`hd`fgbqecd`ecbbflfkfjapdvbwdnftas`jfifieh`yeo``", -"````ffehdhdhdrcqalft`jembtai`wfkdg`obbesbldmfddm`gecfud`dmbbdw`ochbl`ufkap`weganaiar`j`j`ddu`adhff``", -"````ffdcdrdtbj`a`pfhfebibh`legfkesapaqeq`obqbqfddkfu`hd`dwfkchdw`wcheq`ufjemfyaucdby`peectduezdhbu``", -"`````tfadhag`v`iee`fcqfweefleyanaqfjazazebfg`g`qfu`hadcher`q`h`gazdwaibbap`lfw`waybxct`aagcbeueofn``", -"````eoa`ffcbfididr`eaxeybzbhcgaqepdlbkckazeqds`qfueqfdblefeqdzchdg`wfheyamey`laibyalbiagdraodheheo``", -"````at`ydhdh`dfsal`pfyalfyemeyey`waqdgazckepbkdw`qekepecfjdmejflazfj`ubw`lbiftaxee`beecbcbbcdu`ta```", -"````a`a`a`ficbalcqeeauct`fcgdffyflejapds`wefdleradewegaaegeseqbr`lfl`u`megamamctfb`vfebc`deudceoat``", -"``````eofffacb`abyftcbbybtfcanfwaidvapepap`wegazdzdlek`uerfgepdgfj`laqdncn`mbyfoct`p`vbgacezdhbu````", -"```````yffdhfsficbeealbybxbiemcncnamflch`u`uccew`udgdlf``wdldbcgflanbweefycnaxeeacezfsdyfmdh`y`t````", -"```````teoeiezajdcdc`ealeeai`jaxaiamcgavaiew`ucc`w`mandzanebflfcamfldvbiemdffw`pfeezcbdcbpeh`yeo````", -"`````````tfffffmaoakdtalamfbdremfjamaiaidffraiddegdbfhancnbrdn`mamegfwaxfocgftct`x`efeezeifn`t``````", -"````````ex`tehbeezdubydialcdaxcnbidndfbhfwbweydf`mandfcgdvananfyfofycncgcnaxfoacbg`e`pfadueiex``````", -"```````````rbufndcajacfscbbycqfofodnaifhfyai`paxcnfweyddcg`pcgfwfofedifeaxbyalfs`j`kduehfmfm````````", -"```````````yeifndhbefsao`vaxbxbxcsfebyfwbzfybidfcgbjfwaidnambibybzbx`afocdbc`vfidtezajbueha`````````", -"`````````````y`r`rezduaocxficb`jfw`abz`jct`jdnfwbzfwdnaufofofw`afo`i`ddiducb`zdudcezdu`rex``````````", -"``````````````evbudjfmajcbagbcctbcfwcgaufoct`afofb`afodf`jbzemfobx`dfe`val`xczdjbebpdccm````````````", -"````````````````evcmezfneufsaoelcqcxctfeaufecsfectbxbzfeae`b`jdrc``b`x`ecb`zbpfmfmeiev``````````````", -"``````````````````ffbubpfiafafbmbc`vag`bc`csdr`j`bct`jfefbcxcx`j`xdificxacbeenbfev`t````````````````", -"````````````````````cmczczdy`zak`kcucucudrcuaecxc`cxdrcxaeelak`vc``jajakbpafbfbf`r``````````````````", -"``````````````````````cmczbpdjdc`kcxelaoelakagbc`aaeel`bbxakakeu`zdtbm`zdjbpevbf````````````````````", -"````````````````````````cmbfeibfbmeuel`kelelafelelakaeelaf`k`k`zdjbebm`zbncmah``````````````````````", -"````````````````````````````czbnczbp`zafbmaedyafelbmdy`zdybeczdjczbf`kbpex``````````````````````````", -"`````````````````````````````````sevdjbncz`zdj`sczcz`k`k`s`sdjbfahevbn``````````````````````````````", -"``````````````````````````````````````evah`sbncz`kev`sbnczbnczah````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````````````````" -}; -/* XPM */ -static char *glass10[] = { -/* width height ncolors chars_per_pixel */ -"60 60 189 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #272751", -"`j c #23234D", -"`k c #29293F", -"`l c #2C2C63", -"`m c #2A2A61", -"`n c #33334C", -"`o c #353579", -"`p c #272754", -"`q c #414188", -"`r c #20202C", -"`s c #2E2E3D", -"`t c #1C1C28", -"`u c #2E2E68", -"`v c #242447", -"`w c #2C2C66", -"`x c #222245", -"`y c #181824", -"`z c #25253E", -"a` c #161622", -"aa c #B9B9ED", -"ab c #3E3E67", -"ac c #1C1C3F", -"ad c #6767A3", -"ae c #2B2B47", -"af c #272743", -"ag c #222248", -"ah c #292931", -"ai c #29295C", -"aj c #1D1D39", -"ak c #252544", -"al c #1E1E47", -"am c #2B2B61", -"an c #29295F", -"ao c #1F1F3E", -"ap c #2F2F68", -"aq c #2D2D66", -"ar c #30305F", -"as c #2C2C5B", -"at c #11111C", -"au c #262655", -"av c #31316D", -"aw c #4C4C6D", -"ax c #222251", -"ay c #323264", -"az c #2D2D69", -"b` c #33335B", -"ba c #43436E", -"bb c #2B2B67", -"bc c #212146", -"bd c #37374B", -"be c #22223D", -"bf c #252536", -"bg c #1D1D42", -"bh c #2A2A5C", -"bi c #28285A", -"bj c #2B2B53", -"bk c #333372", -"bl c #2F2F6E", -"bm c #2B2B3F", -"bn c #2C2C36", -"bo c #424266", -"bp c #232337", -"bq c #2F2FB0", -"br c #34346C", -"bs c #525265", -"bt c #32326A", -"bu c #1B1B2F", -"bv c #3B3B55", -"bw c #303068", -"bx c #21214C", -"by c #2C2C64", -"bz c #292957", -"c` c #232351", -"ca c #26264A", -"cb c #2F2F60", -"cc c #202044", -"cd c #5D5D97", -"ce c #2B2B5C", -"cf c #363674", -"cg c #3C3C66", -"ch c #252556", -"ci c #30306E", -"cj c #3E3E54", -"ck c #414178", -"cl c #2C2C6A", -"cm c #2F2F4F", -"cn c #25252E", -"co c #27275B", -"cp c #363663", -"cq c #4C4C68", -"cr c #20204A", -"cs c #2E2E5B", -"ct c #29294C", -"cu c #242451", -"cv c #27274A", -"cw c #343464", -"cx c #4F4F64", -"cy c #252548", -"cz c #16162C", -"d` c #292938", -"da c #333384", -"db c #3C3C6F", -"dc c #353572", -"dd c #1E1E37", -"de c #38386B", -"df c #414156", -"dg c #242454", -"dh c #31316E", -"di c #181831", -"dj c #232349", -"dk c #272739", -"dl c #393979", -"dm c #4C4C85", -"dn c #2F2F83", -"do c #28285B", -"dp c #292952", -"dq c #36366C", -"dr c #48486D", -"ds c #23234C", -"dt c #37377A", -"du c #20203F", -"dv c #1E1E3D", -"dw c #26265C", -"dx c #313174", -"dy c #4C4C60", -"dz c #27273F", -"e` c #3C3C78", -"ea c #48485C", -"eb c white", -"ec c #383874", -"ed c #333379", -"ee c #444458", -"ef c #272756", -"eg c #47477C", -"eh c #32326E", -"ei c #1B1B33", -"ej c #1E1E2C", -"ek c #30306C", -"el c #40407F", -"em c #292944", -"en c #212150", -"eo c #23233E", -"ep c #141422", -"eq c #343473", -"er c #323271", -"es c #2D2D76", -"et c #2E2E6D", -"eu c #40406E", -"ev c #21213F", -"ew c #272731", -"ex c #8080BA", -"ey c #23232D", -"ez c #25255A", -"f` c #1B1B39", -"fa c #35356D", -"fb c #191937", -"fc c #262651", -"fd c #313169", -"fe c #2C2C6E", -"ff c #22224D", -"fg c #18182C", -"fh c #373786", -"fi c #2D2D65", -"fj c #232344", -"fk c #2B2B63", -"fl c #292961", -"fm c #27275F", -"fn c #202037", -"fo c #1C1C33", -"fp c #242452", -"fq c #45456F", -"fr c #484868", -"fs c #535380", -"ft c #1F1F43", -"fu c #2C2C5D", -"fv c #3535DD", -"fw c #353573", -"fx c #262657", -"fy c #393963", -"fz c #242455", -/* pixels */ -"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", -"````````````````````````````````````````````````bsbsbsbsbsbsbsbsbsbsbscxbs``````````````````````````````````````````````", -"``````````````````````````````````````````dycxdydycxawawawbsbsbsawcxcxcqdycxcxbs````````````````````````````````````````", -"````````````````````````````````````dyeacxfrawcqawfrawcqcxawcqawawawawawawfrfrcxcqeabs``````````````````````````````````", -"````````````````````````````````dfeadydyawcqawawfrcqawawdrawcqawawfqawcqcqfrawawfrdyeaeadf``````````````````````````````", -"``````````````````````````````eadyeadyfreedrboawfqfqfqdrfqeufqawbaawbabofqeufqdrcqfreeboeadf````````````````````````````", -"``````````````````````````dydffrbocjfrfrdrfrfrfqfqbabofrfqfsbaeubafqfqcgeubafqdrbaabbobobocjeedf````````````````````````", -"````````````````````````dfeeeadffyboeecgeufrfreufqeueueucgbaeubadrdbbacdbaeucgbabocpboboabboeaeebd``````````````````````", -"``````````````````````bdbdcjbd`cfyeefybaabcgfyeubaabdmfseudbdefsaackdbeudebaeudedebocgbofyfycjcjeecj````````````````````", -"````````````````````cjdfabbvb`cg`cfyfyfycgabcgdeckbrfscddecdcddmdmfsabdeeucwcpdbdbcgcgcp`cbvbvcjbvbdcj``````````````````", -"``````````````````bdbddfbv`ccgfyb`cgcgcpfycwdedbdbcdadcdexexckcd`u`uegdedbdbaycpaydecpcpb`bvfybvbdcj`s`s````````````````", -"````````````````dfbdcjbvbd`c`c`cb`cpcwcgdededqayfabrcdexdbcdcdcddeexebbrdbecdedqcwfdaycpcgarb`b`bd`cbd`sbd``````````````", -"```````````````sbdbd`n`ncmcscsarcscwcpdbbtbwbwbtbrfaebexegexaddbdeeceldqbrbrdqbtbkaybt`fbjcscpb`b``ncmctbdbd````````````", -"``````````````aebd`c`ncmcsb`cwayascsdebraybwbrfdbtazdmdeexaddladexckdedmdme`btay`lcbcscwarasfucpb`cmcmae`nbd````````````", -"`````````````saeeo`nbjcmcsarar`paycsbtcb`fbrbtfkfdciecdmdqebcdaacddmece`elbrazfabr`f`wbwbtarbzcsascsarbjbm`kbn``````````", -"``````````ewd`ae`z`c`zbjcsb`cscscwcwbrbravbtecbrfackaadmckexavciexdme`bkfabtapanbr`ffabtfdbtdpcscsbjbjdpbeae`s`s````````", -"``````````ahcm`kcm`bdparaycsay`fcscsfdbrfibwbtbrfdeqcd`qdmelbkeldmexdmeqdce`faerdcapbtbwfa`waucscscvdpdpafcmae`n````````", -"````````cncmaeakcmct`adpcsarcbcbbwdqdeapamdcehcfclbldlbldmeqeradexade`esecelehehdc`ubrbrbtfucsbhcsas`actbecmbpbpey``````", -"````````ejbpeo`vctcv`abzb`ef`ffxfucbbwapbldcdheqetesdlfwdmescfcddmdmdmbkbleldldhaq`ubrfabtcbcsbtcs`pcccycm`veobe`t``````", -"`````````rae`aajevdjdsasas`jbifiapbrbtav`uapclcfdlad`odndnfvdxededexegeceqe`e`cfbybydcbrfmcwcbfdcbbjdjca`bcv`zdd`t``````", -"``````ej`rbu`vcvcv`vcyfcbzefbz`f`uclapfderfeerclerdldlerdada`hedfhe`aacferdtcfciazapfk`ubramcbfuararbzfc`zaeaofo`t`r````", -"``````bpfodibedsdp`jcs`abwbh`lfadccidcecerclet`gfe`hdxdx`hededdt`hdaelcfereterer`wbk`ubtfdbtef`fefcb`paudpbcdiczdi`y````", -"``````ejddddemfcbjefcscs`faycedcececapciazcieqbldterdxdnbqelcdfhfv`h`oe`ererdnetfkfdekfabwbtfubifxfcar`affdpf``yepfo````", -"`````tej`ycyevcuctftbzefdoaiapaqbrbrehfw`udcfwda`oerekfhfhdxdtdaes`hbqfwcferbkehflfkekcffabwfuco`lbzcsbzftbccaevfneja```", -"````atddddem`xaocscsar`pdwdwfibwapbyapeccfdlcf`hdnfmbl`hfhdtdt`hclfvbq`qfhdxbkcfcl`gfkehfa`ufufpamaycsaydjcc`v`vfoepat``", -"````ejfgbucy`vccceaseffdfldgai`ubbfzfdazazcfblereqdt`hdnbq`hedbqfedndndte`dtdtdletfmdhehfkapapbt`mdgfubzacdp`xf`dicz`y``", -"````budddi`x`vevdpcsbzcwfxai`mapfdflfaavblercibkcffhcl`gfvfvfvdadaedclcfcfdteqecdcfkercfav`lbt`famchfdcsbe`bcaczfjbefg``", -"````a`buepccevcrdpbzbzcbfxbifdfififacfekazereretblfe`hfhbqesesdnfh`h`hbq`hfwecdldcerclavecaqaqfifxbhbzbzcv`xfjfodufnat``", -"````atepbufodualfcdp`lauauchfi`lapek`gcicieretfecl`gfhed`hesfm`gfefvfvfvdxbl`oederetfm`wdlfkfxaybzau`d`j`xduf`fgdufga```", -"`````yepddfjacccbz`benamfd`f`mfdbr`mdwcidtcfclfmfebldadneddnesdadadx`hdaededdaclflfmflfmehbyaiaydofuarasftccfjdidiei`t``", -"````a``yczczfbbcbc`bacficucraqfdanfkflaz`oehbbesbldndxfefefeesfvbqbqdnbbdtedciciazaqfkazaz`ubw`laicbas`pdjcccc`advddat``", -"````fo`yddccf`fcalcefucbcufpbi`fbyav`wazbt`ucldxed`hblescldn`hbqdndncl`gazedazazazfw`wekfzanameffucbbzbxbz`jf`fbevbuep``", -"````at`yfbaccy`a`bdsceaiffbzbichfi`manekaq`uclbkcffheletfvesfh`hesdx`qclci`gfkapap`wekapezanfzaifubxeffcfc`bdubufgepat``", -"````a`czdvf`bcdv`bffbzbicrax`fbiezcofifiekbkfk`geredeserbqdndndtadfhazcfblfecl`u`laiflaq`f`lez`ucbdgff`j`bdpccdddiepep``", -"````atczdidvaocy`v`edsbcaxdwbxfzefchameqecdlbl`gazdh`qfhaaadelesfhdaflblbkblerazapfidwbhchaqdobibzalfp`pccbgdveiczepat``", -"````a`epfoczdi`dccac`jaufzcraxaubxdwez`wfkehekbbclbkelaa`obqeleddldafkdmekfm`wfk`wfibwfidobhaiaxef`j`pdsbcacbcaodiddat``", -"``````eifgczevccfbau`jefdgffbhamaxfxezfd`w`l`odl`udcbk`wdneldtegadaaazetdlfmanan`waqfkehfifpbic``p`dbzagftao`vdifbfg````", -"``````a``yfgdv`b`v`ifcbz`b`ibwbtamfxfxfmfxekdhcfby`lciehec`wdlaverapcdecelaz`lby`lfidofiap`mcefxfp`idsagbcagajeicza`````", -"``````ata`czfbdv`vdjceasac`ibiamfian`maifxanazehave`apekehap`uege`ecazcfbkekdwfkfifiauchefbiencuftbcdvfbfof`fbdi`y`y````", -"`````````yczbudvdvdvfbcubgfcaucrbicraxfzchco`wekfke`aqflav`uaa`udm`u`w`uamfzchfmanameffpdgaidgfpaldvaoevf``zfbfgbu``````", -"````````a``tejeif`ajddajdsccbz`pbi`jfpdoanfzanbtai`f`ufkfkdq`lanebexaidcfme`fafiancodgenenbiai`pcracccf`bpddbufg`t``````", -"`````````t`yfgfgbpacaoakdubgbiauffdsenanfidoamaidgcdcoezbtecdc`mdmanbifidoanan`uapfzaxfpfpbhcecr`xbcbgbxddbufoej`t``````", -"```````````t`yfoddaodidv`i`xaleffpc`chfxamchezaichezfmfzanbwanfpcb`famfkanfxfzezcoanbifxc`ffefacbgccacf`ddddej`t````````", -"```````````tcnfobpdvbgdvbgbxftefbibxaiaudofzaxfichanfxfpfxezananfxchdgefezfzfxcuc`crdsfpcubz`jft`eeofcfbfoejfg`r````````", -"````````````eyfgbudiaoajbgdvbecrfpfpff`bffefbwaichchdgdgbhdgbjbidoaicofxfpaicubxds`afpdgas`e`vduag`z`zajdibuey``````````", -"```````````````t`rbuddeodvft`zalbccr`ec``bc`auenfp`jezchfxaidpc`fxdgfpfiamfcdgfxcvcrfcfpalcr`zbeajf`dvajbfey````````````", -"```````````````rbfbpfofbbgdvaffjfjcc`jfxbxfcc``b`bdsbiau`jc`biaibifxfpfcch`afpc``d`d`vdvfjfj`zdvajfbdvbp`tcn````````````", -"````````````````cnfnfnbpfnaoftftdj`ecuftfpaubidgfp`j`bfcfpfc`afpdgc``jfpencuc``b`j`e`vcrevdkdzewbefnfobfej``````````````", -"``````````````````bffnfnajfodvddccftaf`e`b`jdgcuai`jcv`jc`fcdj`jbxcvcvdsdsbxbxdjcr`xbxdjft`z`zddbefnbf`r````````````````", -"````````````````````d`eyewbeduak`zfjemcads`dfp`jdj`b`bcu`jcudgfpefds`bcacacvctct`dagak`xaoddbeeybpfn`r``````````````````", -"``````````````````````eyfnbpdkdz`z`zbmakfj`bag`v`dctctctctem`d`ecvctaeaeafcu`v`ecc`zakafbp`kbpewbfew````````````````````", -"````````````````````````eyeybfbpdk`zemcvcyafemakcvcvaeaeffdjcvcv`j`vae`vemaf`vagcc`z`z`zeodkbfd`ey``````````````````````", -"``````````````````````````cnbnfobe`kbe`kevemdzfj`k`z`b`edjctaeaeemds`eaf`vevdzdjafemd`dk`zbfd`ey````````````````````````", -"``````````````````````````````bncneybf`kbeaf`kememem`kcvafemakaeaeakemem`kdk`z`kbebm`zd`d`ah````````````````````````````", -"````````````````````````````````ahcnewd`dk`z`zaeaf`kaf`k`vemaedzcvakak`z`kdzd`dkdkbmbfbnah``````````````````````````````", -"````````````````````````````````````cncnbf`z`sd``s`k`z`s`zbm`s`kd`d``s`s`k`kd`ahd`bncn``````````````````````````````````", -"``````````````````````````````````````````bnd``s`s`kbnd`d`bfd``kbnbnd`bnd`ewahbn````````````````````````````````````````", -"````````````````````````````````````````````````ahbnahbnd`ewdkbfewahahewbn``````````````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" -}; -/* XPM */ -static char *glass11[] = { -/* width height ncolors chars_per_pixel */ -"72 72 189 2", -/* colors */ -"`` c None", -"`a c #27274E", -"`b c #25254C", -"`c c #383858", -"`d c #23234A", -"`e c #212148", -"`f c #2E2E62", -"`g c #292967", -"`h c #3535A1", -"`i c #272751", -"`j c #23234D", -"`k c #29293F", -"`l c #2C2C63", -"`m c #2A2A61", -"`n c #33334C", -"`o c #353579", -"`p c #272754", -"`q c #414188", -"`r c #20202C", -"`s c #2E2E3D", -"`t c #1C1C28", -"`u c #2E2E68", -"`v c #242447", -"`w c #2C2C66", -"`x c #222245", -"`y c #181824", -"`z c #25253E", -"a` c #161622", -"aa c #B9B9ED", -"ab c #3E3E67", -"ac c #1C1C3F", -"ad c #6767A3", -"ae c #2B2B47", -"af c #272743", -"ag c #222248", -"ah c #292931", -"ai c #29295C", -"aj c #1D1D39", -"ak c #252544", -"al c #1E1E47", -"am c #2B2B61", -"an c #29295F", -"ao c #1F1F3E", -"ap c #2F2F68", -"aq c #2D2D66", -"ar c #30305F", -"as c #2C2C5B", -"at c #11111C", -"au c #262655", -"av c #31316D", -"aw c #4C4C6D", -"ax c #222251", -"ay c #323264", -"az c #2D2D69", -"b` c #33335B", -"ba c #43436E", -"bb c #2B2B67", -"bc c #212146", -"bd c #37374B", -"be c #22223D", -"bf c #252536", -"bg c #1D1D42", -"bh c #2A2A5C", -"bi c #28285A", -"bj c #2B2B53", -"bk c #333372", -"bl c #2F2F6E", -"bm c #2B2B3F", -"bn c #2C2C36", -"bo c #424266", -"bp c #232337", -"bq c #2F2FB0", -"br c #34346C", -"bs c #525265", -"bt c #32326A", -"bu c #1B1B2F", -"bv c #3B3B55", -"bw c #303068", -"bx c #21214C", -"by c #2C2C64", -"bz c #292957", -"c` c #232351", -"ca c #26264A", -"cb c #2F2F60", -"cc c #202044", -"cd c #5D5D97", -"ce c #2B2B5C", -"cf c #363674", -"cg c #3C3C66", -"ch c #252556", -"ci c #30306E", -"cj c #3E3E54", -"ck c #414178", -"cl c #2C2C6A", -"cm c #2F2F4F", -"cn c #25252E", -"co c #27275B", -"cp c #363663", -"cq c #4C4C68", -"cr c #20204A", -"cs c #2E2E5B", -"ct c #29294C", -"cu c #242451", -"cv c #27274A", -"cw c #343464", -"cx c #4F4F64", -"cy c #252548", -"cz c #16162C", -"d` c #292938", -"da c #333384", -"db c #3C3C6F", -"dc c #353572", -"dd c #1E1E37", -"de c #38386B", -"df c #414156", -"dg c #242454", -"dh c #31316E", -"di c #181831", -"dj c #232349", -"dk c #272739", -"dl c #393979", -"dm c #4C4C85", -"dn c #2F2F83", -"do c #28285B", -"dp c #292952", -"dq c #36366C", -"dr c #48486D", -"ds c #23234C", -"dt c #37377A", -"du c #20203F", -"dv c #1E1E3D", -"dw c #26265C", -"dx c #313174", -"dy c #4C4C60", -"dz c #27273F", -"e` c #3C3C78", -"ea c #48485C", -"eb c white", -"ec c #383874", -"ed c #333379", -"ee c #444458", -"ef c #272756", -"eg c #47477C", -"eh c #32326E", -"ei c #1B1B33", -"ej c #1E1E2C", -"ek c #30306C", -"el c #40407F", -"em c #292944", -"en c #212150", -"eo c #23233E", -"ep c #141422", -"eq c #343473", -"er c #323271", -"es c #2D2D76", -"et c #2E2E6D", -"eu c #40406E", -"ev c #21213F", -"ew c #272731", -"ex c #8080BA", -"ey c #23232D", -"ez c #25255A", -"f` c #1B1B39", -"fa c #35356D", -"fb c #191937", -"fc c #262651", -"fd c #313169", -"fe c #2C2C6E", -"ff c #22224D", -"fg c #18182C", -"fh c #373786", -"fi c #2D2D65", -"fj c #232344", -"fk c #2B2B63", -"fl c #292961", -"fm c #27275F", -"fn c #202037", -"fo c #1C1C33", -"fp c #242452", -"fq c #45456F", -"fr c #484868", -"fs c #535380", -"ft c #1F1F43", -"fu c #2C2C5D", -"fv c #3535DD", -"fw c #353573", -"fx c #262657", -"fy c #393963", -"fz c #242455", -/* pixels */ -"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", -"``````````````````````````````````````````````````````````````bsbsbsbsbsbsdydybsbsea````````````````````````````````````````````````````````````", -"``````````````````````````````````````````````````````eabsbsdybsbsbsbsbsbscqcxbsbsbsbsbscxdy````````````````````````````````````````````````````", -"````````````````````````````````````````````````dydybsbsdycqcqdycxbsbsfrcqcxdyfrcqcxcxbseacxcxbsbs``````````````````````````````````````````````", -"````````````````````````````````````````````eaeaeafrcqawawawdrdrawcxawawcqcqawawawawawbscqfrfrdycxcxea``````````````````````````````````````````", -"````````````````````````````````````````frdfcxcqawcqcqawawfrcqdrawfrawawcqawawawfqawcqawcqdrawdrfrdycqdycx``````````````````````````````````````", -"````````````````````````````````````eeeaeaeadycqdffrboboawfqfqfqdrdrfqbabadrdrdrdrbobodrdrbaawdrdyfreaeaboeeee``````````````````````````````````", -"``````````````````````````````````eeeefreeeefrbofrfrbofrfqeudrbadrfqdrfqeubabababababafqdreufqfrbafrfreeeeeacjdf````````````````````````````````", -"``````````````````````````````eecjboeebocjboboababboabdrfsfqfqbabobobafqfqawdrfqawbaeueudrdebafrbocgbobobobodfdfcjbd````````````````````````````", -"````````````````````````````dfeeeedfcjbvab`ccgfyeuabboabbabaabdbadeucgdeabbabadbegfqfqfqbaeueueubobob`bocgcgdfeacjcjcj``````````````````````````", -"``````````````````````````cjbddfcjbv`ccgdffycgfqbofyfyabdbeuabfqexbaeueudefqexadckdbbadedebaabdedeeufyboabcpfycjdfdfeecj````````````````````````", -"````````````````````````cjcjdfdfbvb`cg`cfyfyfyfycgabcgdeeudbbregexdbdbadcddmegexeucgdedbdbayfydbdbabcgfycpb`bv`cbvcjdfbdcj``````````````````````", -"``````````````````````bdbdcjbvbvfy`c`cb`cpcgfyfyfycpdededbdeegexdmaaebexckaadm`ucddbdedbdbcwcpcpfddedeb`fyb`bvfycjcmbdcj`s`s````````````````````", -"````````````````````bd`nbvbvbv`ccg`c`ccscpcwcwcgdebrcwbraydqckdbcdegegcdcdade`btdcadbrdqfabrdebrcpbwaycpfyfyb``car`n`nbdcjbnbd``````````````````", -"```````````````````n`s`n`ncj`nb`b`b`b`b`b`arcpdqfabrbrcwaybtbrexadcddbadaae`dedeexaddbdqdebrdedbdededeayb`b`cpb`b`fy`n`c`ncmbdbd````````````````", -"```````````````````n`sbdaecmcmcscscscpcscscpcwfsbwfiaqfdaybtecadexaafsexe`exckdbbtecdedqfdaycpbrekcbcsaycb`icsaycpb`b``ncm`naebd````````````````", -"`````````````````scj`c`ccmctbjcsb`cparasascsdqayaybwecbwbrbrbbe`dee`ebadegcdexadegdbcdade`ecbrbwfk`ffuarcwarcscscscpcscmcmct`nd`bd``````````````", -"```````````````s`saecv`nbjaecmasarar`parcsayfdcb`fbrbtaq`fbtciecdmdbdeebcdebcdebehece`egfabtaqecbrcbazap`fayarcsas`casbjarcmem`n`sbn````````````", -"``````````````ew`s`zcv`nevcmbjcscsbzcscwaydedqbwavfafdfadcdcckadebcke`aaehdhadebe`dcehdcbtbran`fbr`fbrfibtayaybzbjarcsb`bjbjafbm`sae````````````", -"````````````bnaeae`kcmagdjfuaycsb``ffucscsbtbwdcaqfifdfabwave`exaaadcdcddh`oecadcddmfwapdbe`fdaqbrapbtbtfdecaqbhbzarcs`adpcmaf`zcmcncn``````````", -"````````````dz`n`kctcmct`idparcwaybw`farfubrdqbr`ffdfafaecekerdcfeazeleqavdmexaddmelcibkegbrbtbkfa`uehbwfifiambzfxcscs`abjbjakctcmcm`z``````````", -"``````````ey`saf`zafbjcv`befascsfuar`ffdbrde`faq`wdcdcbkerclesdlcfdmcdblfwcdebaddmdldxercdecbkavbkapbrbtfdbt`fcbbwcbbjbzcactaebectfn`zey````````", -"``````````a`bf`zcacvdpcv`icucscsbi`fefbhar`fbr`uekbrekcierdxdxdlcieleqes`odmelelexdmcfere`eldcetaqfibwfadcapcbcscsbtcsfcccakdp`vcv`zfncn````````", -"`````````tbpaecvao`vcccydsbzcsbzffaifiekbwbtbrap`uekbber`odladdteddndnbqdxeqedeqebeleceqdtelelerbyfkavdcfiancwarbtfdcsbjdjfcbjctaebpddbpbf``````", -"````````bf`rfodpevcv`vfjcybz`idpefbhayapetblapfdciblcleqeteqeldldxdxdadadaesdadtadcdcfereqdldcekapap`wflbwayamcbbhcbasasdp`pbjakcvfjfo`y`y``````", -"````````ewdddidvdj`abzagdpcu`p`lbzambwfdbbclehdcerfeetetflfedaedbldxdadndaeddada`qdmcfeqdxdheqblfkap`waqfddq`fdgaycs`pcsefef`afjeveieifo`k``````", -"```````ybfevei`zft`afubzcsas`fam`fbwfaecdcdcdccfetbbblcieretedesed`h`heldm`qdafvdndleceqercledetaqbrapbkfaayfabwbz`fbiascs`p`j`vftf`a`epbu`t````", -"```````y`ybufnaefc`bdpcucs`pfubw`lbwbrdqdcehavfw`wcfcfereqfwercidt`hdae``qdtbqbqeddle`cfdtdxercifk`uavavecbwbw`fbz`m`mefay`jbc`d`aaobua`fg`t````", -"``````epbuddcvfjefca`bdsbzbzbhezbyaqaqbrdqehecdcfddccfeqdaedblazdtfhfhdxdtdnfednfvfvcfdtererdcehfl`wfkbkfafaap`fcefifiasasfudjbc`bcadudda``t````", -"``````a`foeoemak`adparcsarefaidwamapbwapbyazeheccfeccfdxbqesfmblesbqeldtdtbq`g`hfvbq`q`qeqerfweqclbbfmdhbwfa`ufubifxbtarcscb`b`bcv`v`vfgfgbu````", -"````atejfgfgcy`v`bbcfuasef`ffiezchco`uazezezap`uekdlererereqeddadnfvfved`ofvesesbqfvdle`dleddtdlclfmfkerbr`mapfibtbi`lbzfufuccfccvccdvfg`yfoat``", -"`````yfodiaj`v`v`x`bdpcsbzdeamamaxfkaqehfm`wav`ueteretbkbkcffhdxfednfefv`hbqdadxesfedtfwcfdtfwe`dcflcldlbkfdfibtap`fanfpayasao`idpagczfneifg`t``", -"````atfgfofgagccao`abjasbzcbfufxbibtbwfdapecdlavekerblbkeqeqdaesfedafvdndn`hfvfv`hdxeddtdtcffwdlecdhcleqehbkaqaqfkfkco`f`fayafctdjcadiajdv`yfo``", -"````atejbpczaocc`aaldpbzbzfudoen`mbtfiambtbtereretererbletetfeesbq`hfv`g`gdn`hdafhdabqfvbkbkdldlfwerclfkekecaqaqfdfidgef`b`pctccftakfoajfgbua```", -"````ata`befofoft`daldp`p`laubzambi`lby`lehfm`gavciererclfe`g`gfhdtdxed`g`gesfmdnfvfvdndnetdxedblblazfmfmapec`mfzcbarc`bzbxfcaoccftf`fgbcepfgbu``", -"`````y`yevbefjdv`xfpdp`jenbifd`lfufkfdbtazdw`merdtdtci`g`gfebledfhesdnfeesdafvededfvdaed`hdadaclflfmflezfibtbycobwfudgfuarfuds`v`xaodidia`atat``", -"````atfgaobudif`acfp`ebxacfu`fc`fxfdfdan`mdw`gaz`ocfekcletesdndxfecletesdn`h`hfvfhedclfheqfherek`gbyazfm`uaz`ubtamanfucbceaufcccccducaevfoatat``", -"````atfoejfof`fbcc`jcrbheffufualaxamfiancifkbbciehekflcleleqdadxfedn`gbq`hfvesdnblfmflbberedcletazeqazehapfm`w`lfubzcbcsbzcr`jdpacf`ftdvfn`yat``", -"````atfgbufodjfjdudp`afpfu`l`jfcbiefdoapavfkfketazbyazbldxdt`hes`hesdxdx`h`hesdndaet`gazeler`wazdhdhcidhanbxezfzchbibh`p`pfceffffcf`czfodd`yat``", -"````atatczdif``b`v`v`afffu`facfcfubidgfmcoez`lapbbap`gbbedecfhedetdaesesfv`h`qcifhfhdadletfl`wekfianfkcifk`lfkchfl`lbzcrcufc`ift`aaodddda`buat``", -"````at`tdif`dvagcycc`iff`pefcraxfz`fbianezfkap`uehfw`ufl`gcieqcderfh`hdnedeqdcfedmazdldxdl`gazaq`lfmfmdwfi`l`lan`wfdfucrc`fp`b`d`daoddbufnatat``", -"``````fga`f`dvdvcycc`xffdsdscrchezcrfzeffxezfieqecdlbkfebbcidh`qfhfhad`qelfedndadnfkblcfclcierazapaqdwaibhchaqanfxcecealfpef`x`bdvf`eiczfg`y````", -"``````at`yeiczeiajftftac`j`pfpaxalaxefbxfzch`maqfkbkerazclblbkdmdtdaaaedexfvaddafe`udmblflfkazbbazaqfiaqanbiamanaxfpbzds`pfcbcccdvftaoei`yep````", -"``````a`a`didif`f`acbxalfp`pbxax`jcefufzfzfmfmbbfifkfibkdhaveqelexfv`qcddndmcdadfeekdl`hflanfkfm`wfdfkapapbhcuefchcuau`bbz`jacccf``vdidvat`y````", -"``````a`epfoczdv`baoacefbxbzcscr`pfi`fcochchezez`mavekdcecfmfmdmfa`wdlapexcdcddmaabbazes`wfd`lan`maqaibwehapcofiauauau`befalbcdp`ddvfodieiat````", -"````````ata`difbftao`a`bbzfu`bagbzfdbrfiandoaiaifp`wekeqfw`wfkeke`apckaqelecerfkckcdfherer`ufk`wbyaqaidoanamanbzcufx`b`pbgbcbgccagdieiczep``````", -"````````at`yfgf`difbctagbzascrbcefaubififx`lananezdo`mcidhapav`uelcddcecape`dcflfaekbkeqekdwcofkfiapaidgefchbic`ffalftaldvf`bpf`fbdidia`a```````", -"````````at`yczddeiaof`dvfb`jbgccasc`crbhcrfpenchchcoanekeh`we``wfkelececaaek`qcdaqfk`ufiezdgdwfman`lbhenfzfzaifpcealcraoaodueobeajdifg`ya```````", -"``````````a`bueibueiajajddddbcbgalbzfcbh`j`pfpdoaichchavapdodmbtbyad`mfkbydweccfckaielfmbybt`l`mcodwanaxaxenbifxbzdsbxf`ftacfndkajfofgfg````````", -"``````````a``teifgbubeftdvafccbgalamef`j`dbxcofkaqcodo`famdgdeanaidqanape``me`fiaianfk`m`mbwfdapaqfzffenfpc`bhfu`pftagagft`jddddfofofga`````````", -"````````````fg`tbueibpf`dvevfbevbgfpfpcrenbxaxamfiananfkbiaxfpezezfxfkecbwbifzch`mezfiamdocochfi`lcobibibzfpfpbzcufjevccac`efgbubu`tej``````````", -"`````````````tbu`rejf`aodidvdjfcagacbzbhaxdochfxanfzfpbiaichanbychchchbt`lfzbhezcofxaiaichchaufzc`fxch`jdoffenefbgalbgbcbccceiddfo`y`r``````````", -"```````````````rejeifodvdvajacbcccccdgbibxfpdgaufuezfz`manfzanfxaufp`fcodocoezchchenauchfxchefff`jagffbxenbzbi`dftbc`edz`df`buddbudd````````````", -"```````````````y`rbuf`diaoajacbgevevcrfpfpfp`afffffc`faqfxchchfzc`dgfxdgbjfxaiaiancofxfpcodg`bffds`adgbxbzbz`e`v`vftbeev`zajf`ddei`t````````````", -"`````````````````yfoeyfbaj`zajbgevakalbxcccu`e`b`bc`efbic`axaxchfxfpezchbjfcdodochfx`fanbzcuaufxcv`bfp`pef`e`eeoeoaof`f`ajdv`rfn`r``````````````", -"``````````````````cn`rejeidvacdveoak`vccccfffpbibx`ac``jcucu`jfxbifxfpfxfxfxcodgc`aybiai`i`jch`j`a`edjagacbc`x`zfnddajf`eodvey`t````````````````", -"``````````````````eybfej`rejfoaoevcccc`v`xbcc`c`fffpbicubxcucuffc`cu`pfcfpdgbhdoaucu`jcuffbxbx`bcr`efjagbcfjeodkeodkevddfobpcney````````````````", -"````````````````````eyejbpejbpdddvaoaodjbcagbcft`jefchfxbiauc``a`ac`c`fc`afcfccufcenfp`jfffp`jdsfpftcycrbcccdz`zdkbebebfddbf`r``````````````````", -"``````````````````````cnbpeyfofofodudd`eacdjafcr`d`dcufpffef`jca`bff`jfcbxcuc`dsaecv`d`jds`dcy`vag`xagbcfteo`zbpfnbpbfej`r`r````````````````````", -"````````````````````````d`bpddbfbebgak`zfj`z`kdsdsbxffff`bdj`b`b`jcucucudgcueffp`b`bcacacvcvctct`dagcyfjccevddeoeybpd`ej`r``````````````````````", -"``````````````````````````eyddbp`r`k`z`zdzem`kfjfj`b`d`vdjcyctctcactctcv`dcr`bcvctaeaecv`b`jfjdsccakcveoakbedz`zd`ahewah````````````````````````", -"````````````````````````````ewcnbnbndd`kdzfjdzemakemae`zcv`dcaaeaecy`e`acadsag`vaeaecvakaffjcacrbcajfj`zbp`z`kfnewewcn``````````````````````````", -"```````````````````````````````rewbfbp`z`zbedzafcyakembeafctcaak`d`v`acvaeae`dff`dag`baeakfj`zcy`zbm`z`z`k`zbfd`ahcn````````````````````````````", -"```````````````````````````````````sd`eyfnbmeobm`zdz`saf`v`k`kcvbcag`bcvemaeaecvagcyaecvevafaf`zem`zd`dkbmd`bfbf````````````````````````````````", -"````````````````````````````````````ahewfoewbf`k`z`zdz`zafemememcvaf`kdz`vafaeafakemembmbpafdkdkbp`k`zbp`seyah``````````````````````````````````", -"`````````````````````````````````````````sah`zewdk`z`zdzaeaf`kemdzakakaeae`kemakemeo`z`kemdkbfbpdk`kd`d`bn``````````````````````````````````````", -"````````````````````````````````````````````ahbnbf`zd`d``sbm`kdz`sdkdk`sae`k`zbmd``k`sbmdz`kbnah`s`sbn``````````````````````````````````````````", -"````````````````````````````````````````````````bncnbmbnd`dkdkdkdkbm`sbnbnbndzd`d``sbm`sbfd`bnewah``````````````````````````````````````````````", -"``````````````````````````````````````````````````````cnd``s`s`sahd`dkbmbnbn`sbnd`bnbn`newah````````````````````````````````````````````````````", -"``````````````````````````````````````````````````````````````ahcn`sbnahewbn`sewahbn````````````````````````````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", -"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" -}; -char **default_bubbles[] = {glass1, glass2, glass3, glass4, glass5, glass6, glass7, glass8, glass9, glass10, glass11, (char **)0}; - -int num_default_bubbles = 11; - -#endif /* NO_DEFAULT_BUBBLE */ diff --git a/hacks/compile_axp.com b/hacks/compile_axp.com index 18124d5c..336175bd 100644 --- a/hacks/compile_axp.com +++ b/hacks/compile_axp.com @@ -3,9 +3,10 @@ $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BLITSPIN.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BOUBOULE.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BRAID.C +$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES-DEFAULT.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES.C -$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES_DEFAULT.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CORAL.C +$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CYNOSURE.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECAYSCREEN.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECO.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DRIFT.C @@ -32,6 +33,7 @@ $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) LMORPH.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MAZE.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE.C +$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE2.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOUNTAIN.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MUNCH.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) NOSEGUY.C diff --git a/hacks/compile_decc.com b/hacks/compile_decc.com index 18124d5c..336175bd 100644 --- a/hacks/compile_decc.com +++ b/hacks/compile_decc.com @@ -3,9 +3,10 @@ $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BLITSPIN.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BOUBOULE.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BRAID.C +$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES-DEFAULT.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES.C -$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) BUBBLES_DEFAULT.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CORAL.C +$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) CYNOSURE.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECAYSCREEN.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DECO.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) DRIFT.C @@ -32,6 +33,7 @@ $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) LMORPH.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MAZE.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE.C +$ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOIRE2.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MOUNTAIN.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) MUNCH.C $ CC/DECC/PREFIX=ALL/DEFINE=(VMS,HAVE_CONFIG_H,STANDALONE)/INCL=([],[-],[-.UTILS]) NOSEGUY.C diff --git a/hacks/coral.c b/hacks/coral.c index 2cf5b114..74b5120b 100644 --- a/hacks/coral.c +++ b/hacks/coral.c @@ -231,8 +231,6 @@ char *defaults[] = { "*seeds: 20", /* too many for 640x480, too few for 1280x1024 */ "*delay: 5", "*delay2: 1000", - "*eraseSpeed: 400", - "*eraseMode: -1", 0 }; @@ -241,8 +239,6 @@ XrmOptionDescRec options[] = { { "-seeds", ".seeds", XrmoptionSepArg, 0 }, { "-delay", ".delay", XrmoptionSepArg, 0 }, { "-delay2", ".delay2", XrmoptionSepArg, 0 }, - { "-erase-speed", ".eraseSpeed", XrmoptionSepArg, 0 }, - { "-erase-mode", ".eraseMode", XrmoptionSepArg, 0 }, { 0, 0, 0, 0 } }; diff --git a/hacks/cynosure.c b/hacks/cynosure.c new file mode 100644 index 00000000..6a2be2df --- /dev/null +++ b/hacks/cynosure.c @@ -0,0 +1,390 @@ +/* cynosure --- draw some rectangles + * + * 01-aug-96: written in Java by ozymandias G desiderata + * 25-dec-97: ported to C and XScreenSaver by Jamie Zawinski + * + * Original version: + * http://www.organic.com/staff/ogd/java/cynosure.html + * http://www.organic.com/staff/ogd/java/source/cynosure/Cynosure-java.txt + * + * Original comments and copyright: + * + * Cynosure.java + * A Java implementation of Stephen Linhart's Cynosure screen-saver as a + * drop-in class. + * + * Header: /home/ogd/lib/cvs/aoaioxxysz/graphics/Cynosure.java,v 1.2 1996/08/02 02:41:21 ogd Exp + * + * ozymandias G desiderata + * Thu Aug 1 1996 + * + * COPYRIGHT NOTICE + * + * Copyright 1996 ozymandias G desiderata. Title, ownership rights, and + * intellectual property rights in and to this software remain with + * ozymandias G desiderata. This software may be copied, modified, + * or used as long as this copyright is retained. Use this code at your + * own risk. + * + * Revision: 1.2 + * + * Log: Cynosure.java,v + * Revision 1.2 1996/08/02 02:41:21 ogd + * Added a few more comments, fixed messed-up header. + * + * Revision 1.1.1.1 1996/08/02 02:30:45 ogd + * First version + */ + +#include "screenhack.h" +static Display *dpy; +static Window window; +static XColor *colors; +static int ncolors; +static int fg_pixel, bg_pixel; +static GC fg_gc, bg_gc, shadow_gc; + +static void paint(void); +static int genNewColor(void); +static int genConstrainedColor(int base, int tweak); +static int c_tweak(int base, int tweak); + +/** + * The current color that is being tweaked to create the + * rectangles. + **/ +static int curColor; + +/** + * A variable used for the progression of the colors (yes, I know + * that's a lame explanation, but if your read the source, it should + * become obvious what I'm doing with this variable). + **/ +static int curBase; + +/** + * The width of the right and bottom edges of the rectangles. + **/ +static int shadowWidth; + +/* The offset of the dropshadow beneath the rectangles. */ +static int elevation; + +/** + * The approximate amount of time that will elapse before the base + * color is permanently changed. + * + * @see #tweak + **/ +static int sway; + +/** + * The counter of time left until the base color value used. This class + * variable is necessary because Java doesn't support static method + * variables (grr grr). + **/ +static int timeLeft; + +/** + * The amount by which the color of the polygons drawn will vary. + * + * @see #sway; + **/ +static int tweak; + +/** + * The smallest size for an individual cell. + **/ +#define MINCELLSIZE 16 + +/** + * The narrowest a rectangle can be. + **/ +#define MINRECTSIZE 6 + +/** + * The size of the grid that the rectangles are placed within. + **/ +static int gridSize; + +/** + * Every so often genNewColor() generates a completely random + * color. This variable sets how frequently that happens. It's + * currently set to happen 1% of the time. + * + * @see #genNewColor + **/ +#define THRESHOLD 100 /*0.01*/ + + +char *progclass = "Cynosure"; +char *defaults [] = { + "Cynosure.background: black", /* to placate SGI */ + "*delay: 500000", + "*colors: 128", + "*iterations: 100", + "*shadowWidth: 2", + "*elevation: 5", + "*sway: 30", + "*tweak: 20", + "*gridSize: 12", + 0 +}; + +XrmOptionDescRec options [] = { + { "-delay", ".delay", XrmoptionSepArg, 0 }, + { "-ncolors", ".colors", XrmoptionSepArg, 0 }, + { "-iterations", ".iterations", XrmoptionSepArg, 0 }, + { 0, 0, 0, 0 } +}; + + +void screenhack(Display *d, Window w) +{ + XWindowAttributes xgwa; + XGCValues gcv; + int delay; + int i, iterations; + + dpy = d; + window = w; + + curColor = 0; + curBase = curColor; + shadowWidth = get_integer_resource ("shadowWidth", "Integer"); + elevation = get_integer_resource ("elevation", "Integer"); + sway = get_integer_resource ("sway", "Integer"); + tweak = get_integer_resource ("tweak", "Integer"); + gridSize = get_integer_resource ("gridSize", "Integer"); + timeLeft = 0; + + XGetWindowAttributes (dpy, window, &xgwa); + + ncolors = get_integer_resource ("colors", "Colors"); + if (ncolors < 2) ncolors = 2; + if (ncolors <= 2) mono_p = True; + + if (mono_p) + colors = 0; + else + colors = (XColor *) malloc(sizeof(*colors) * (ncolors+1)); + + if (mono_p) + ; + else { + make_smooth_colormap (dpy, xgwa.visual, xgwa.colormap, colors, &ncolors, + True, 0, True); + if (ncolors <= 2) { + mono_p = True; + ncolors = 2; + if (colors) free(colors); + colors = 0; + } + } + + bg_pixel = get_pixel_resource("background", "Background", dpy, + xgwa.colormap); + fg_pixel = get_pixel_resource("foreground", "Foreground", dpy, + xgwa.colormap); + + gcv.foreground = fg_pixel; + fg_gc = XCreateGC(dpy, window, GCForeground, &gcv); + gcv.foreground = bg_pixel; + bg_gc = XCreateGC(dpy, window, GCForeground, &gcv); + + gcv.fill_style = FillStippled; + gcv.stipple = XCreateBitmapFromData(dpy, window, "\125\252", 8, 2); + shadow_gc = XCreateGC(dpy, window, GCForeground|GCFillStyle|GCStipple, &gcv); + XFreePixmap(dpy, gcv.stipple); + + delay = get_integer_resource ("delay", "Delay"); + iterations = get_integer_resource ("iterations", "Iterations"); + + while (1) + { + if (iterations > 0 && ++i >= iterations) + { + i = 0; + if (!mono_p) + XSetWindowBackground(dpy, window, + colors[random() % ncolors].pixel); + XClearWindow(dpy, window); + } + paint(); + XSync(dpy, False); + if (delay) + usleep(delay); + } +} + +/** + * paint adds a new layer of multicolored rectangles within a grid of + * randomly generated size. Each row of rectangles is the same color, + * but colors vary slightly from row to row. Each rectangle is placed + * within a regularly-sized cell, but each rectangle is sized and + * placed randomly within that cell. + * + * @param g the Graphics coordinate in which to draw + * @see #genNewColor + **/ +static void paint(void) +{ + int i; + int cellsWide, cellsHigh, cellWidth, cellHeight; + static int width, height; + static int size_check = 1; + + if (--size_check <= 0) + { + XWindowAttributes xgwa; + XGetWindowAttributes (dpy, window, &xgwa); + width = xgwa.width; + height = xgwa.height; + size_check = 1000; + } + + /* How many cells wide the grid is (equal to gridSize +/- (gridSize / 2)) + */ + cellsWide = c_tweak(gridSize, gridSize / 2); + /* How many cells high the grid is (equal to gridSize +/- (gridSize / 2)) + */ + cellsHigh = c_tweak(gridSize, gridSize / 2); + /* How wide each cell in the grid is */ + cellWidth = width / cellsWide; + /* How tall each cell in the grid is */ + cellHeight = height / cellsHigh; + + /* Ensure that each cell is above a certain minimum size */ + + if (cellWidth < MINCELLSIZE) { + cellWidth = MINCELLSIZE; + cellsWide = width / cellWidth; + } + + if (cellHeight < MINCELLSIZE) { + cellHeight = MINCELLSIZE; + cellsHigh = width / cellWidth; + } + + /* fill the grid with randomly-generated cells */ + for(i = 0; i < cellsHigh; i++) { + int j; + + /* Each row is a different color, randomly generated (but constrained) */ + if (!mono_p) + { + int c = genNewColor(); + XSetForeground(dpy, fg_gc, colors[c].pixel); + } + + for(j = 0; j < cellsWide; j++) { + int curWidth, curHeight, curX, curY; + + /* Generate a random height for a rectangle and make sure that */ + /* it's above a certain minimum size */ + curHeight = random() % (cellHeight - shadowWidth); + if (curHeight < MINRECTSIZE) + curHeight = MINRECTSIZE; + /* Generate a random width for a rectangle and make sure that + it's above a certain minimum size */ + curWidth = random() % (cellWidth - shadowWidth); + if (curWidth < MINRECTSIZE) + curWidth = MINRECTSIZE; + /* Figure out a random place to locate the rectangle within the + cell */ + curY = (i * cellHeight) + (random() % ((cellHeight - curHeight) - + shadowWidth)); + curX = (j * cellWidth) + (random() % ((cellWidth - curWidth) - + shadowWidth)); + + /* Draw the shadow */ + if (elevation > 0) + XFillRectangle(dpy, window, shadow_gc, + curX + elevation, curY + elevation, + curWidth, curHeight); + + /* Draw the edge */ + if (shadowWidth > 0) + XFillRectangle(dpy, window, bg_gc, + curX + shadowWidth, curY + shadowWidth, + curWidth, curHeight); + + XFillRectangle(dpy, window, fg_gc, curX, curY, curWidth, curHeight); + + /* Draw a 1-pixel black border around the rectangle */ + XDrawRectangle(dpy, window, bg_gc, curX, curY, curWidth, curHeight); + } + + } +} + + +/** + * genNewColor returns a new color, gradually mutating the colors and + * occasionally returning a totally random color, just for variety. + * + * @return the new color + **/ +static int genNewColor(void) +{ + /* These lines handle "sway", or the gradual random changing of */ + /* colors. After genNewColor() has been called a given number of */ + /* times (specified by a random permutation of the tweak variable), */ + /* take whatever color has been most recently randomly generated and */ + /* make it the new base color. */ + if (timeLeft == 0) { + timeLeft = c_tweak(sway, sway / 3); + curColor = curBase; + } else { + timeLeft--; + } + + /* If a randomly generated number is less than the threshold value, + produce a "sport" color value that is completely unrelated to the + current palette. */ + if (0 == (random() % THRESHOLD)) { + return (random() % ncolors); + } else { + curBase = genConstrainedColor(curColor, tweak); + return curBase; + } + +} + +/** + * genConstrainedColor creates a random new color within a certain + * range of an existing color. Right now this works with RGB color + * values, but a future version of the program will most likely use HSV + * colors, which should generate a more pleasing progression of values. + * + * @param base the color on which the new color will be based + * @param tweak the amount that the new color can be tweaked + * @return a new constrained color + * @see #genNewColor + **/ +static int genConstrainedColor(int base, int tweak) +{ + int i = 1 + (random() % tweak); + if (random() & 1) + i = -i; + i = (base + i) % ncolors; + while (i < 0) + i += ncolors; + return i; +} + +/** + * Utility function to generate a tweaked color value + * + * @param base the byte value on which the color is based + * @param tweak the amount the value will be skewed + * @see #tweak + * @return the tweaked byte + **/ +static int c_tweak(int base, int tweak) +{ + int ranTweak = (random() % (2 * tweak)); + int n = (base + (ranTweak - tweak)); + if (n < 0) n = -n; + return (n < 255 ? n : 255); +} diff --git a/hacks/decayscreen.c b/hacks/decayscreen.c index ed7a0840..ebcecfbc 100644 --- a/hacks/decayscreen.c +++ b/hacks/decayscreen.c @@ -81,6 +81,8 @@ init_decay (Display *dpy, Window window) if (delay < 0) delay = 0; + XGetWindowAttributes (dpy, window, &xgwa); + gcv.function = GXcopy; gcv.subwindow_mode = IncludeInferiors; gcflags = GCForeground |GCFunction; @@ -88,7 +90,6 @@ init_decay (Display *dpy, Window window) gcflags |= GCSubwindowMode; gc = XCreateGC (dpy, window, gcflags, &gcv); - XGetWindowAttributes (dpy, window, &xgwa); sizex = xgwa.width; sizey = xgwa.height; diff --git a/hacks/default.xbm b/hacks/default.xbm deleted file mode 100644 index dcd2ff50..00000000 --- a/hacks/default.xbm +++ /dev/null @@ -1,1686 +0,0 @@ -#define logo_width 464 -#define logo_height 435 -static unsigned char logo_bits[] = { -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0x60, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0x60,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xf0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf8,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf8,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0x01, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0x01,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfc,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0x07,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0x07,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfe,0x07,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff, -0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xff,0x0f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0x0f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0x3f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0x80,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x80,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0xff,0xff,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf0,0xff,0xff,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff, -0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x03, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfc,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfc,0xff,0xff,0x07,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfe,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe, -0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff, -0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0x0f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff, -0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x7f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff, -0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff, -0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xf8,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfc,0xff,0xdf,0xff,0xff,0x07,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe, -0xff,0xdf,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x8f, -0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0xff,0xff, -0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0xff,0xff,0x0f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xff,0xff,0x07,0xff,0xff,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xff,0xff,0x07,0xff,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x80,0xff,0xff,0x07,0xfe,0xff,0x1f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0xff,0x03,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff, -0x03,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0xfc, -0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xe0,0xff,0xff,0,0xf0,0x03,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xe0,0xff,0xff,0,0xf0,0x03,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xe0,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff, -0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xf0,0x07,0,0, -0x80,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff, -0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff, -0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xc0,0xff,0xff,0xff,0x03,0,0,0xe0,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfc,0xff,0xff,0,0,0,0,0,0xe0,0xff,0x07,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff, -0x7f,0xfe,0,0,0,0,0,0,0xfc,0x7f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x01,0xfe, -0x01,0,0,0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfe,0xff,0x01,0xfe,0x01,0, -0,0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf0,0xff,0x07,0,0xce,0x07,0,0,0, -0,0,0,0xfe,0x1f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xfe,0x7f,0,0,0x87,0x1f,0,0,0,0,0, -0,0xc0,0xff,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xe0,0xff,0x07,0,0x80,0x03,0x3e,0,0,0,0,0,0,0, -0xfe,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc, -0x3f,0,0,0x80,0x03,0xf8,0,0,0,0,0,0,0,0xe0,0x3f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0x3f,0, -0,0x80,0x03,0xf8,0,0,0,0,0,0,0,0xe0,0x3f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0x07,0,0,0xc0, -0x01,0xe0,0x01,0,0,0,0,0,0,0,0xff,0x01,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0xc0,0xfb,0xff, -0x0f,0,0,0,0,0,0,0,0xf0,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0xff,0xff,0x07,0,0xc0,0xff,0xff,0x3f,0, -0,0,0,0,0,0,0x80,0xff,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x80,0xff,0xc0,0xff,0x7f,0,0xe0,0xff,0xff,0x7f,0,0,0, -0,0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0x80,0xff,0xc0,0xff,0x7f,0,0xe0,0xff,0xff,0x7f,0,0,0,0,0, -0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0x1f, -0,0xf8,0xff,0x0f,0xf0,0x0f,0xc0,0xff,0x01,0,0,0,0,0,0, -0,0xf0,0x0f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xe0,0x0f,0,0, -0xff,0x7f,0xf0,0x01,0,0xf8,0x03,0,0,0,0,0,0,0,0xc0, -0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,0x80,0xff, -0x7b,0,0,0xe0,0x07,0,0,0,0,0,0,0,0,0xfe,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xf8,0,0,0,0,0xfc,0x3f,0, -0,0x80,0x1f,0,0,0,0,0,0,0,0,0xf0,0x03,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf8,0,0,0,0,0xfc,0x3f,0,0,0x80, -0x1f,0,0,0,0,0,0,0,0,0xf0,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0x3c,0,0,0,0,0xe0,0x7f,0,0,0,0x7e,0, -0,0,0,0,0,0,0,0xe0,0x0f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x3e,0,0,0,0,0,0xff,0x03,0,0,0x70,0,0,0, -0,0,0,0,0,0x80,0x3f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0x0f, -0,0,0,0,0,0xf0,0x1f,0,0,0,0,0,0,0,0, -0,0,0,0,0xfc,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xc0,0x0f,0,0, -0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0, -0,0,0xf8,0x07,0,0,0,0,0,0,0,0,0,0,0, -0xe0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,0,0, -0xf8,0x07,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x07, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xe0,0x03,0,0,0,0,0,0,0xe0,0x3f, -0,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xf0,0x01,0,0,0,0,0,0,0x80,0xff,0,0, -0,0,0,0,0,0,0,0,0,0,0x3f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xf8,0x01,0,0,0,0,0,0,0,0xfc,0x07,0,0,0, -0,0,0,0,0,0,0,0,0x7c,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8, -0,0,0,0xfe,0x03,0,0,0,0xf0,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0xf8,0x01,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0,0, -0,0xfe,0x03,0,0,0,0xf0,0x0f,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xfc,0,0,0xf0,0xff, -0x1f,0,0,0,0x80,0x7f,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0x3f,0,0,0xfc,0xff,0x7f,0, -0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,0, -0xc0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0x1f,0,0,0xff,0x47,0x7f,0,0,0, -0,0xf8,0x0f,0,0,0,0,0,0,0,0,0,0,0x80,0x0f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0,0,0,0,0xc0, -0xff,0,0,0,0,0,0,0,0,0,0,0,0x3e,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0,0,0,0,0xc0,0xff,0, -0,0,0,0,0,0,0,0,0,0,0x3e,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc, -0x03,0xc0,0xff,0xfe,0xff,0x7d,0,0,0,0,0x80,0xff,0x01,0,0, -0,0,0,0,0,0,0,0,0x7c,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0,0x40, -0,0,0xfe,0x7f,0,0,0,0,0x80,0xff,0x07,0,0,0,0, -0,0,0,0,0,0,0xf0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xf0,0x3f,0,0,0x80,0x03, -0xf8,0x3f,0,0,0,0,0x80,0xe7,0x1f,0,0,0,0,0,0, -0,0,0,0,0xf0,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfe,0x0f,0,0,0xf0,0xff,0xff,0x1f, -0,0,0,0,0x80,0xc7,0x7f,0,0,0,0,0,0,0,0, -0,0,0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0x0f,0,0,0xf0,0xff,0xff,0x1f,0,0, -0,0,0x80,0xc7,0x7f,0,0,0,0,0,0,0,0,0,0, -0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xc0,0xff,0x03,0,0,0xf0,0xff,0xff,0x0f,0,0,0,0, -0xc0,0x0f,0xff,0x01,0,0,0,0,0,0,0,0,0,0xc0,0x07, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf0,0x7f,0,0,0,0xc0,0xff,0xff,0x01,0,0,0,0,0xc0,0x0f, -0xfc,0x07,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,0x0f, -0,0,0,0,0,0,0,0,0,0,0,0xc0,0x0f,0xf0,0x0f, -0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0x80,0xff,0x01,0,0, -0,0,0,0,0,0,0,0,0,0xe0,0x1f,0x80,0x3f,0,0, -0,0,0,0,0,0,0,0,0x1c,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf8,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0,0xf0,0x1c,0,0xfe,0x03,0,0,0, -0,0,0,0,0,0,0x78,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf8,0x0f,0,0,0,0,0,0,0, -0,0,0,0,0,0xf0,0x1c,0,0xfe,0x03,0,0,0,0,0, -0,0,0,0,0x78,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0x70,0x1c,0,0xf0,0x07,0,0,0,0,0,0,0, -0,0,0xf0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x3f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x70,0x38,0,0xc0,0x1f,0,0,0,0,0,0,0,0,0, -0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0x80, -0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0x70, -0x78,0,0,0x7f,0,0,0,0,0,0,0,0,0,0xc0,0x03, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0x03,0, -0,0,0,0,0,0,0,0,0,0,0,0,0x70,0x70,0, -0,0xfc,0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xc0,0x03,0,0,0, -0,0,0,0,0,0,0,0,0,0,0x70,0x70,0,0,0xfc, -0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xc0,0x01,0,0,0,0,0, -0,0,0,0,0,0,0,0,0x38,0x70,0,0,0xfe,0x03,0xfe, -0x7f,0,0,0,0,0,0,0,0x0f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0x01,0,0,0,0,0,0,0, -0,0,0,0,0,0,0x38,0xf0,0,0,0xfe,0x0f,0xff,0xff,0x01, -0,0,0,0,0,0,0x0f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xe0,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0,0x18,0xe0,0,0x80,0x9f,0xff,0x3f,0xfe,0x03,0,0, -0,0,0,0,0x0f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x1c,0xe0,0,0x80,0x0f,0xff,0x07,0xc0,0x0f,0,0,0,0, -0,0,0x1e,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0x1c,0xe0,0,0x80,0x0f,0xff,0x07,0xc0,0x0f,0,0,0,0,0,0, -0x1e,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xf1, -0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0x0e,0xe0, -0,0xc0,0x07,0xfc,0x01,0,0x1f,0,0,0,0,0,0,0x3e,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xc0,0xe1,0xff,0, -0,0,0,0,0,0,0,0,0,0,0,0x0e,0xe0,0x01,0xe0, -0x03,0x60,0,0,0x38,0,0,0,0,0,0,0x3c,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xc0,0xc3,0xff,0x01,0,0, -0,0,0,0,0,0,0,0,0,0x07,0xc0,0x01,0xf0,0x01,0, -0xe0,0x03,0xf0,0,0,0,0,0,0,0x38,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0x07,0xf0,0x03,0,0,0,0, -0,0,0,0,0,0,0,0x07,0xc0,0x03,0xf8,0,0,0xf8,0x1f, -0xe0,0,0,0,0,0,0,0x38,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0x07,0xf0,0x03,0,0,0,0,0,0, -0,0,0,0,0,0x07,0xc0,0x03,0xf8,0,0,0xf8,0x1f,0xe0,0, -0,0,0,0,0,0x38,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0x80,0x0f,0xc0,0x07,0,0,0,0,0,0,0,0, -0,0,0,0x07,0x80,0x03,0x78,0,0,0xf8,0x7f,0xe0,0x01,0,0, -0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x0f,0x80,0x0f,0,0,0,0,0,0,0,0,0,0, -0x80,0x03,0x80,0x03,0x3e,0,0,0x78,0x7e,0xc0,0x03,0,0,0,0, -0,0x78,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0x1e,0x1c,0x0f,0,0,0,0,0,0,0,0,0,0,0x80,0xf3, -0x9f,0x03,0x1f,0,0,0,0xf0,0x80,0x03,0,0,0,0,0,0x70, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0x1e,0xfe, -0x0f,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x07, -0x0f,0,0,0,0xe0,0,0x07,0,0,0,0,0,0x70,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x1e,0xfe,0x0f,0, -0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x07,0x0f,0, -0,0,0xe0,0,0x07,0,0,0,0,0,0x70,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x7c,0xfc,0x0f,0,0,0, -0,0,0,0,0,0,0,0xc0,0xff,0xff,0x87,0x07,0,0,0, -0xe0,0,0x07,0,0,0,0,0,0x70,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x7c,0xf8,0x0f,0,0,0,0,0, -0,0,0,0,0,0xc0,0x3f,0xf4,0xc7,0x07,0,0,0,0xe0,0, -0x07,0,0,0,0,0,0x70,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf0,0x01,0,0,0,0,0,0,0,0, -0,0,0,0xe0,0x03,0x80,0xe7,0x01,0,0,0,0xe0,0,0x07,0, -0,0,0,0,0xe0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,0, -0,0xe0,0,0,0xff,0x01,0,0,0,0xe0,0x80,0x07,0,0,0, -0,0,0xe0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xff,0,0,0,0,0xf8,0x80,0x03,0,0,0,0,0, -0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0, -0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xff,0,0,0,0,0xf8,0x80,0x03,0,0,0,0,0,0xe0,0x01, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0x80,0x07,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0x7e,0, -0,0,0,0x7c,0xc0,0x01,0,0,0,0,0,0xe0,0x01,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x3e,0,0x80,0x07, -0xe0,0x3f,0xe0,0x01,0,0,0,0,0,0xc0,0x01,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x1e,0,0xc0,0xff,0xff,0x0f, -0xe0,0,0,0,0,0,0,0xc0,0x01,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x1e,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x1f,0,0xe0,0xff,0xff,0x03,0xe0,0, -0,0,0,0,0,0xc0,0x01,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x1e,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x1f,0,0xe0,0xff,0xff,0x03,0xe0,0,0,0, -0,0,0,0xc0,0x01,0,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0x3f,0,0x1e,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x80,0x07,0,0x80,0xff,0x7f,0,0xf8,0x01,0,0,0,0, -0,0xc0,0x01,0,0,0,0,0,0,0,0,0,0,0,0, -0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0x03,0x1e,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xc0,0x07,0,0,0,0,0,0xfc,0x07,0,0,0,0,0,0xc0, -0x01,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x1e, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x03, -0,0,0,0,0,0xfe,0x0f,0,0,0,0,0,0xc0,0x01,0, -0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0, -0,0,0x80,0xcf,0x3f,0,0,0xfe,0x01,0,0xc0,0x01,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,0,0, -0x80,0xcf,0x3f,0,0,0xfe,0x01,0,0xc0,0x01,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x0f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xf0,0,0,0,0,0,0xe0,0xe7, -0xff,0,0,0xfe,0x0f,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0x03,0,0xfc,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0x03,0x0f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x7c,0,0,0,0,0xf0,0xff,0xf9,0xff,0x01, -0,0xe0,0x1f,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0x03,0,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0x03,0x0f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0x7e,0,0,0,0xc0,0xff,0x7f,0xfe,0xe1,0x07,0,0xc0, -0xff,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0x01,0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0x03,0x07,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x1e,0,0,0,0xfc,0xff,0x1f,0xff,0x81,0x0f,0,0x80,0xf1,0x03, -0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0,0, -0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03, -0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0x1e, -0,0,0,0xfc,0xff,0x1f,0xff,0x81,0x0f,0,0x80,0xf1,0x03,0xc0,0xe1, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0xc0,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x81,0x0f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0x1f,0,0, -0,0xff,0x3f,0x80,0xff,0,0x1f,0,0x80,0xc1,0x07,0xc0,0xe1,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0,0,0,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xc1,0xff,0x3f,0,0, -0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0x03,0xc0,0x3f, -0,0xe0,0x7f,0,0x7e,0,0x80,0x01,0x1f,0xe0,0xe1,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0xfc,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x03,0,0,0, -0,0,0,0,0,0,0,0x80,0x0f,0x80,0x07,0xf0,0x07,0,0xf0, -0x3f,0,0xf8,0,0x80,0x01,0x3c,0xe0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0x03,0,0,0,0xf8,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x7f,0,0,0,0,0, -0,0,0,0,0,0xc0,0x03,0x80,0xff,0xff,0x01,0,0xfc,0x1f,0, -0xf0,0x01,0xc0,0x01,0x38,0xe0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0x7f,0xf0,0,0xf8,0xff,0x07,0,0,0,0,0,0, -0,0,0,0xe0,0x03,0,0xfe,0x1f,0,0x80,0xbf,0x07,0,0x80,0x07, -0xc0,0x01,0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f, -0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0x7f,0xf0,0,0xf8,0xff,0x07,0,0,0,0,0,0,0,0, -0,0xe0,0x03,0,0xfe,0x1f,0,0x80,0xbf,0x07,0,0x80,0x07,0xc0,0x01, -0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,0,0, -0,0,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f, -0xf0,0,0,0xfe,0x7f,0,0,0,0,0,0,0,0,0,0xf0, -0x01,0,0xf8,0x03,0,0xc0,0xcf,0x03,0,0x80,0x1f,0xf0,0x01,0xe0,0x71, -0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0, -0,0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0xf0,0, -0,0xe0,0xff,0x03,0,0,0,0,0,0,0,0,0xf8,0,0, -0,0,0,0xe0,0xe7,0x03,0,0,0x7e,0xff,0,0xc0,0x73,0xf0,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0xfc, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0xf0,0,0,0, -0xfc,0x1f,0,0,0,0,0,0,0,0,0x78,0,0,0,0, -0,0xf8,0xf3,0,0,0,0xfc,0x7f,0,0,0x7f,0xf0,0xff,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0xf0,0xff,0xff, -0xff,0x1f,0,0,0,0,0,0,0,0xf0,0,0,0,0xe0,0xff, -0,0,0,0,0,0,0,0,0x3c,0,0,0,0,0,0x7c, -0xf8,0,0,0,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff, -0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x1f, -0,0,0,0,0,0,0,0xf0,0,0,0,0xe0,0xff,0,0, -0,0,0,0,0,0,0x3c,0,0,0,0,0,0x7c,0xf8,0, -0,0,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff, -0xff,0x7f,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x3f,0,0, -0,0,0,0,0,0x70,0,0,0,0x80,0xff,0x0f,0,0,0, -0,0,0,0,0x3e,0,0,0,0,0,0x7f,0x7c,0,0,0, -0xe0,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f, -0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0,0,0,0, -0,0,0,0x78,0,0,0,0,0xfe,0x7f,0,0,0,0,0, -0,0,0x1e,0,0,0,0,0xc0,0x1f,0x3e,0,0,0,0xc0,0xff, -0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0, -0,0,0,0,0,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0, -0,0x7c,0,0,0,0,0xf0,0xff,0x03,0,0,0,0,0,0, -0x0f,0,0,0,0,0xe0,0x07,0x1f,0,0,0,0x80,0x0f,0,0, -0x3c,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0,0,0,0, -0,0,0,0xfc,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0x3c, -0,0,0,0,0,0xfe,0x0f,0,0,0,0,0,0,0x0f,0, -0,0,0,0xfc,0x83,0x0f,0,0,0,0,0x0f,0,0,0x38,0xf0, -0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0, -0,0xfc,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0x3c,0,0, -0,0,0,0xfe,0x0f,0,0,0,0,0,0,0x0f,0,0,0, -0,0xfc,0x83,0x0f,0,0,0,0,0x0f,0,0,0x38,0xf0,0xff,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0xf0, -0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0x1e,0,0,0,0xf8, -0xff,0xff,0x3f,0,0,0,0,0,0x80,0x07,0,0,0,0,0xff, -0x80,0x07,0,0,0,0,0x3e,0,0,0x38,0,0,0,0,0, -0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0xc0,0xff,0xff, -0xff,0x7f,0,0,0,0,0,0,0x0f,0,0,0,0xff,0xff,0xff, -0xff,0x03,0,0,0,0,0xe0,0x01,0,0,0,0xe0,0x1f,0xe0,0x03, -0,0,0,0,0x78,0,0,0x1c,0,0,0,0,0xe0,0xff,0xff, -0xff,0x0f,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff, -0,0,0,0,0,0x80,0x0f,0,0,0,0xff,0x3f,0xe0,0xff,0x0f, -0,0,0,0,0xf0,0x01,0,0,0,0xf8,0x07,0xf0,0x01,0,0, -0,0,0xf0,0x01,0,0x1e,0,0,0,0,0xf0,0xff,0xff,0xff,0x07, -0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x03,0, -0,0,0,0x80,0x07,0,0,0,0xe0,0xff,0x01,0xfe,0x3f,0,0, -0,0,0xf0,0,0,0,0,0xfe,0x01,0xf8,0,0,0,0,0, -0xc0,0x03,0,0x0e,0,0,0,0,0xfc,0xff,0xff,0xff,0x01,0,0, -0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x03,0,0,0, -0,0x80,0x07,0,0,0,0xe0,0xff,0x01,0xfe,0x3f,0,0,0,0, -0xf0,0,0,0,0,0xfe,0x01,0xf8,0,0,0,0,0,0xc0,0x03, -0,0x0e,0,0,0,0,0xfc,0xff,0xff,0xff,0x01,0,0,0,0, -0,0,0,0,0,0xf8,0xff,0xff,0xff,0x07,0,0,0,0,0x80, -0x07,0,0,0,0,0xf8,0x07,0xc0,0xff,0x01,0,0,0,0xf8,0, -0,0,0x80,0x7f,0,0x78,0,0,0,0,0,0xc0,0x0f,0,0x0e, -0,0,0,0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0, -0,0,0,0xf0,0xff,0xff,0xff,0x1f,0,0,0,0,0xc0,0xe3,0xff, -0xff,0,0,0xc0,0x1f,0x80,0xff,0x03,0,0,0,0x3c,0,0,0, -0xe0,0x1f,0,0x3e,0,0,0,0,0,0,0x0f,0,0x07,0,0, -0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0xff,0xff,0x7f,0,0,0,0,0xc0,0xfb,0xff,0xff,0x0f, -0,0,0x3e,0x80,0xf3,0x1f,0,0,0,0x3e,0,0,0,0xf8,0x07, -0,0x1e,0,0,0,0,0,0,0x1e,0,0x07,0,0,0,0xe0, -0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0, -0xff,0xff,0xff,0xff,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0,0, -0x7c,0xc0,0x81,0xff,0,0,0,0x1f,0,0,0,0xff,0x01,0,0x0f, -0,0,0,0,0,0,0x7c,0x80,0x07,0,0,0,0xf0,0xff,0xff, -0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff, -0xff,0xff,0x03,0,0,0,0xc0,0x7f,0,0xe0,0xff,0x3f,0,0xf0,0xc0, -0x01,0xfe,0x03,0,0,0x0f,0,0,0xc0,0x7f,0,0xc0,0x07,0,0, -0,0,0,0,0xf0,0xc0,0x03,0,0,0,0xfc,0xff,0xff,0xff,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff, -0x03,0,0,0,0xc0,0x7f,0,0xe0,0xff,0x3f,0,0xf0,0xc0,0x01,0xfe, -0x03,0,0,0x0f,0,0,0xc0,0x7f,0,0xc0,0x07,0,0,0,0, -0,0,0xf0,0xc0,0x03,0,0,0,0xfc,0xff,0xff,0xff,0,0,0, -0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0x07,0, -0,0,0xc0,0x0f,0,0,0xfc,0xff,0x03,0xc0,0xe3,0x01,0xf0,0x07,0, -0x80,0x07,0,0,0xf0,0x1f,0,0xc0,0x07,0,0,0,0,0,0, -0xf0,0xc1,0x01,0,0,0,0xff,0xff,0xff,0x7f,0,0,0,0,0, -0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x1f,0,0,0, -0xc0,0x07,0,0,0,0xfc,0xff,0,0xf7,0,0,0x3f,0,0xc0,0x03, -0,0,0xff,0,0,0xe0,0x01,0,0,0,0,0,0,0xc0,0xe3, -0x01,0,0,0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0,0,0,0xc0,0x01, -0,0,0,0xc0,0xff,0x07,0x7f,0,0,0xfc,0,0xe0,0x03,0,0xe0, -0x3f,0,0,0xf0,0x01,0,0,0,0,0,0,0x80,0xff,0,0, -0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xfe,0xff,0xff,0xff,0,0,0,0xc0,0x01,0,0, -0,0,0xfe,0x7f,0x7f,0,0,0xf8,0x01,0xe0,0x01,0,0xfc,0x07,0, -0,0xf8,0,0,0,0,0,0,0,0,0xff,0,0,0,0xfc, -0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xfe,0xff,0xff,0xff,0,0,0,0xc0,0x01,0,0,0,0, -0xfe,0x7f,0x7f,0,0,0xf8,0x01,0xe0,0x01,0,0xfc,0x07,0,0,0xf8, -0,0,0,0,0,0,0,0,0xff,0,0,0,0xfc,0xff,0xff, -0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0xff,0xff,0x03,0,0,0xc0,0x03,0,0,0,0,0xe0,0xff, -0x3f,0,0,0xf0,0x07,0xf0,0,0,0xff,0x03,0,0,0x7c,0,0, -0,0,0,0,0,0,0x7e,0,0,0,0xff,0xff,0xff,0x7f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff, -0xff,0xff,0x0f,0,0,0xc0,0x03,0,0,0,0,0,0xfe,0x3f,0, -0,0xc0,0x3f,0xf8,0,0xf8,0x3f,0,0,0,0x3c,0,0,0,0, -0,0,0,0,0x3c,0,0,0x80,0xff,0xff,0xff,0x3f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff, -0x3f,0,0,0xc0,0x03,0,0,0,0,0,0xf0,0xff,0x0f,0,0, -0x7f,0x7c,0,0xfe,0x07,0,0,0,0x1e,0,0,0,0,0,0, -0,0,0x1e,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0, -0,0x80,0x07,0,0,0,0,0,0,0xff,0x7f,0,0,0xfc,0x3e, -0xe0,0x7f,0,0,0,0,0x1f,0,0,0,0,0,0,0,0, -0x1f,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,0,0x80, -0x07,0,0,0,0,0,0,0xff,0x7f,0,0,0xfc,0x3e,0xe0,0x7f, -0,0,0,0,0x1f,0,0,0,0,0,0,0,0,0x1f,0, -0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x01,0,0x80,0x0f,0, -0,0,0,0,0,0xf0,0xff,0x1f,0,0xf0,0x1f,0xfe,0x0f,0,0, -0,0x80,0x0f,0,0,0,0,0,0,0,0,0x07,0,0,0xfc, -0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0x0f,0,0,0, -0,0,0,0,0xfc,0xff,0x3f,0xc0,0xff,0xff,0,0,0,0,0xc0, -0x07,0,0,0,0,0,0,0,0x80,0x03,0,0,0xff,0xff,0xff, -0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0xff,0xff,0xff,0x0f,0,0,0x1e,0,0,0,0,0, -0,0,0,0xfe,0xff,0xff,0xff,0x1f,0,0,0,0,0xe0,0x03,0, -0,0,0,0,0,0,0xe0,0x03,0,0xc0,0xff,0xff,0xff,0x1f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0x80,0xff,0xff,0xff,0x7f,0,0,0x3c,0,0,0,0,0,0,0, -0,0,0xfc,0xff,0xff,0x03,0,0,0,0,0xf0,0x01,0,0,0, -0,0,0,0,0xf8,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff, -0xff,0xff,0x7f,0,0,0x3c,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0xff,0x03,0,0,0,0,0xf0,0x01,0,0,0,0,0, -0,0,0xf8,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff, -0xff,0,0,0x78,0,0,0,0,0,0,0,0,0,0,0xf8, -0xff,0x1f,0,0,0,0,0xf0,0,0,0,0,0,0,0,0, -0x7c,0,0,0xfc,0xff,0xff,0xff,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03, -0,0xf0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0x7f, -0,0,0,0,0x7c,0,0,0,0,0,0,0,0,0x3e,0, -0,0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0,0xe0, -0x01,0,0,0,0,0,0,0,0,0,0,0x7c,0xfe,0,0, -0,0,0x3c,0,0,0,0,0,0,0,0x80,0x1f,0,0xc0,0xff, -0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x1f,0,0xc0,0x03,0, -0,0,0,0,0,0,0,0,0,0x78,0xf8,0x03,0,0,0, -0x1e,0,0,0,0,0,0,0,0xc0,0x07,0,0xe0,0xff,0xff,0xff, -0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,0x80,0x07,0,0,0, -0,0,0,0,0,0,0,0x70,0xe0,0x0f,0,0,0,0x0f,0, -0,0,0,0,0,0,0xf0,0x03,0,0xf8,0xff,0xff,0xff,0x03,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x80,0xff,0xff,0xff,0x7f,0,0x80,0x07,0,0,0,0,0, -0,0,0,0,0,0x70,0xe0,0x0f,0,0,0,0x0f,0,0,0, -0,0,0,0,0xf0,0x03,0,0xf8,0xff,0xff,0xff,0x03,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xff,0xff,0xff,0xff,0,0x80,0x0f,0,0,0,0,0,0,0, -0,0,0,0x70,0,0x3f,0,0,0x80,0x0f,0,0,0,0,0, -0,0,0xf8,0x01,0,0xfe,0xff,0xff,0x7f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc, -0xff,0xff,0xff,0x03,0,0x1f,0,0,0,0,0,0,0,0,0, -0,0x70,0,0xfe,0,0,0xc0,0x03,0,0,0,0,0,0,0, -0x7e,0,0x80,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff, -0xff,0x0f,0,0x3e,0,0,0,0,0,0,0,0,0,0,0x70, -0,0xf8,0x01,0,0xc0,0x03,0,0,0,0,0,0,0,0x3e,0, -0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f, -0,0xf8,0,0,0,0,0,0,0,0,0,0,0x70,0,0x80, -0x0f,0,0xf0,0x01,0,0,0,0,0,0,0xc0,0x0f,0,0xf8,0xff, -0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,0,0xf8, -0,0,0,0,0,0,0,0,0,0,0x70,0,0x80,0x0f,0, -0xf0,0x01,0,0,0,0,0,0,0xc0,0x0f,0,0xf8,0xff,0xff,0xff, -0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,0,0xe0,0x01,0, -0,0,0,0,0,0,0,0,0x70,0,0,0x3e,0,0xf0,0, -0,0,0,0,0,0,0xe0,0x07,0,0xfe,0xff,0xff,0xff,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,0xc0,0x03,0,0,0, -0,0,0,0,0,0,0x70,0,0,0xfc,0,0x78,0,0,0, -0,0,0,0,0xf8,0x01,0x80,0xff,0xff,0xff,0x3f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xf0,0xff,0xff,0xff,0x0f,0xc0,0x07,0,0,0,0,0, -0,0,0,0,0x78,0,0,0xe0,0x03,0x3c,0,0,0,0,0, -0,0,0x7c,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0xff,0xff,0x1f,0,0x0f,0,0,0,0,0,0,0, -0,0,0x7c,0,0,0xc0,0x1f,0x1e,0,0,0,0,0,0,0, -0x3e,0,0xf0,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0xff,0xff,0x1f,0,0x0f,0,0,0,0,0,0,0,0,0, -0x7c,0,0,0xc0,0x1f,0x1e,0,0,0,0,0,0,0,0x3e,0, -0xf0,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff, -0xff,0x7f,0,0x1e,0,0,0,0,0,0,0,0,0,0x7c,0, -0,0,0x3f,0x0f,0,0,0,0,0,0,0x80,0x0f,0,0xfc,0xff, -0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff, -0x01,0x7c,0,0,0,0,0,0,0,0,0,0x3c,0,0,0, -0xfc,0x0f,0,0,0,0,0,0,0xe0,0x07,0,0xff,0xff,0xff,0x3f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,0x78, -0,0,0,0,0,0,0,0,0,0x3c,0,0,0,0xf8,0x07, -0,0,0,0,0,0,0xf0,0x01,0xc0,0xff,0xff,0xff,0x1f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0, -0,0,0,0,0,0,0,0x1c,0,0,0,0xfc,0x03,0,0, -0,0,0,0,0xf8,0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0,0,0, -0,0,0,0,0,0x1c,0,0,0,0xfc,0x03,0,0,0,0, -0,0,0xf8,0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xe0,0xff,0xff,0xff,0x1f,0xe0,0x03,0,0,0,0,0, -0,0,0,0x1c,0,0,0,0xfc,0x01,0,0,0,0,0,0, -0x7e,0,0xf8,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xff,0xff,0xff,0xff,0x80,0x0f,0,0,0,0,0,0,0, -0,0x1e,0,0,0,0xff,0,0,0,0,0,0,0x80,0x0f,0, -0xfe,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0xff,0xff,0x01,0x1f,0,0,0,0,0,0,0,0,0x0e, -0,0,0x80,0x7f,0,0,0,0,0,0,0xc0,0x07,0x80,0xff,0xff, -0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff, -0xff,0xff,0x07,0x3e,0,0,0,0,0,0,0,0,0x0e,0,0, -0xc0,0x3f,0,0,0,0,0,0,0xf0,0x01,0xe0,0xff,0xff,0xff,0x07, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff, -0x0f,0x7c,0,0,0,0,0,0,0,0,0x0f,0,0,0xe0,0x3f, -0,0,0,0,0,0,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,0x7c, -0,0,0,0,0,0,0,0,0x0f,0,0,0xe0,0x3f,0,0, -0,0,0,0,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,0xf0,0,0, -0,0,0,0,0,0,0x0f,0,0,0xf0,0x1f,0,0,0,0, -0,0,0x7e,0,0xfc,0xff,0xff,0xff,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xfe,0xff,0xff,0x7f,0xe0,0x01,0,0,0, -0,0,0,0x80,0x07,0,0,0xfc,0x1f,0,0,0,0,0,0, -0x3e,0,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xfc,0xff,0xff,0xff,0xe0,0x03,0,0,0,0,0, -0,0x80,0x07,0,0,0xfc,0x0f,0,0,0,0,0,0,0x1f,0xc0, -0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0xff,0xff,0xff,0xc1,0x07,0,0,0,0,0,0,0xc0, -0x03,0,0,0xfe,0x07,0,0,0,0,0,0xc0,0x0f,0xf0,0xff,0xff, -0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf0,0xff,0xff,0xff,0xc1,0x07,0,0,0,0,0,0,0xc0,0x03,0, -0,0xfe,0x07,0,0,0,0,0,0xc0,0x0f,0xf0,0xff,0xff,0xff,0x07, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff, -0xff,0xff,0x83,0x0f,0,0,0,0,0,0,0xc0,0x01,0,0,0xff, -0x07,0,0,0,0,0,0xc0,0x07,0xf8,0xff,0xff,0xff,0x03,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff, -0x0f,0x1e,0,0,0,0,0,0,0xe0,0x01,0,0xc0,0xef,0x03,0, -0,0,0,0,0xe0,0x01,0xff,0xff,0xff,0x7f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0x0f,0x1c, -0,0,0,0,0,0,0xf0,0,0,0xe0,0xf3,0x01,0,0,0, -0,0,0xf0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x1f,0x38,0,0, -0,0,0,0,0x70,0,0,0xf0,0xf9,0,0,0,0,0,0, -0x78,0xe0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xfc,0xff,0xff,0x1f,0x38,0,0,0,0, -0,0,0x70,0,0,0xf0,0xf9,0,0,0,0,0,0,0x78,0xe0, -0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf0,0xff,0xff,0x7f,0xf0,0,0,0,0,0,0, -0x78,0,0,0x78,0x7c,0,0,0,0,0,0,0x3c,0xf0,0xff,0xff, -0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x80,0xff,0xff,0xff,0xe0,0,0,0,0,0,0,0x78,0, -0,0x7e,0x7c,0,0,0,0,0,0,0x3c,0xf8,0xff,0xff,0xff,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xff,0xff,0xff,0xe0,0x01,0,0,0,0,0,0x3c,0,0,0x3e, -0x3e,0,0,0,0,0,0,0x1f,0xfe,0xff,0xff,0x7f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe, -0xff,0xff,0xc1,0x03,0,0,0,0,0,0x3c,0,0,0x0f,0x1e,0, -0,0,0,0,0,0x0f,0xfe,0xff,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff, -0xc1,0x03,0,0,0,0,0,0x3c,0,0,0x0f,0x1e,0,0,0, -0,0,0,0x0f,0xfe,0xff,0xff,0x1f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x83,0x07, -0,0,0,0,0,0x1e,0,0xc0,0x07,0x0f,0,0,0,0,0, -0x80,0x07,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0x07,0x0f,0,0, -0,0,0,0x0f,0,0xe0,0x83,0x0f,0,0,0,0,0,0x80,0xc7, -0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xc0,0xff,0xff,0x0f,0x0f,0,0,0,0, -0,0x07,0,0xf0,0x81,0x07,0,0,0,0,0,0xc0,0xc3,0xff,0xff, -0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xff,0xff,0x1f,0x1c,0,0,0,0,0x80,0x03, -0,0x7c,0xc0,0x03,0,0,0,0,0,0xe0,0xe1,0xff,0xff,0x7f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0xff,0x3f,0x3c,0,0,0,0,0xc0,0x03,0,0x3f, -0xe0,0x01,0,0,0,0,0,0xe0,0xe0,0xff,0xff,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfe,0xff,0x3f,0x3c,0,0,0,0,0xc0,0x03,0,0x3f,0xe0,0x01, -0,0,0,0,0,0xe0,0xe0,0xff,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8, -0xff,0x3f,0x3c,0,0,0,0,0xe0,0x01,0x80,0x1f,0xe0,0x01,0,0, -0,0,0,0xf0,0xe0,0xff,0xff,0x07,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0x3f, -0x38,0,0,0,0,0xe0,0,0xe0,0x07,0xf0,0,0,0,0,0, -0,0x78,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0, -0,0,0,0xf0,0,0xf0,0x03,0x70,0,0,0,0,0,0,0x78, -0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0, -0,0x70,0,0xfe,0,0x38,0,0,0,0,0,0,0x3c,0xfc,0xff, -0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,0,0x70, -0,0xfe,0,0x38,0,0,0,0,0,0,0x3c,0xfc,0xff,0x3f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,0,0x38,0x80,0x3f, -0,0x3c,0,0,0,0,0,0,0x1c,0xfc,0xff,0x3f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xfc,0xff,0x3f,0x38,0,0,0,0,0x1c,0xc0,0x0f,0,0x1c, -0,0,0,0,0,0,0x1e,0xfc,0xff,0x3f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0x1f,0x38,0,0,0,0,0x1e,0xf0,0x03,0,0x1e,0,0, -0,0,0,0,0x1e,0xfc,0xff,0x3f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff, -0x1f,0x38,0,0,0,0,0x0f,0x7f,0,0,0x0f,0,0,0,0, -0,0,0x0f,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x1f,0x38, -0,0,0,0,0x0f,0x7f,0,0,0x0f,0,0,0,0,0,0, -0x0f,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfe,0xff,0x1f,0x38,0,0, -0,0,0xe7,0x3f,0,0,0x07,0,0,0,0,0,0,0x0f,0xfc, -0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xff,0xff,0x0f,0x38,0,0,0,0x80, -0xfb,0x0f,0,0x80,0x03,0,0,0,0,0,0,0x07,0xfc,0xff,0x7f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xff,0xff,0x07,0x38,0,0,0,0xc0,0xff,0x01, -0,0xc0,0x03,0,0,0,0,0,0x80,0x07,0xf8,0xff,0xff,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xff,0xff,0x07,0x38,0,0,0,0xe0,0x3f,0,0,0xc0, -0x01,0,0,0,0,0,0xc0,0x03,0xf8,0xff,0xff,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xff,0xff,0x07,0x38,0,0,0,0xe0,0x3f,0,0,0xc0,0x01,0, -0,0,0,0,0xc0,0x03,0xf8,0xff,0xff,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff, -0xff,0x07,0x38,0,0,0,0xe0,0x0f,0,0,0xe0,0,0,0,0, -0,0,0xc0,0x03,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03, -0x38,0,0,0,0xf0,0x03,0,0,0xf0,0,0,0,0,0,0, -0xe0,0x01,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0x38,0, -0,0,0x70,0,0,0,0x70,0,0,0,0,0,0,0xe0,0x01, -0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xc0,0xff,0xff,0x01,0x38,0,0,0, -0,0,0,0,0x78,0,0,0,0,0,0,0xe0,0,0xf0,0xff, -0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0, -0,0,0x38,0,0,0,0,0,0,0xf0,0,0xf0,0xff,0xff,0x03, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,0,0, -0x38,0,0,0,0,0,0,0xf0,0,0xf0,0xff,0xff,0x03,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,0,0,0x3c,0, -0,0,0,0,0,0xf0,0,0xe0,0xff,0xff,0x07,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0, -0xff,0xff,0,0x38,0,0,0,0,0,0,0,0x1e,0,0,0, -0,0,0,0x78,0,0xe0,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f, -0,0x18,0,0,0,0,0,0,0,0x1e,0,0,0,0,0, -0,0x78,0,0xc0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0x18, -0,0,0,0,0,0,0,0x0f,0,0,0,0,0,0,0x3c, -0,0xc0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0x18,0,0, -0,0,0,0,0,0x0f,0,0,0,0,0,0,0x3c,0,0xc0, -0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf8,0xff,0x7f,0,0x1c,0,0,0,0, -0,0,0x80,0x07,0,0,0,0,0,0,0x3c,0,0x80,0xff,0xff, -0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0xff,0x3f,0,0x1c,0,0,0,0,0,0, -0x80,0x07,0,0,0,0,0,0,0x1e,0,0x80,0xff,0xff,0x1f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xfc,0xff,0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03, -0,0,0,0,0,0,0x1e,0,0x80,0xff,0xff,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,0,0, -0,0,0,0,0x1f,0,0,0xff,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff, -0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,0,0,0,0, -0,0,0x1f,0,0,0xff,0xff,0x1f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0, -0x1c,0,0,0,0,0,0,0xe0,0x01,0,0,0,0,0,0, -0x0f,0,0,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0x1c,0, -0,0,0,0,0,0xe0,0,0,0,0,0,0,0,0x0f,0, -0,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfe,0xff,0x07,0,0x1c,0,0,0, -0,0,0,0xf0,0,0,0,0,0,0,0x80,0x07,0,0,0xfe, -0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0, -0,0x70,0,0,0,0,0,0,0x80,0x07,0,0,0xfe,0xff,0x7f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,0,0x70, -0,0,0,0,0,0,0x80,0x07,0,0,0xfe,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,0,0x78,0,0, -0,0,0,0,0x80,0x07,0,0,0xfc,0xff,0x7f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff, -0xff,0x03,0,0x1e,0,0,0,0,0,0,0x38,0,0,0,0, -0,0,0x80,0x03,0,0,0xfc,0xff,0xff,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03, -0,0x1e,0,0,0,0,0,0,0x3c,0,0,0,0,0,0, -0xc0,0x03,0,0,0xfc,0xff,0xff,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0,0x1e, -0,0,0,0,0,0,0x1e,0,0,0,0,0,0,0xc0,0x03, -0,0,0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0,0x1e,0,0, -0,0,0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,0,0, -0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xc0,0xff,0xff,0x01,0,0x1e,0,0,0,0, -0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,0,0,0xf8,0xff, -0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xe0,0xff,0xff,0x01,0,0x1c,0,0,0,0,0,0, -0x0f,0,0,0,0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x01, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xe0,0xff,0xff,0,0,0x1c,0,0,0,0,0,0x80,0x07,0, -0,0,0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x01,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0, -0xff,0xff,0,0,0x3c,0,0,0,0,0,0x80,0x07,0,0,0, -0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f, -0,0,0x3c,0,0,0,0,0,0x80,0x03,0,0,0,0,0, -0,0xc0,0x01,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0, -0x3c,0,0,0,0,0,0x80,0x03,0,0,0,0,0,0,0xc0, -0x01,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0x38,0, -0,0,0,0,0xc0,0x03,0,0,0,0,0,0,0xc0,0x01,0, -0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf8,0xff,0x3f,0,0,0x38,0,0,0, -0,0,0xc0,0x01,0,0,0,0,0,0,0xc0,0x01,0,0,0xe0, -0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0xff,0x3f,0,0,0x38,0,0,0,0,0, -0xe0,0x01,0,0,0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff, -0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xfc,0xff,0x1f,0,0,0x38,0,0,0,0,0,0xe0,0, -0,0,0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,0x07,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0x1f,0,0,0x38,0,0,0,0,0,0xe0,0,0,0, -0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,0x07,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff, -0x1f,0,0,0x38,0,0,0,0,0,0xf0,0,0,0,0,0, -0,0,0xc0,0x01,0,0,0x80,0xff,0xff,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0, -0,0x38,0,0,0,0,0,0x78,0,0,0,0,0,0,0, -0xc0,0x03,0,0,0x80,0xff,0xff,0x0f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x38, -0,0,0,0,0,0x78,0,0,0,0,0,0,0,0xc0,0x03, -0,0,0,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x3c,0,0, -0,0,0,0x3c,0,0,0,0,0,0,0,0x80,0x07,0,0, -0,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x3c,0,0,0,0, -0,0x3c,0,0,0,0,0,0,0,0x80,0x07,0,0,0,0xff, -0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xff,0x07,0,0,0xfc,0x3f,0,0,0,0,0,0x3e, -0,0,0,0,0,0,0,0x80,0x07,0,0,0,0xfe,0xff,0x1f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x0f,0,0xe0,0xff,0xff,0x3f,0,0,0,0,0,0x1e,0,0, -0,0,0,0,0,0,0x0f,0,0,0,0xfe,0xff,0x3f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0xff,0xff,0x3f,0,0,0,0,0,0x0f,0,0,0,0, -0,0,0,0,0x0f,0,0,0,0xfe,0xff,0x3f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff, -0xff,0x0f,0x3c,0,0,0,0,0,0x0f,0,0,0,0,0,0, -0,0,0x0e,0,0,0,0xfc,0xff,0x3f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f, -0x3c,0,0,0,0,0,0x0f,0,0,0,0,0,0,0,0, -0x0e,0,0,0,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x01,0,0x38,0, -0,0,0,0x80,0x07,0,0,0,0,0,0,0,0,0x1e,0, -0,0,0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf0,0xff,0xff,0,0,0,0x38,0,0,0, -0,0x80,0x07,0,0,0,0,0,0,0,0,0x3c,0,0,0, -0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xff,0xff,0x03,0,0,0,0x38,0,0,0,0,0xc0, -0x03,0,0,0,0,0,0,0,0,0x78,0,0,0,0xf8,0xff, -0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0x1f,0,0,0,0,0x78,0,0,0,0,0xc0,0x01,0, -0,0,0,0,0,0,0,0x70,0,0,0,0xf8,0xff,0xff,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff, -0x01,0,0,0,0,0x70,0,0,0,0,0xe0,0x01,0,0,0, -0,0,0,0,0,0xf0,0x01,0,0,0xf0,0xff,0xff,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x01,0, -0,0,0,0x70,0,0,0,0,0xe0,0x01,0,0,0,0,0, -0,0,0,0xf0,0x01,0,0,0xf0,0xff,0xff,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xff,0xff,0x07,0,0xfe,0,0, -0,0x70,0,0,0,0,0xe0,0,0,0,0,0,0,0,0, -0,0xe0,0x03,0,0,0xf0,0xff,0xff,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf0,0xff,0x1f,0,0xf8,0xff,0,0,0,0x70, -0,0,0,0,0xf0,0,0,0,0,0,0,0,0,0,0xc0, -0x03,0,0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0x7f,0,0xe0,0xff,0x7f,0,0,0,0x70,0,0, -0,0,0xf8,0,0,0,0,0,0,0,0,0,0x80,0x0f,0, -0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xe0,0xff,0x03,0,0xf0,0xff,0x3f,0,0,0,0x70,0,0,0,0, -0x78,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0xe0, -0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff, -0x03,0,0xf0,0xff,0x3f,0,0,0,0x70,0,0,0,0,0x78,0, -0,0,0,0,0,0,0,0,0,0x1f,0,0,0xe0,0xff,0xff, -0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0x7f,0,0, -0xf8,0xff,0x3f,0,0,0,0x70,0,0,0,0,0x78,0,0,0, -0,0,0,0,0,0,0,0x7c,0,0,0xe0,0xff,0xff,0x03,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0x80,0xff,0x07,0,0,0xf8,0xff, -0x1f,0,0,0,0xe0,0,0,0,0,0x3c,0,0,0,0,0, -0,0,0,0,0,0xf8,0x01,0,0xe0,0xff,0xff,0x03,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xc0,0xff,0,0,0,0xfc,0xff,0x1f,0, -0,0,0xe0,0,0,0,0,0x3c,0,0,0,0,0,0,0, -0,0,0,0xe0,0x07,0,0xc0,0xff,0xff,0x03,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xc0,0x1f,0,0,0,0xfe,0xff,0x1f,0,0,0, -0xe0,0,0,0,0,0x3c,0,0,0x60,0,0,0,0,0,0, -0,0xc0,0x3f,0,0xc0,0xff,0xff,0x07,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xc0,0x1f,0,0,0,0xfe,0xff,0x1f,0,0,0,0xe0,0, -0,0,0,0x3c,0,0,0x60,0,0,0,0,0,0,0,0xc0, -0x3f,0,0xc0,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0x80,0x03,0,0,0,0xfe,0xff,0x0f,0,0,0,0xe0,0,0,0, -0,0x3e,0,0,0x70,0,0,0,0,0,0,0,0,0xff,0x01, -0x80,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0xff,0x0f,0,0,0,0xe0,0,0,0,0,0x3f, -0,0,0x38,0,0,0,0,0,0,0,0,0xf8,0x3f,0x80,0xff, -0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xff,0xff,0x07,0,0,0,0xc0,0x01,0,0,0,0xff,0,0, -0x38,0,0,0,0,0,0,0,0,0xc0,0xff,0,0xfc,0xff,0x0f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff, -0xff,0x07,0,0,0,0xc0,0x01,0,0,0,0xf7,0x03,0,0x3c,0, -0,0,0,0,0,0,0,0,0xff,0x0f,0xc0,0xff,0x0f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0x07, -0,0,0,0xc0,0x01,0,0,0,0xf7,0x03,0,0x3c,0,0,0, -0,0,0,0,0,0,0xff,0x0f,0xc0,0xff,0x0f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0, -0,0xc0,0x01,0,0,0x80,0xe3,0x0f,0,0x3f,0,0,0,0,0, -0,0,0,0,0xf0,0x7f,0,0xf8,0x1f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,0,0xc0, -0x01,0,0,0x80,0xe3,0xff,0xff,0x3f,0,0,0,0,0,0,0, -0,0,0x80,0xff,0x03,0x80,0x0f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,0,0xc0,0x01,0, -0,0x80,0xc3,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0xfe,0x1f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xc0,0xff,0xff,0x01,0,0,0,0xc0,0x01,0,0,0xc0, -0x01,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0xe0, -0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0xff,0,0,0,0,0xc0,0x01,0,0,0xc0,0x01,0xfe, -0x7f,0x38,0,0,0,0,0,0,0,0,0,0,0,0xfe,0x1f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0xff,0,0,0,0,0xc0,0x01,0,0,0xc0,0x01,0xfe,0x7f,0x38, -0,0,0,0,0,0,0,0,0,0,0,0xfe,0x1f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff, -0,0,0,0,0xc1,0x01,0,0,0xe0,0,0x3e,0,0x38,0,0, -0,0,0,0,0,0,0,0,0,0xf0,0xff,0x01,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0,0, -0,0x80,0xc3,0x01,0,0,0xe0,0,0x7c,0,0x3c,0,0,0,0, -0,0,0,0,0,0,0,0,0xff,0x7f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0,0xf0, -0xc3,0x01,0,0,0xf0,0,0xf0,0,0x3c,0,0,0,0,0,0, -0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf8,0xff,0x7f,0,0,0,0xf8,0xc3,0x01, -0,0,0xf0,0,0xe0,0x01,0x3c,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf8,0xff,0x7f,0,0,0,0xf8,0xc3,0x01,0,0, -0xf0,0,0xe0,0x01,0x3c,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf8,0xff,0x7f,0,0,0,0xff,0xc3,0x03,0,0,0x70,0, -0xc0,0x03,0x3c,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x80,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf8,0xff,0x3f,0,0,0x80,0xff,0xc3,0x03,0,0,0x70,0,0xc0,0x03, -0x3c,0,0,0,0,0,0,0,0,0,0,0,0xf0,0x01,0, -0xf0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff, -0x1f,0,0,0xe0,0xff,0xc3,0x03,0,0,0x78,0,0x80,0x07,0x3c,0, -0,0,0,0,0,0,0,0,0,0,0xf0,0x7f,0,0,0, -0xfc,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0, -0,0xf8,0xff,0xc3,0x03,0,0,0x78,0,0,0x0f,0x3c,0,0,0, -0,0,0,0,0,0,0,0,0xe0,0xff,0x0f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,0,0xf8, -0xff,0xc3,0x03,0,0,0x78,0,0,0x0f,0x3c,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0xff,0x0f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfc,0xff,0x0f,0,0,0xfe,0xff,0x83, -0x03,0,0,0x3c,0,0,0x1e,0x1c,0,0,0,0,0,0,0, -0,0xfc,0xff,0x01,0xe0,0xff,0xff,0x01,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0xff,0x0f,0,0x80,0xff,0xff,0x87,0x03,0, -0,0x3c,0,0,0x3c,0x1c,0,0,0,0,0,0,0xf8,0xff,0xff, -0xff,0xff,0xe1,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0xff,0x0f,0,0xc0,0xff,0xff,0x87,0x03,0,0,0x3c, -0,0,0x78,0x1c,0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0xff, -0xe1,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xff,0xff,0x07,0,0xf8,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0, -0xe0,0x1c,0,0,0,0x80,0xff,0xff,0xff,0x01,0,0,0,0xc0,0xff, -0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff, -0xff,0x07,0,0xf8,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0xe0,0x1c, -0,0,0,0x80,0xff,0xff,0xff,0x01,0,0,0,0xc0,0xff,0xff,0x03, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0x03, -0,0xfe,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0xe0,0x1f,0,0, -0,0xf0,0xff,0xff,0,0,0,0,0,0x80,0xff,0xff,0x07,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0xff, -0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0x80,0x1f,0,0,0,0xff, -0xff,0x03,0,0,0,0xfc,0x03,0x80,0xff,0xff,0x07,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0xc0,0xff,0xff,0xff, -0xc7,0x03,0,0,0x1e,0,0,0,0x1f,0,0,0xf8,0xff,0x0f,0, -0x80,0xff,0xff,0xff,0x1f,0,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0xff,0x01,0xf0,0xff,0xff,0xff,0xc3,0x03, -0,0,0xfe,0xff,0,0,0x1f,0,0xe0,0xff,0x3f,0,0,0x80,0xff, -0xff,0xff,0x3f,0,0xff,0xff,0x07,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0,0, -0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0x80,0xff,0xff,0xff, -0x7f,0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0,0,0xfe,0xff, -0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0x80,0xff,0xff,0xff,0x7f,0, -0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0, -0xff,0xff,0x01,0xff,0xff,0xff,0xff,0x80,0x03,0,0,0xfe,0xff,0xff,0xff, -0xff,0xff,0xff,0x07,0,0,0,0,0xfe,0xff,0xff,0xff,0x01,0xfe,0xff, -0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff, -0x80,0xff,0xff,0xff,0x3f,0,0,0,0,0x7c,0,0,0xf5,0xff,0xff, -0x3f,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x07,0xfe,0xff,0x1f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0xf0,0xff, -0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf0,0xff,0xff,0xff,0x1f,0xfe,0xff,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff, -0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,0x03,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf0,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff, -0xff,0xff,0xff,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf8,0xff,0xff,0xff,0xff,0xff,0x3f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff, -0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf8,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0xff, -0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff, -0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff, -0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0xff,0xff, -0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0xff,0x7f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0x3f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfc,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0, -0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfe,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff, -0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe, -0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff, -0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff, -0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0x01, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0x3f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0x01,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0x1f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0x07,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xf0,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xc0,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xf0,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff, -0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff, -0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff, -0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x0f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x0f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x03,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xf8,0xff,0xff,0xff,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf0,0xff,0xff,0xff,0x01,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf8,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xf8,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff, -0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff, -0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x07, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x3f, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x3f,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xfe,0xff,0xff,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0xe0,0xff,0xff,0x3f,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0xfe,0xff,0x3f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0xff,0x3f,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xfe,0xff,0x3f,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0x80,0xff,0xff,0x3f,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xfe,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xfe,0xff,0x7f,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff, -0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff, -0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0x3f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0x7f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xfe,0xff,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0xc0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xfc,0xff,0x01,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0, -0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xf0,0xff,0x01,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x1f,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0xc0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xe0,0x1f,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff, -0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xe0,0x0f,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0x01,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0xfe,0x03,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0x78,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0xf8,0x03,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0x18,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0x18,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0xc0,0x07,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0, -0,0,0,0,0,0,0,0,0,0,0,0,0,0,0 -}; diff --git a/hacks/drift.c b/hacks/drift.c index 50870708..a9995832 100644 --- a/hacks/drift.c +++ b/hacks/drift.c @@ -35,9 +35,7 @@ static const char sccsid[] = "@(#)drift.c 4.02 97/04/01 xlockmore"; # define drift_opts xlockmore_opts # define DEFAULTS "*count: 30 \n" \ "*delay: 10000 \n" \ - "*ncolors: 200 \n" \ - "*eraseSpeed: 400 \n" \ - "*eraseMode: -1 \n" + "*ncolors: 200 \n" # define SMOOTH_COLORS # include "xlockmore.h" /* from the xscreensaver distribution */ # include "erase.h" diff --git a/hacks/flag.c b/hacks/flag.c index 1c2c5054..643aff10 100644 --- a/hacks/flag.c +++ b/hacks/flag.c @@ -24,6 +24,9 @@ static const char sccsid[] = "@(#)flag.c 4.02 97/04/01 xlockmore"; * other special, indirect and consequential damages. * * Revision History: + * 22-Jan-98: jwz: made the flag wigglier; added xpm support. + * (I tried to do this by re-porting from xlockmore, but the + * current xlockmore version is completely inscrutable.) * 13-May-97: jwz@netscape.com: turned into a standalone program. * Made it able to animate arbitrary (runtime) text or bitmaps. * 01-May-96: written. @@ -45,6 +48,13 @@ static const char sccsid[] = "@(#)flag.c 4.02 97/04/01 xlockmore"; # define DEF_TEXT "" # include "xlockmore.h" /* from the xscreensaver distribution */ +# ifdef HAVE_XPM +# include +# ifndef PIXEL_ALREADY_TYPEDEFED +# define PIXEL_ALREADY_TYPEDEFED /* Sigh, Xmu/Drawing.h needs this... */ +# endif +# endif + #ifdef HAVE_XMU # ifndef VMS # include @@ -53,7 +63,7 @@ static const char sccsid[] = "@(#)flag.c 4.02 97/04/01 xlockmore"; # endif /* VMS */ #endif /* HAVE_XMU */ -#include "bob.xbm" +#include "images/bob.xbm" #else /* !STANDALONE */ # include "xlock.h" /* from the xlockmore distribution */ @@ -69,8 +79,21 @@ static const char sccsid[] = "@(#)flag.c 4.02 97/04/01 xlockmore"; # include #endif /* HAVE_UNAME */ +#ifdef STANDALONE +static XrmOptionDescRec opts[] = +{ + { "-bitmap", ".flag.bitmap", XrmoptionSepArg, 0 } +}; + +#endif /* STANDALONE */ + ModeSpecOpt flag_opts = { - 0, NULL, 0, NULL, NULL }; +#ifdef STANDALONE + 1, opts, 0, NULL, NULL +#else /* !STANDALONE */ + 0, NULL, 0, NULL, NULL +#endif /* STANDALONE */ +}; #include #include @@ -119,8 +142,18 @@ initSintab(ModeInfo * mi) flagstruct *fp = &flags[MI_SCREEN(mi)]; int i; + /*- + * change the periodicity of the sin formula : the maximum of the + * periocity seem to be 16 ( 2^4 ), after the drawing isn't good looking + */ + int periodicity = random_num(4); + int puissance = 1; + + /* for (i=0;istab[i] = (int) (SINF(i * 4 * M_PI / ANGLES) * fp->samp) + fp->sofs; + fp->stab[i] = (int) (SINF(i * puissance * M_PI / ANGLES) * fp->samp) + + fp->sofs; } static void @@ -136,13 +169,18 @@ affiche(ModeInfo * mi) fp->stab[(fp->sidx + x + y) % ANGLES]; yp = (int) (fp->size * (float) y) + fp->stab[(fp->sidx + 4 * x + y + y) % ANGLES]; - if (XGetPixel(fp->image, x, y)) + + if (fp->image->depth > 1) + XSetForeground(display, MI_GC(mi), + XGetPixel(fp->image, x, y)); + else if (XGetPixel(fp->image, x, y)) XSetForeground(display, MI_GC(mi), MI_WIN_BLACK_PIXEL(mi)); else if (MI_NPIXELS(mi) <= 2) XSetForeground(display, MI_GC(mi), MI_WIN_WHITE_PIXEL(mi)); else XSetForeground(display, MI_GC(mi), MI_PIXEL(mi, (y + x + fp->sidx + fp->startcolor) % MI_NPIXELS(mi))); + if (fp->pointsize <= 1) XDrawPoint(display, fp->cache, MI_GC(mi), xp, yp); else if (fp->pointsize < 6) @@ -184,20 +222,91 @@ make_flag_bits(ModeInfo *mi) *bitmap_name && !!strcmp(bitmap_name, "(default)")) { +#ifdef HAVE_XPM + Window window = MI_WINDOW(mi); + XWindowAttributes xgwa; + XpmAttributes xpmattrs; + int result; + Pixmap bitmap = 0; + int width = 0, height = 0; + xpmattrs.valuemask = 0; + + XGetWindowAttributes (dpy, window, &xgwa); + +# ifdef XpmCloseness + xpmattrs.valuemask |= XpmCloseness; + xpmattrs.closeness = 40000; +# endif +# ifdef XpmVisual + xpmattrs.valuemask |= XpmVisual; + xpmattrs.visual = xgwa.visual; +# endif +# ifdef XpmDepth + xpmattrs.valuemask |= XpmDepth; + xpmattrs.depth = xgwa.depth; +# endif +# ifdef XpmColormap + xpmattrs.valuemask |= XpmColormap; + xpmattrs.colormap = xgwa.colormap; +# endif + + /* Uh, we don't need these now. We use the colors from the xpm. + It kinda sucks that we already allocated them. */ + XFreeColors(dpy, xgwa.colormap, mi->pixels, mi->npixels, 0L); + + result = XpmReadFileToPixmap (dpy, window, bitmap_name, &bitmap, 0, + &xpmattrs); + switch (result) + { + case XpmColorError: + fprintf (stderr, "%s: warning: xpm color substitution performed\n", + progname); + /* fall through */ + case XpmSuccess: + width = xpmattrs.width; + height = xpmattrs.height; + break; + case XpmFileInvalid: + case XpmOpenFailed: + bitmap = 0; + break; + case XpmColorFailed: + fprintf (stderr, "%s: xpm: color allocation failed\n", progname); + exit (-1); + case XpmNoMemory: + fprintf (stderr, "%s: xpm: out of memory\n", progname); + exit (-1); + default: + fprintf (stderr, "%s: xpm: unknown error code %d\n", progname, + result); + exit (-1); + } + + if (bitmap) + { + fp->image = XGetImage(dpy, bitmap, 0, 0, width, height, ~0L, + ZPixmap); + XFreePixmap(dpy, bitmap); + } + else +#endif /* HAVE_XPM */ + #ifdef HAVE_XMU - int width, height, xh, yh; - Pixmap bitmap = - XmuLocateBitmapFile (DefaultScreenOfDisplay (dpy), - bitmap_name, 0, 0, &width, &height, &xh, &yh); - if (!bitmap) { - fprintf(stderr, "%s: unable to load bitmap file %s\n", - progname, bitmap_name); - exit (1); + int width, height, xh, yh; + Pixmap bitmap = + XmuLocateBitmapFile (DefaultScreenOfDisplay (dpy), + bitmap_name, 0, 0, &width, &height, &xh, &yh); + if (!bitmap) + { + fprintf(stderr, "%s: unable to load bitmap file %s\n", + progname, bitmap_name); + exit (1); + } + fp->image = XGetImage(dpy, bitmap, 0, 0, width, height, + 1L, XYPixmap); + XFreePixmap(dpy, bitmap); } - fp->image = XGetImage(dpy, bitmap, 0, 0, width, height, - 1L, XYPixmap); - XFreePixmap(dpy, bitmap); #else /* !XMU */ fprintf (stderr, diff --git a/hacks/forest.c b/hacks/forest.c index 4d4b9d6e..54fe8073 100644 --- a/hacks/forest.c +++ b/hacks/forest.c @@ -33,9 +33,7 @@ static const char sccsid[] = "@(#)forest.c 4.03 97/05/10 xlockmore"; # define DEFAULTS "*count: 100 \n" \ "*cycles: 200 \n" \ "*delay: 400000 \n" \ - "*ncolors: 100 \n" \ - "*eraseSpeed: 400 \n" \ - "*eraseMode: -1 \n" + "*ncolors: 100 \n" # define UNIFORM_COLORS # include "xlockmore.h" /* from the xscreensaver distribution */ # include "erase.h" diff --git a/hacks/glx/Makefile.in b/hacks/glx/Makefile.in index 2f8292b6..686223b0 100644 --- a/hacks/glx/Makefile.in +++ b/hacks/glx/Makefile.in @@ -55,17 +55,18 @@ UTIL_OBJS = $(UTILS_SRC)/colors.o $(UTILS_SRC)/hsv.o \ $(UTILS_SRC)/resources.o $(UTILS_SRC)/usleep.o \ $(UTILS_SRC)/visual.o $(UTILS_SRC)/yarandom.o -SRCS = buildlwo.c escher.c gears.c morph3d.c pipeobjs.c pipes.c \ - s1_1.c s1_2.c s1_3.c s1_4.c s1_5.c s1_6.c s1_b.c \ - sproingies.c sproingiewrap.c superquadrics.c rubik.c \ - xlock-gl.c - -OBJS = buildlwo.o escher.o gears.o morph3d.o pipeobjs.o pipes.o \ - s1_1.o s1_2.o s1_3.o s1_4.o s1_5.o s1_6.o s1_b.o \ - sproingies.o sproingiewrap.o superquadrics.o rubik.o \ - xlock-gl.o - -GL_EXES = escher gears pipes sproingies superquadrics morph3d rubik +SRCS = buildlwo.c cage.c gears.c moebius.c morph3d.c \ + pipeobjs.c pipes.c rubik.c s1_1.c s1_2.c s1_3.c s1_4.c \ + s1_5.c s1_6.c s1_b.c sproingies.c sproingiewrap.c stairs.c \ + superquadrics.c xlock-gl.c + +OBJS = buildlwo.o cage.o gears.o moebius.o morph3d.o \ + pipeobjs.o pipes.o rubik.o s1_1.o s1_2.o s1_3.o s1_4.o \ + s1_5.o s1_6.o s1_b.o sproingies.o sproingiewrap.o stairs.o \ + superquadrics.o xlock-gl.o + +GL_EXES = cage gears moebius pipes sproingies stairs superquadrics \ + morph3d rubik EXES = @GL_EXES@ HACK_OBJS = screenhack-gl.o xlock-gl.o $(HACK_BIN)/xlockmore.o \ @@ -146,7 +147,8 @@ distdepend: -e 's@\.\./\.\./utils@$$(UTILS_SRC)@g' \ -e 's@\.\./glx/@@g' \ -e 's@ \.\./@ $$(HACK_SRC)/@g' \ - -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' ; \ + -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \ + -e 's@ $$(srcdir)/\(.*config.h\)@ \1@g' ; \ echo '' \ ) > /tmp/distdepend.$$$$ && \ mv Makefile.in Makefile.in.bak && \ @@ -192,25 +194,31 @@ screenhack-gl.o: $(HACK_SRC)/screenhack.c CC_HACK = $(CC) $(LDFLAGS) -gears: gears.o $(HACK_OBJS) +cage: cage.o $(HACK_OBJS) $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) -superquadrics: superquadrics.o $(HACK_OBJS) +gears: gears.o $(HACK_OBJS) $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) -escher: escher.o $(HACK_OBJS) +moebius: moebius.o $(HACK_OBJS) $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) pipes: pipes.o $(HACK_OBJS) pipeobjs.o buildlwo.o $(CC_HACK) -o $@ $@.o $(HACK_OBJS) pipeobjs.o buildlwo.o \ $(HACK_LIBS) +superquadrics: superquadrics.o $(HACK_OBJS) + $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) + morph3d: morph3d.o $(HACK_OBJS) $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) rubik: rubik.o $(HACK_OBJS) $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) +stairs: stairs.o $(HACK_OBJS) + $(CC_HACK) -o $@ $@.o $(HACK_OBJS) $(HACK_LIBS) + SPROINGIES = sproingiewrap.o buildlwo.o \ s1_1.o s1_2.o s1_3.o s1_4.o s1_5.o s1_6.o s1_b.o sproingies: sproingies.o $(HACK_OBJS) $(SPROINGIES) @@ -222,18 +230,18 @@ sproingies: sproingies.o $(HACK_OBJS) $(SPROINGIES) # DO NOT DELETE: updated by make distdepend buildlwo.o: $(srcdir)/buildlwo.h -escher.o: $(HACK_SRC)/xlockmore.h -escher.o: $(HACK_SRC)/../config.h -escher.o: $(HACK_SRC)/xlockmoreI.h -escher.o: $(HACK_SRC)/screenhack.h -escher.o: $(UTILS_SRC)/yarandom.h -escher.o: $(UTILS_SRC)/usleep.h -escher.o: $(UTILS_SRC)/resources.h -escher.o: $(UTILS_SRC)/hsv.h -escher.o: $(UTILS_SRC)/colors.h -escher.o: $(UTILS_SRC)/grabscreen.h -escher.o: $(UTILS_SRC)/visual.h -escher.o: $(srcdir)/e_textures.h +cage.o: $(HACK_SRC)/xlockmore.h +cage.o: $(HACK_SRC)/../config.h +cage.o: $(HACK_SRC)/xlockmoreI.h +cage.o: $(HACK_SRC)/screenhack.h +cage.o: $(UTILS_SRC)/yarandom.h +cage.o: $(UTILS_SRC)/usleep.h +cage.o: $(UTILS_SRC)/resources.h +cage.o: $(UTILS_SRC)/hsv.h +cage.o: $(UTILS_SRC)/colors.h +cage.o: $(UTILS_SRC)/grabscreen.h +cage.o: $(UTILS_SRC)/visual.h +cage.o: $(srcdir)/e_textures.h gears.o: $(HACK_SRC)/xlockmore.h gears.o: $(HACK_SRC)/../config.h gears.o: $(HACK_SRC)/xlockmoreI.h @@ -245,6 +253,18 @@ gears.o: $(UTILS_SRC)/hsv.h gears.o: $(UTILS_SRC)/colors.h gears.o: $(UTILS_SRC)/grabscreen.h gears.o: $(UTILS_SRC)/visual.h +moebius.o: $(HACK_SRC)/xlockmore.h +moebius.o: $(HACK_SRC)/../config.h +moebius.o: $(HACK_SRC)/xlockmoreI.h +moebius.o: $(HACK_SRC)/screenhack.h +moebius.o: $(UTILS_SRC)/yarandom.h +moebius.o: $(UTILS_SRC)/usleep.h +moebius.o: $(UTILS_SRC)/resources.h +moebius.o: $(UTILS_SRC)/hsv.h +moebius.o: $(UTILS_SRC)/colors.h +moebius.o: $(UTILS_SRC)/grabscreen.h +moebius.o: $(UTILS_SRC)/visual.h +moebius.o: $(srcdir)/e_textures.h morph3d.o: $(HACK_SRC)/xlockmore.h morph3d.o: $(HACK_SRC)/../config.h morph3d.o: $(HACK_SRC)/xlockmoreI.h @@ -269,6 +289,17 @@ pipes.o: $(UTILS_SRC)/colors.h pipes.o: $(UTILS_SRC)/grabscreen.h pipes.o: $(UTILS_SRC)/visual.h pipes.o: $(srcdir)/buildlwo.h +rubik.o: $(HACK_SRC)/xlockmore.h +rubik.o: $(HACK_SRC)/../config.h +rubik.o: $(HACK_SRC)/xlockmoreI.h +rubik.o: $(HACK_SRC)/screenhack.h +rubik.o: $(UTILS_SRC)/yarandom.h +rubik.o: $(UTILS_SRC)/usleep.h +rubik.o: $(UTILS_SRC)/resources.h +rubik.o: $(UTILS_SRC)/hsv.h +rubik.o: $(UTILS_SRC)/colors.h +rubik.o: $(UTILS_SRC)/grabscreen.h +rubik.o: $(UTILS_SRC)/visual.h s1_1.o: $(srcdir)/buildlwo.h s1_2.o: $(srcdir)/buildlwo.h s1_3.o: $(srcdir)/buildlwo.h @@ -298,6 +329,18 @@ sproingiewrap.o: $(UTILS_SRC)/hsv.h sproingiewrap.o: $(UTILS_SRC)/colors.h sproingiewrap.o: $(UTILS_SRC)/grabscreen.h sproingiewrap.o: $(UTILS_SRC)/visual.h +stairs.o: $(HACK_SRC)/xlockmore.h +stairs.o: $(HACK_SRC)/../config.h +stairs.o: $(HACK_SRC)/xlockmoreI.h +stairs.o: $(HACK_SRC)/screenhack.h +stairs.o: $(UTILS_SRC)/yarandom.h +stairs.o: $(UTILS_SRC)/usleep.h +stairs.o: $(UTILS_SRC)/resources.h +stairs.o: $(UTILS_SRC)/hsv.h +stairs.o: $(UTILS_SRC)/colors.h +stairs.o: $(UTILS_SRC)/grabscreen.h +stairs.o: $(UTILS_SRC)/visual.h +stairs.o: $(srcdir)/e_textures.h superquadrics.o: $(HACK_SRC)/xlockmore.h superquadrics.o: $(HACK_SRC)/../config.h superquadrics.o: $(HACK_SRC)/xlockmoreI.h @@ -309,17 +352,6 @@ superquadrics.o: $(UTILS_SRC)/hsv.h superquadrics.o: $(UTILS_SRC)/colors.h superquadrics.o: $(UTILS_SRC)/grabscreen.h superquadrics.o: $(UTILS_SRC)/visual.h -rubik.o: $(HACK_SRC)/xlockmore.h -rubik.o: $(HACK_SRC)/../config.h -rubik.o: $(HACK_SRC)/xlockmoreI.h -rubik.o: $(HACK_SRC)/screenhack.h -rubik.o: $(UTILS_SRC)/yarandom.h -rubik.o: $(UTILS_SRC)/usleep.h -rubik.o: $(UTILS_SRC)/resources.h -rubik.o: $(UTILS_SRC)/hsv.h -rubik.o: $(UTILS_SRC)/colors.h -rubik.o: $(UTILS_SRC)/grabscreen.h -rubik.o: $(UTILS_SRC)/visual.h xlock-gl.o: $(HACK_SRC)/screenhack.h xlock-gl.o: $(HACK_SRC)/../config.h xlock-gl.o: $(UTILS_SRC)/yarandom.h diff --git a/hacks/glx/README b/hacks/glx/README index 83a795b6..682fa3c9 100644 --- a/hacks/glx/README +++ b/hacks/glx/README @@ -1,6 +1,10 @@ -This directory contains various graphics hacks that requre GL. These are -independent from the xscreensaver program (in the ../../driver/ directory) +This directory contains various graphics hacks that requre OpenGL. These are +independent from the xscreensaver program (in the ../../driver/ directory) but some of them use the utility functions found in the ../../utils/ directory. If you have compilation problems, check the parameters in ../../config.h. + +If you're looking for a free implementation of the OpenGL library, check +out . For general OpenGL info, +see . diff --git a/hacks/glx/cage.c b/hacks/glx/cage.c new file mode 100644 index 00000000..10edcbf7 --- /dev/null +++ b/hacks/glx/cage.c @@ -0,0 +1,452 @@ +/* -*- Mode: C; tab-width: 4 -*- */ +/* cage --- the Impossible Cage, an Escher like scene. */ + +#if !defined( lint ) && !defined( SABER ) +static const char sccsid[] = "@(#)cage.c 4.07 98/01/04 xlockmore"; + +#endif + +#undef DEBUG_LISTS + +/*- + * Permission to use, copy, modify, and distribute this software and its + * documentation for any purpose and without fee is hereby granted, + * provided that the above copyright notice appear in all copies and that + * both that copyright notice and this permission notice appear in + * supporting documentation. + * + * This file is provided AS IS with no warranties of any kind. The author + * shall have no liability with respect to the infringement of copyrights, + * trade secrets or any patents by this file or any part thereof. In no + * event will the author be liable for any lost revenue or profits or + * other special, indirect and consequential damages. + * + * The RotateAroundU() routine was adapted from the book + * "Computer Graphics Principles and Practice + * Foley - vanDam - Feiner - Hughes + * Second Edition" Pag. 227, exercise 5.15. + * + * This mode shows some interesting scenes that are impossible OR very + * wierd to build in the real universe. Much of the scenes are inspirated + * on Mauritz Cornelis Escher's works which derivated the mode's name. + * M.C. Escher (1898-1972) was a dutch artist and many people prefer to + * say he was a mathematician. + * + * Thanks goes to Brian Paul for making it possible and inexpensive to use + * OpenGL at home. + * + * Since I'm not a native English speaker, my apologies for any grammatical + * mistake. + * + * My e-mail addresses are + * vianna@cat.cbpf.br + * and + * m-vianna@usa.net + * + * Marcelo F. Vianna (Jun-01-1997) + * + * Revision History: + * 01-Jan-98: Mode separated from escher and renamed + * 08-Jun-97: New scene implemented: "Impossible Cage" based in a M.C. Escher's + * painting with the same name (quite similar). The first GL mode + * to use texture mapping. + * The "Impossible Cage" scene doesn't use DEPTH BUFFER, the + * wood planks are drawn consistently using GL_CULL_FACE, and + * the painter's algorithm is used to sort the planks. + * Marcelo F. Vianna. + * 07-Jun-97: Speed ups in Moebius Strip using GL_CULL_FACE. + * Marcelo F. Vianna. + * 03-Jun-97: Initial Release (Only one scene: "Moebius Strip") + * The Moebius Strip scene was inspirated in a M.C. Escher's + * painting named Moebius Strip II in wich ants walk across a + * Moebius Strip path, sometimes meeting each other and sometimes + * being in "opposite faces" (note that the moebius strip has + * only one face and one edge). + * Marcelo F. Vianna. + * + */ + +/*- + * Texture mapping is only available on RGBA contexts, Mono and color index + * visuals DO NOT support texture mapping in OpenGL. + * + * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture + * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono + * is not officially supported for both OpenGL and Mesa, but seems to not crash + * Mesa. + * + * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know). + */ + +#include + +#ifdef STANDALONE +# define PROGCLASS "Cage" +# define HACK_INIT init_cage +# define HACK_DRAW draw_cage +# define cage_opts xlockmore_opts +# define DEFAULTS "*cycles: 1 \n" \ + "*delay: 1000 \n" \ + "*wireframe: False \n" +# include "xlockmore.h" /* from the xscreensaver distribution */ +#else /* !STANDALONE */ +# include "xlock.h" /* from the xlockmore distribution */ + +#endif /* !STANDALONE */ + +#ifdef USE_GL + + +#include +#include "e_textures.h" + +ModeSpecOpt cage_opts = +{0, NULL, 0, NULL, NULL}; + +#ifdef USE_MODULES +ModStruct cage_description = +{"cage", "init_cage", "draw_cage", "release_cage", + "draw_cage", "change_cage", NULL, &cage_opts, + 1000, 1, 1, 1, 1.0, "", + "Shows the Impossible Cage, an Escher-like GL scene", 0, NULL}; + +#endif + +#define Scale4Window 0.3 +#define Scale4Iconic 0.4 + +#define sqr(A) ((A)*(A)) + +#ifndef Pi +#define Pi M_PI +#endif + +/*************************************************************************/ + +typedef struct { + GLint WindH, WindW; + GLfloat step; + int AreObjectsDefined[1]; + GLXContext *glx_context; +} cagestruct; + +static float front_shininess[] = +{60.0}; +static float front_specular[] = +{0.7, 0.7, 0.7, 1.0}; +static float ambient[] = +{0.0, 0.0, 0.0, 1.0}; +static float diffuse[] = +{1.0, 1.0, 1.0, 1.0}; +static float position0[] = +{1.0, 1.0, 1.0, 0.0}; +static float position1[] = +{-1.0, -1.0, 1.0, 0.0}; +static float lmodel_ambient[] = +{0.5, 0.5, 0.5, 1.0}; +static float lmodel_twoside[] = +{GL_TRUE}; + +static float MaterialWhite[] = +{0.7, 0.7, 0.7, 1.0}; + +static cagestruct *cage = NULL; +static GLuint objects; + +#define ObjWoodPlank 0 + +#define PlankWidth 3.0 +#define PlankHeight 0.35 +#define PlankThickness 0.15 + +static void +draw_woodplank(cagestruct * cp) +{ + if (!cp->AreObjectsDefined[ObjWoodPlank]) { + glNewList(objects + ObjWoodPlank, GL_COMPILE_AND_EXECUTE); + glBegin(GL_QUADS); + glNormal3f(0, 0, 1); + glTexCoord2f(0, 0); + glVertex3f(-PlankWidth, -PlankHeight, PlankThickness); + glTexCoord2f(1, 0); + glVertex3f(PlankWidth, -PlankHeight, PlankThickness); + glTexCoord2f(1, 1); + glVertex3f(PlankWidth, PlankHeight, PlankThickness); + glTexCoord2f(0, 1); + glVertex3f(-PlankWidth, PlankHeight, PlankThickness); + glNormal3f(0, 0, -1); + glTexCoord2f(0, 0); + glVertex3f(-PlankWidth, PlankHeight, -PlankThickness); + glTexCoord2f(1, 0); + glVertex3f(PlankWidth, PlankHeight, -PlankThickness); + glTexCoord2f(1, 1); + glVertex3f(PlankWidth, -PlankHeight, -PlankThickness); + glTexCoord2f(0, 1); + glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness); + glNormal3f(0, 1, 0); + glTexCoord2f(0, 0); + glVertex3f(-PlankWidth, PlankHeight, PlankThickness); + glTexCoord2f(1, 0); + glVertex3f(PlankWidth, PlankHeight, PlankThickness); + glTexCoord2f(1, 1); + glVertex3f(PlankWidth, PlankHeight, -PlankThickness); + glTexCoord2f(0, 1); + glVertex3f(-PlankWidth, PlankHeight, -PlankThickness); + glNormal3f(0, -1, 0); + glTexCoord2f(0, 0); + glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness); + glTexCoord2f(1, 0); + glVertex3f(PlankWidth, -PlankHeight, -PlankThickness); + glTexCoord2f(1, 1); + glVertex3f(PlankWidth, -PlankHeight, PlankThickness); + glTexCoord2f(0, 1); + glVertex3f(-PlankWidth, -PlankHeight, PlankThickness); + glNormal3f(1, 0, 0); + glTexCoord2f(0, 0); + glVertex3f(PlankWidth, -PlankHeight, PlankThickness); + glTexCoord2f(1, 0); + glVertex3f(PlankWidth, -PlankHeight, -PlankThickness); + glTexCoord2f(1, 1); + glVertex3f(PlankWidth, PlankHeight, -PlankThickness); + glTexCoord2f(0, 1); + glVertex3f(PlankWidth, PlankHeight, PlankThickness); + glNormal3f(-1, 0, 0); + glTexCoord2f(0, 0); + glVertex3f(-PlankWidth, PlankHeight, PlankThickness); + glTexCoord2f(1, 0); + glVertex3f(-PlankWidth, PlankHeight, -PlankThickness); + glTexCoord2f(1, 1); + glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness); + glTexCoord2f(0, 1); + glVertex3f(-PlankWidth, -PlankHeight, PlankThickness); + glEnd(); + glEndList(); + cp->AreObjectsDefined[ObjWoodPlank] = 1; +#ifdef DEBUG_LISTS + (void) printf("WoodPlank drawn SLOWLY\n"); +#endif + } else { + glCallList(objects + ObjWoodPlank); +#ifdef DEBUG_LISTS + (void) printf("WoodPlank drawn quickly\n"); +#endif + } +} + +static void +draw_impossiblecage(cagestruct * cp) +{ + glPushMatrix(); + glRotatef(90, 0, 1, 0); + glTranslatef(0.0, PlankHeight - PlankWidth, -PlankThickness - PlankWidth); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 0, 1); + glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - PlankThickness); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 1, 0); + glTranslatef(0.0, PlankWidth - PlankHeight, -PlankThickness - PlankWidth); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glTranslatef(0.0, PlankWidth - PlankHeight, 3 * PlankThickness - PlankWidth); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 0, 1); + glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - PlankThickness); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - 3 * PlankThickness); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glTranslatef(0.0, PlankHeight - PlankWidth, 3 * PlankThickness - PlankWidth); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 0, 1); + glTranslatef(0.0, PlankHeight - PlankWidth, PlankThickness - PlankWidth); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - 3 * PlankThickness); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 1, 0); + glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth + PlankThickness); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 0, 1); + glTranslatef(0.0, PlankWidth - PlankHeight, PlankThickness - PlankWidth); + draw_woodplank(cp); + glPopMatrix(); + glPushMatrix(); + glRotatef(90, 0, 1, 0); + glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth + PlankThickness); + draw_woodplank(cp); + glPopMatrix(); +} + +static void +reshape(ModeInfo * mi, int width, int height) +{ + cagestruct *cp = &cage[MI_SCREEN(mi)]; + + glViewport(0, 0, cp->WindW = (GLint) width, cp->WindH = (GLint) height); + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); + glMatrixMode(GL_MODELVIEW); + if (width >= 1024) { + glLineWidth(3); + glPointSize(3); + } else if (width >= 512) { + glLineWidth(2); + glPointSize(2); + } else { + glLineWidth(1); + glPointSize(1); + } + cp->AreObjectsDefined[ObjWoodPlank] = 0; +} + +static void +pinit(void) +{ + glClearDepth(1.0); + glClearColor(0.0, 0.0, 0.0, 1.0); + + glLightfv(GL_LIGHT0, GL_AMBIENT, ambient); + glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse); + glLightfv(GL_LIGHT0, GL_POSITION, position0); + glLightfv(GL_LIGHT1, GL_AMBIENT, ambient); + glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse); + glLightfv(GL_LIGHT1, GL_POSITION, position1); + glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient); + glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside); + glEnable(GL_LIGHTING); + glEnable(GL_LIGHT0); + glEnable(GL_LIGHT1); + glEnable(GL_NORMALIZE); + glFrontFace(GL_CCW); + glCullFace(GL_BACK); + + /* cage */ + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); + glShadeModel(GL_FLAT); + glDisable(GL_DEPTH_TEST); + glEnable(GL_TEXTURE_2D); + glEnable(GL_CULL_FACE); + + glPixelStorei(GL_UNPACK_ALIGNMENT, 1); + gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight, + GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData); + glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); + + glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess); + glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular); +} + +void +init_cage(ModeInfo * mi) +{ + int screen = MI_SCREEN(mi); + cagestruct *cp; + + if (cage == NULL) { + if ((cage = (cagestruct *) calloc(MI_NUM_SCREENS(mi), + sizeof (cagestruct))) == NULL) + return; + } + cp = &cage[screen]; + cp->step = NRAND(90); + + if ((cp->glx_context = init_GL(mi)) != NULL) { + + reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + glDrawBuffer(GL_BACK); + if (!glIsList(objects)) + objects = glGenLists(1); + pinit(); + } else { + MI_CLEARWINDOW(mi); + } +} + +void +draw_cage(ModeInfo * mi) +{ + cagestruct *cp = &cage[MI_SCREEN(mi)]; + + Display *display = MI_DISPLAY(mi); + Window window = MI_WINDOW(mi); + + if (!cp->glx_context) + return; + + glXMakeCurrent(display, window, *(cp->glx_context)); + + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + glPushMatrix(); + + glTranslatef(0.0, 0.0, -10.0); + + if (!MI_WIN_IS_ICONIC(mi)) { + glScalef(Scale4Window * cp->WindH / cp->WindW, Scale4Window, Scale4Window); + } else { + glScalef(Scale4Iconic * cp->WindH / cp->WindW, Scale4Iconic, Scale4Iconic); + } + + /* cage */ + glRotatef(cp->step * 100, 0, 0, 1); + glRotatef(25 + cos(cp->step * 5) * 6, 1, 0, 0); + glRotatef(204.5 - sin(cp->step * 5) * 8, 0, 1, 0); + draw_impossiblecage(cp); + + glPopMatrix(); + + glFlush(); + + glXSwapBuffers(display, window); + + cp->step += 0.025; +} + +void +change_cage(ModeInfo * mi) +{ + cagestruct *cp = &cage[MI_SCREEN(mi)]; + + if (!cp->glx_context) + return; + + glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(cp->glx_context)); + pinit(); +} + +void +release_cage(ModeInfo * mi) +{ + if (cage != NULL) { + (void) free((void *) cage); + cage = NULL; + } + if (glIsList(objects)) { + glDeleteLists(objects, 1); + } + FreeAllGL(mi); +} + +#endif diff --git a/hacks/glx/escher.c b/hacks/glx/escher.c deleted file mode 100644 index b61b2736..00000000 --- a/hacks/glx/escher.c +++ /dev/null @@ -1,814 +0,0 @@ -/* -*- Mode: C; tab-width: 4 -*- - * escher.c - Shows some Escher like scenes - */ -#if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)escher.c 4.04 97/07/28 xlockmore"; -#endif - -#undef DEBUG_LISTS - -/* Permission to use, copy, modify, and distribute this software and its - * documentation for any purpose and without fee is hereby granted, - * provided that the above copyright notice appear in all copies and that - * both that copyright notice and this permission notice appear in - * supporting documentation. - * - * This file is provided AS IS with no warranties of any kind. The author - * shall have no liability with respect to the infringement of copyrights, - * trade secrets or any patents by this file or any part thereof. In no - * event will the author be liable for any lost revenue or profits or - * other special, indirect and consequential damages. - * - * The RotateAroundU() routine was adapted from the book - * "Computer Graphics Principles and Practice - * Foley - vanDam - Feiner - Hughes - * Second Edition" Pag. 227, exercise 5.15. - * - * This mode shows some interesting scenes that are impossible OR very - * wierd to build in the real universe. Much of the scenes are inspirated - * on Mauritz Cornelis Escher's works which derivated the mode's name. - * M.C. Escher (1898-1972) was a dutch artist and many people prefer to - * say he was a mathematician. - * - * Thanks goes to Brian Paul for making it possible and inexpensive to use - * OpenGL at home. - * - * Since I'm not a native english speaker, my apologies for any gramatical - * mistake. - * - * My e-mail addresses are - * vianna@cat.cbpf.br - * and - * marcelo@venus.rdc.puc-rio.br - * - * Marcelo F. Vianna (Jun-01-1997) - * - * Revision History: - * 08-Jun-97: New scene implemented: "Impossible Cage" based in a M.C. Escher's - * painting with the same name (quite similar). The first GL mode - * to use texture mapping. - * The "Impossible Cage" scene doesn't use DEPTH BUFFER, the - * wood planks are drawn consistently using GL_CULL_FACE, and - * the painter's algorithm is used to sort the planks. - * Marcelo F. Vianna. - * 07-Jun-97: Speed ups in Moebius Strip using GL_CULL_FACE. - * Marcelo F. Vianna. - * 03-Jun-97: Initial Release (Only one scene: "Moebius Strip") - * The Moebious Strip scene was inspirated in a M.C. Escher's - * painting named Moebius Strip II in wich ants walk across a - * Moebius Strip path, sometimes meeting each other and sometimes - * being in "opposite faces" (note that the moebius strip has - * only one face and one edge). - * Marcelo F. Vianna. - * - */ - -/*- - * Texture mapping is only available on RGBA contexts, Mono and color index - * visuals DO NOT support texture mapping in OpenGL. - * - * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture - * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono - * is not officially supported for both OpenGL and Mesa, but seems to not crash - * Mesa. - * - * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know). - */ - -#include - -#ifdef STANDALONE -# define PROGCLASS "Escher" -# define HACK_INIT init_escher -# define HACK_DRAW draw_escher -# define escher_opts xlockmore_opts -# define DEFAULTS "*count: 0 \n" \ - "*cycles: 1 \n" \ - "*delay: 100 \n" \ - "*wireframe: False \n" -# include "xlockmore.h" /* from the xscreensaver distribution */ -#else /* !STANDALONE */ -# include "xlock.h" /* from the xlockmore distribution */ -#endif /* !STANDALONE */ - - -#ifdef USE_GL - - -#include -#include "e_textures.h" - -#define DEF_SOLIDMOEBIUS "False" -#define DEF_NOANTS "False" - -static int solidmoebius; -static int noants; - -static XrmOptionDescRec opts[] = -{ - {"-solidmoebius", ".escher.solidmoebius", XrmoptionNoArg, (caddr_t) "on"}, - {"+solidmoebius", ".escher.solidmoebius", XrmoptionNoArg, (caddr_t) "off"}, - {"-noants", ".escher.noants", XrmoptionNoArg, (caddr_t) "on"}, - {"+noants", ".escher.noants", XrmoptionNoArg, (caddr_t) "off"} -}; -static argtype vars[] = -{ - {(caddr_t *) & solidmoebius, "solidmoebius", "Solidmoebius", DEF_SOLIDMOEBIUS, t_Bool}, - {(caddr_t *) & noants, "noants", "Noants", DEF_NOANTS, t_Bool} -}; -static OptionStruct desc[] = -{ - {"-/+solidmoebius", "select between a SOLID or a NET Moebius Strip"}, - {"-/+noants", "turn on/off walking ants"} -}; - -ModeSpecOpt escher_opts = -{4, opts, 2, vars, desc}; - -#define Scale4Window 0.3 -#define Scale4Iconic 0.4 - -#define sqr(A) ((A)*(A)) - -#ifndef Pi -#define Pi M_PI -#endif - -/*************************************************************************/ - -typedef struct { - GLint WindH, WindW; - GLfloat step; - GLfloat ant_position; - int scene; - int AreObjectsDefined[3]; - GLXContext glx_context; -} escherstruct; - -static float front_shininess[] = -{60.0}; -static float front_specular[] = -{0.7, 0.7, 0.7, 1.0}; -static float ambient[] = -{0.0, 0.0, 0.0, 1.0}; -static float diffuse[] = -{1.0, 1.0, 1.0, 1.0}; -static float position0[] = -{1.0, 1.0, 1.0, 0.0}; -static float position1[] = -{-1.0, -1.0, 1.0, 0.0}; -static float lmodel_ambient[] = -{0.5, 0.5, 0.5, 1.0}; -static float lmodel_twoside[] = -{GL_TRUE}; - -static float MaterialRed[] = -{0.7, 0.0, 0.0, 1.0}; -static float MaterialGreen[] = -{0.1, 0.5, 0.2, 1.0}; -static float MaterialBlue[] = -{0.0, 0.0, 0.7, 1.0}; -static float MaterialCyan[] = -{0.2, 0.5, 0.7, 1.0}; -static float MaterialYellow[] = -{0.7, 0.7, 0.0, 1.0}; -static float MaterialMagenta[] = -{0.6, 0.2, 0.5, 1.0}; -static float MaterialWhite[] = -{0.7, 0.7, 0.7, 1.0}; -static float MaterialGray[] = -{0.2, 0.2, 0.2, 1.0}; - -static escherstruct *escher = NULL; -static GLuint objects; - -#define NUM_SCENES 2 - -#define ObjMoebiusStrip 0 -#define ObjAntBody 1 -#define ObjWoodPlank 2 - -#define PlankWidth 3.0 -#define PlankHeight 0.35 -#define PlankThickness 0.15 - -static void -mySphere(float radius) -{ - GLUquadricObj *quadObj; - - quadObj = gluNewQuadric(); - gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL); - gluSphere(quadObj, radius, 16, 16); - gluDeleteQuadric(quadObj); -} - -static void -myCone(float radius) -{ - GLUquadricObj *quadObj; - - quadObj = gluNewQuadric(); - gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL); - gluCylinder(quadObj, radius, 0, radius * 3, 8, 1); - gluDeleteQuadric(quadObj); -} - -static void -draw_escher_ant(escherstruct * ep, float *Material) -{ - static float ant_step = 0; - float cos1 = cos(ant_step); - float cos2 = cos(ant_step + 2 * Pi / 3); - float cos3 = cos(ant_step + 4 * Pi / 3); - float sin1 = sin(ant_step); - float sin2 = sin(ant_step + 2 * Pi / 3); - float sin3 = sin(ant_step + 4 * Pi / 3); - - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, Material); - if (!ep->AreObjectsDefined[ObjAntBody]) { - glNewList(objects + ObjAntBody, GL_COMPILE_AND_EXECUTE); - glEnable(GL_CULL_FACE); - glPushMatrix(); - glScalef(1, 1.3, 1); - mySphere(0.18); - glScalef(1, 1 / 1.3, 1); - glTranslatef(0.00, 0.30, 0.00); - mySphere(0.2); - - glTranslatef(-0.05, 0.17, 0.05); - glRotatef(-90, 1, 0, 0); - glRotatef(-25, 0, 1, 0); - myCone(0.05); - glTranslatef(0.00, 0.10, 0.00); - myCone(0.05); - glRotatef(25, 0, 1, 0); - glRotatef(90, 1, 0, 0); - - glScalef(1, 1.3, 1); - glTranslatef(0.15, -0.65, 0.05); - mySphere(0.25); - glScalef(1, 1 / 1.3, 1); - glPopMatrix(); - glDisable(GL_CULL_FACE); - glEndList(); - ep->AreObjectsDefined[ObjAntBody] = 1; -#ifdef DEBUG_LISTS - (void) printf("Ant drawn SLOWLY\n"); -#endif - } else { - glCallList(objects + ObjAntBody); -#ifdef DEBUG_LISTS - (void) printf("Ant drawn quickly\n"); -#endif - } - - glDisable(GL_LIGHTING); - /* ANTENNAS */ - glBegin(GL_LINES); - glColor3fv(Material); - glVertex3f(0.00, 0.30, 0.00); - glColor3fv(MaterialGray); - glVertex3f(0.40, 0.70, 0.40); - glColor3fv(Material); - glVertex3f(0.00, 0.30, 0.00); - glColor3fv(MaterialGray); - glVertex3f(0.40, 0.70, -0.40); - glEnd(); - glBegin(GL_POINTS); - glColor3fv(MaterialRed); - glVertex3f(0.40, 0.70, 0.40); - glVertex3f(0.40, 0.70, -0.40); - glEnd(); - - /* LEFT-FRONT ARM */ - glBegin(GL_LINE_STRIP); - glColor3fv(Material); - glVertex3f(0.00, 0.05, 0.18); - glVertex3f(0.35 + 0.05 * cos1, 0.15, 0.25); - glColor3fv(MaterialGray); - glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45); - glEnd(); - - /* LEFT-CENTER ARM */ - glBegin(GL_LINE_STRIP); - glColor3fv(Material); - glVertex3f(0.00, 0.00, 0.18); - glVertex3f(0.35 + 0.05 * cos2, 0.00, 0.25); - glColor3fv(MaterialGray); - glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45); - glEnd(); - - /* LEFT-BACK ARM */ - glBegin(GL_LINE_STRIP); - glColor3fv(Material); - glVertex3f(0.00, -0.05, 0.18); - glVertex3f(0.35 + 0.05 * cos3, -0.15, 0.25); - glColor3fv(MaterialGray); - glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45); - glEnd(); - - /* RIGHT-FRONT ARM */ - glBegin(GL_LINE_STRIP); - glColor3fv(Material); - glVertex3f(0.00, 0.05, -0.18); - glVertex3f(0.35 - 0.05 * sin1, 0.15, -0.25); - glColor3fv(MaterialGray); - glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45); - glEnd(); - - /* RIGHT-CENTER ARM */ - glBegin(GL_LINE_STRIP); - glColor3fv(Material); - glVertex3f(0.00, 0.00, -0.18); - glVertex3f(0.35 - 0.05 * sin2, 0.00, -0.25); - glColor3fv(MaterialGray); - glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45); - glEnd(); - - /* RIGHT-BACK ARM */ - glBegin(GL_LINE_STRIP); - glColor3fv(Material); - glVertex3f(0.00, -0.05, -0.18); - glVertex3f(0.35 - 0.05 * sin3, -0.15, -0.25); - glColor3fv(MaterialGray); - glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45); - glEnd(); - - glBegin(GL_POINTS); - glColor3fv(MaterialMagenta); - glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45); - glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45); - glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45); - glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45); - glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45); - glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45); - glEnd(); - - glEnable(GL_LIGHTING); - - ant_step += 0.3; -} - -static void -RotateAaroundU(float Ax, float Ay, float Az, - float Ux, float Uy, float Uz, - float *Cx, float *Cy, float *Cz, - float Theta) -{ - float cosO = cos(Theta); - float sinO = sin(Theta); - float one_cosO = 1 - cosO; - float Ux2 = sqr(Ux); - float Uy2 = sqr(Uy); - float Uz2 = sqr(Uz); - float UxUy = Ux * Uy; - float UxUz = Ux * Uz; - float UyUz = Uy * Uz; - - *Cx = (Ux2 + cosO * (1 - Ux2)) * Ax + (UxUy * one_cosO - Uz * sinO) * Ay + (UxUz * one_cosO + Uy * sinO) * Az; - *Cy = (UxUy * one_cosO + Uz * sinO) * Ax + (Uy2 + cosO * (1 - Uy2)) * Ay + (UyUz * one_cosO - Ux * sinO) * Az; - *Cz = (UxUz * one_cosO - Uy * sinO) * Ax + (UyUz * one_cosO + Ux * sinO) * Ay + (Uz2 + cosO * (1 - Uz2)) * Az; -} - -#define MoebiusDivisions 40 -#define MoebiusTransversals 4 -static void -draw_moebius(ModeInfo * mi) -{ - GLfloat Phi, Theta; - GLfloat cPhi, sPhi; - escherstruct *ep = &escher[MI_SCREEN(mi)]; - int i, j; - - float Cx, Cy, Cz; - - if (!ep->AreObjectsDefined[ObjMoebiusStrip]) { - glNewList(objects + ObjMoebiusStrip, GL_COMPILE_AND_EXECUTE); - - if (solidmoebius) { - glBegin(GL_QUAD_STRIP); - Phi = 0; - i = 0; - while (i < (MoebiusDivisions * 2 + 1)) { - Theta = Phi / 2; - cPhi = cos(Phi); - sPhi = sin(Phi); - - i++; - if (i % 2) - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed); - else - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray); - - RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); - glNormal3f(Cx, Cy, Cz); - RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); - glVertex3f(cPhi * 3 + Cx, sPhi * 3 + Cy, +Cz); - glVertex3f(cPhi * 3 - Cx, sPhi * 3 - Cy, -Cz); - - Phi += Pi / MoebiusDivisions; - } - glEnd(); - } else { - for (j = -MoebiusTransversals; j < MoebiusTransversals; j++) { - glPolygonMode(GL_FRONT_AND_BACK, GL_LINE); - glBegin(GL_QUAD_STRIP); - Phi = 0; - i = 0; - while (i < (MoebiusDivisions * 2 + 1)) { - Theta = Phi / 2; - cPhi = cos(Phi); - sPhi = sin(Phi); - - RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); - glNormal3f(Cx, Cy, Cz); - RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); - j++; - if (j == MoebiusTransversals) - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); - else if (i % 2) - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed); - else - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray); - glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j); - j--; - if (j == -MoebiusTransversals) - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); - else if (i % 2) - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed); - else - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray); - glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j); - - Phi += Pi / MoebiusDivisions; - i++; - } - glEnd(); - } - glPolygonMode(GL_FRONT_AND_BACK, GL_FILL); - } - - glEndList(); - ep->AreObjectsDefined[ObjMoebiusStrip] = 1; -#ifdef DEBUG_LISTS - (void) printf("Strip drawn SLOWLY\n"); -#endif - } else { - glCallList(objects + ObjMoebiusStrip); -#ifdef DEBUG_LISTS - (void) printf("Strip drawn quickly\n"); -#endif - } - - if (!noants) { - /* DRAW BLUE ANT */ - glPushMatrix(); - glRotatef(ep->ant_position + 180, 0, 0, 1); - glTranslatef(3, 0, 0); - glRotatef(ep->ant_position / 2 + 90, 0, 1, 0); - glTranslatef(0.28, 0, -0.45); - draw_escher_ant(ep, MaterialYellow); - glPopMatrix(); - - /* DRAW YELLOW ANT */ - glPushMatrix(); - glRotatef(ep->ant_position, 0, 0, 1); - glTranslatef(3, 0, 0); - glRotatef(ep->ant_position / 2, 0, 1, 0); - glTranslatef(0.28, 0, -0.45); - draw_escher_ant(ep, MaterialBlue); - glPopMatrix(); - - /* DRAW GREEN ANT */ - glPushMatrix(); - glRotatef(-ep->ant_position, 0, 0, 1); - glTranslatef(3, 0, 0); - glRotatef(-ep->ant_position / 2, 0, 1, 0); - glTranslatef(0.28, 0, 0.45); - glRotatef(180, 1, 0, 0); - draw_escher_ant(ep, MaterialGreen); - glPopMatrix(); - - /* DRAW CYAN ANT */ - glPushMatrix(); - glRotatef(-ep->ant_position + 180, 0, 0, 1); - glTranslatef(3, 0, 0); - glRotatef(-ep->ant_position / 2 + 90, 0, 1, 0); - glTranslatef(0.28, 0, 0.45); - glRotatef(180, 1, 0, 0); - draw_escher_ant(ep, MaterialCyan); - glPopMatrix(); - } - ep->ant_position += 1; -} -#undef MoebiusDivisions -#undef MoebiusTransversals - -static void -draw_woodplank(escherstruct * ep) -{ - if (!ep->AreObjectsDefined[ObjWoodPlank]) { - glNewList(objects + ObjWoodPlank, GL_COMPILE_AND_EXECUTE); - glBegin(GL_QUADS); - glNormal3f(0, 0, 1); - glTexCoord2f(0, 0); - glVertex3f(-PlankWidth, -PlankHeight, PlankThickness); - glTexCoord2f(1, 0); - glVertex3f(PlankWidth, -PlankHeight, PlankThickness); - glTexCoord2f(1, 1); - glVertex3f(PlankWidth, PlankHeight, PlankThickness); - glTexCoord2f(0, 1); - glVertex3f(-PlankWidth, PlankHeight, PlankThickness); - glNormal3f(0, 0, -1); - glTexCoord2f(0, 0); - glVertex3f(-PlankWidth, PlankHeight, -PlankThickness); - glTexCoord2f(1, 0); - glVertex3f(PlankWidth, PlankHeight, -PlankThickness); - glTexCoord2f(1, 1); - glVertex3f(PlankWidth, -PlankHeight, -PlankThickness); - glTexCoord2f(0, 1); - glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness); - glNormal3f(0, 1, 0); - glTexCoord2f(0, 0); - glVertex3f(-PlankWidth, PlankHeight, PlankThickness); - glTexCoord2f(1, 0); - glVertex3f(PlankWidth, PlankHeight, PlankThickness); - glTexCoord2f(1, 1); - glVertex3f(PlankWidth, PlankHeight, -PlankThickness); - glTexCoord2f(0, 1); - glVertex3f(-PlankWidth, PlankHeight, -PlankThickness); - glNormal3f(0, -1, 0); - glTexCoord2f(0, 0); - glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness); - glTexCoord2f(1, 0); - glVertex3f(PlankWidth, -PlankHeight, -PlankThickness); - glTexCoord2f(1, 1); - glVertex3f(PlankWidth, -PlankHeight, PlankThickness); - glTexCoord2f(0, 1); - glVertex3f(-PlankWidth, -PlankHeight, PlankThickness); - glNormal3f(1, 0, 0); - glTexCoord2f(0, 0); - glVertex3f(PlankWidth, -PlankHeight, PlankThickness); - glTexCoord2f(1, 0); - glVertex3f(PlankWidth, -PlankHeight, -PlankThickness); - glTexCoord2f(1, 1); - glVertex3f(PlankWidth, PlankHeight, -PlankThickness); - glTexCoord2f(0, 1); - glVertex3f(PlankWidth, PlankHeight, PlankThickness); - glNormal3f(-1, 0, 0); - glTexCoord2f(0, 0); - glVertex3f(-PlankWidth, PlankHeight, PlankThickness); - glTexCoord2f(1, 0); - glVertex3f(-PlankWidth, PlankHeight, -PlankThickness); - glTexCoord2f(1, 1); - glVertex3f(-PlankWidth, -PlankHeight, -PlankThickness); - glTexCoord2f(0, 1); - glVertex3f(-PlankWidth, -PlankHeight, PlankThickness); - glEnd(); - glEndList(); - ep->AreObjectsDefined[ObjWoodPlank] = 1; -#ifdef DEBUG_LISTS - (void) printf("WoodPlank drawn SLOWLY\n"); -#endif - } else { - glCallList(objects + ObjWoodPlank); -#ifdef DEBUG_LISTS - (void) printf("WoodPlank drawn quickly\n"); -#endif - } -} - -static void -draw_impossiblecage(escherstruct * ep) -{ - glPushMatrix(); - glRotatef(90, 0, 1, 0); - glTranslatef(0.0, PlankHeight - PlankWidth, -PlankThickness - PlankWidth); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 0, 1); - glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - PlankThickness); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 1, 0); - glTranslatef(0.0, PlankWidth - PlankHeight, -PlankThickness - PlankWidth); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glTranslatef(0.0, PlankWidth - PlankHeight, 3 * PlankThickness - PlankWidth); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 0, 1); - glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - PlankThickness); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth - 3 * PlankThickness); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glTranslatef(0.0, PlankHeight - PlankWidth, 3 * PlankThickness - PlankWidth); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 0, 1); - glTranslatef(0.0, PlankHeight - PlankWidth, PlankThickness - PlankWidth); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth - 3 * PlankThickness); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 1, 0); - glTranslatef(0.0, PlankHeight - PlankWidth, PlankWidth + PlankThickness); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 0, 1); - glTranslatef(0.0, PlankWidth - PlankHeight, PlankThickness - PlankWidth); - draw_woodplank(ep); - glPopMatrix(); - glPushMatrix(); - glRotatef(90, 0, 1, 0); - glTranslatef(0.0, PlankWidth - PlankHeight, PlankWidth + PlankThickness); - draw_woodplank(ep); - glPopMatrix(); -} - -void -draw_escher(ModeInfo * mi) -{ - escherstruct *ep = &escher[MI_SCREEN(mi)]; - - Display *display = MI_DISPLAY(mi); - Window window = MI_WINDOW(mi); - - glXMakeCurrent(display, window, ep->glx_context); - - glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); - - glPushMatrix(); - - glTranslatef(0.0, 0.0, -10.0); - - if (!MI_WIN_IS_ICONIC(mi)) { - glScalef(Scale4Window * ep->WindH / ep->WindW, Scale4Window, Scale4Window); - } else { - glScalef(Scale4Iconic * ep->WindH / ep->WindW, Scale4Iconic, Scale4Iconic); - } - - - switch (ep->scene) { - case 1: - glRotatef(ep->step * 100, 1, 0, 0); - glRotatef(ep->step * 95, 0, 1, 0); - glRotatef(ep->step * 90, 0, 0, 1); - draw_moebius(mi); - break; - case 2: /* 196 - 213 */ - glRotatef(ep->step * 100, 0, 0, 1); - glRotatef(25 + cos(ep->step * 5) * 6, 1, 0, 0); - glRotatef(204.5 - sin(ep->step * 5) * 8, 0, 1, 0); - draw_impossiblecage(ep); - break; - } - - glPopMatrix(); - - glFlush(); - - glXSwapBuffers(display, window); - - ep->step += 0.025; -} - -static void -reshape(ModeInfo * mi, int width, int height) -{ - escherstruct *ep = &escher[MI_SCREEN(mi)]; - - glViewport(0, 0, ep->WindW = (GLint) width, ep->WindH = (GLint) height); - glMatrixMode(GL_PROJECTION); - glLoadIdentity(); - glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); - glMatrixMode(GL_MODELVIEW); - if (width >= 1024) { - glLineWidth(3); - glPointSize(3); - } else if (width >= 512) { - glLineWidth(2); - glPointSize(2); - } else { - glLineWidth(1); - glPointSize(1); - } - ep->AreObjectsDefined[ObjMoebiusStrip] = 0; - ep->AreObjectsDefined[ObjAntBody] = 0; - ep->AreObjectsDefined[ObjWoodPlank] = 0; -} - -static void -pinit(ModeInfo * mi) -{ - escherstruct *ep = &escher[MI_SCREEN(mi)]; - - glClearDepth(1.0); - glClearColor(0.0, 0.0, 0.0, 1.0); - - glLightfv(GL_LIGHT0, GL_AMBIENT, ambient); - glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse); - glLightfv(GL_LIGHT0, GL_POSITION, position0); - glLightfv(GL_LIGHT1, GL_AMBIENT, ambient); - glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse); - glLightfv(GL_LIGHT1, GL_POSITION, position1); - glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient); - glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside); - glEnable(GL_LIGHTING); - glEnable(GL_LIGHT0); - glEnable(GL_LIGHT1); - glEnable(GL_NORMALIZE); - glFrontFace(GL_CCW); - glCullFace(GL_BACK); - - switch (ep->scene) { - case 1: - glShadeModel(GL_SMOOTH); - glEnable(GL_DEPTH_TEST); - glDisable(GL_TEXTURE_2D); - glDisable(GL_CULL_FACE); - break; - case 2: - glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); - glShadeModel(GL_FLAT); - glDisable(GL_DEPTH_TEST); - glEnable(GL_TEXTURE_2D); - glEnable(GL_CULL_FACE); - break; - } - - glPixelStorei(GL_UNPACK_ALIGNMENT, 1); - gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight, - GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData); - glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE); - glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT); - glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT); - glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); - glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); - - glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess); - glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular); -} - -void -init_escher(ModeInfo * mi) -{ - int screen = MI_SCREEN(mi); - escherstruct *ep; - - if (escher == NULL) { - if ((escher = (escherstruct *) calloc(MI_NUM_SCREENS(mi), - sizeof (escherstruct))) == NULL) - return; - } - ep = &escher[screen]; - ep->step = NRAND(90); - ep->ant_position = NRAND(90); - - ep->glx_context = init_GL(mi); - - reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); - ep->scene = MI_BATCHCOUNT(mi); - if (ep->scene <= 0 || ep->scene > NUM_SCENES) - ep->scene = NRAND(NUM_SCENES) + 1; - glDrawBuffer(GL_BACK); - objects = glGenLists(3); - pinit(mi); - -} - -void -change_escher(ModeInfo * mi) -{ - escherstruct *ep = &escher[MI_SCREEN(mi)]; - - ep->scene = (ep->scene) % NUM_SCENES + 1; - glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), ep->glx_context); - pinit(mi); -} - -void -release_escher(ModeInfo * mi) -{ - if (escher != NULL) { - (void) free((void *) escher); - escher = NULL; - } - glDeleteLists(objects, 3); -} - -#endif diff --git a/hacks/glx/gears.c b/hacks/glx/gears.c index db13ab46..a0847ff1 100644 --- a/hacks/glx/gears.c +++ b/hacks/glx/gears.c @@ -1,10 +1,13 @@ -/* -*- Mode: C; tab-width: 4 -*- - * gears.c --- 3D gear wheels - */ +/* -*- Mode: C; tab-width: 4 -*- */ +/* gears --- 3D gear wheels */ + #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)gears.c 4.02 97/04/01 xlockmore"; +static const char sccsid[] = "@(#)gears.c 4.07 97/11/24 xlockmore"; + #endif -/* Permission to use, copy, modify, and distribute this software and its + +/*- + * Permission to use, copy, modify, and distribute this software and its * documentation for any purpose and without fee is hereby granted, * provided that the above copyright notice appear in all copies and that * both that copyright notice and this permission notice appear in @@ -17,8 +20,9 @@ static const char sccsid[] = "@(#)gears.c 4.02 97/04/01 xlockmore"; * other special, indirect and consequential damages. * * Revision History: + * 10-May-97: Compatible with xscreensaver * 22-Mar-97: Added support for -mono mode, and monochrome X servers. - * Ed Mackey, emackey@early.com + * Ed Mackey, emackey@netaxs.com * 13-Mar-97: Memory leak fix by Tom Schmidt * 1996: "written" by Danny Sung * Based on 3-D gear wheels by Brian Paul which is in the public domain. @@ -58,12 +62,21 @@ static const char sccsid[] = "@(#)gears.c 4.02 97/04/01 xlockmore"; ModeSpecOpt gears_opts = { 0, NULL, 0, NULL, NULL }; +#ifdef USE_MODULES +ModStruct gears_description = +{"gears", "init_gears", "draw_gears", "release_gears", + "draw_gears", "init_gears", NULL, &gears_opts, + 1000, 1, 2, 1, 1.0, "", + "Shows GL's gears", 0, NULL}; + +#endif + typedef struct { GLfloat view_rotx, view_roty, view_rotz; GLuint gear1, gear2, gear3; GLfloat angle; - int mono; - GLXContext glx_context; + GLXContext *glx_context; + Window window; #if 0 Window win; #endif @@ -71,7 +84,7 @@ typedef struct { static gearsstruct *gears = NULL; -/* +/*- * Draw a gear wheel. You'll probably want to call this function when * building a display list since we do a lot of trig here. * @@ -263,7 +276,7 @@ static void draw(ModeInfo * mi) { gearsstruct *gp = &gears[MI_SCREEN(mi)]; - int wire = MI_WIN_IS_WIREFRAME(mi) || gp->mono; + int wire = MI_WIN_IS_WIREFRAME(mi); if (!wire) { glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); @@ -335,7 +348,12 @@ pinit(ModeInfo * mi) {0.0, 0.8, 0.2, 1.0}; static GLfloat blue[4] = {0.2, 0.2, 1.0, 1.0}; - int wire = MI_WIN_IS_WIREFRAME(mi) || gp->mono; + static GLfloat gray[4] = + {0.5, 0.5, 0.5, 1.0}; + static GLfloat white[4] = + {1.0, 1.0, 1.0, 1.0}; + int wire = MI_WIN_IS_WIREFRAME(mi); + int mono = MI_WIN_IS_MONO(mi); if (!wire) { glLightfv(GL_LIGHT0, GL_POSITION, pos); @@ -360,28 +378,49 @@ pinit(ModeInfo * mi) /* make the gears */ gp->gear1 = glGenLists(1); glNewList(gp->gear1, GL_COMPILE); - if (!wire) - glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, red); - else - glColor4fv(red); + if (wire) { + if (mono) + glColor4fv(white); + else + glColor4fv(red); + } else { + if (mono) + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, gray); + else + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, red); + } gear(1.0, 4.0, 1.0, 20, 0.7, wire); glEndList(); gp->gear2 = glGenLists(1); glNewList(gp->gear2, GL_COMPILE); - if (!wire) - glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, green); - else - glColor4fv(green); + if (wire) { + if (mono) + glColor4fv(white); + else + glColor4fv(green); + } else { + if (mono) + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, gray); + else + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, green); + } gear(0.5, 2.0, 2.0, 10, 0.7, wire); glEndList(); gp->gear3 = glGenLists(1); glNewList(gp->gear3, GL_COMPILE); - if (!wire) - glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, blue); - else - glColor4fv(blue); + if (wire) { + if (mono) + glColor4fv(white); + else + glColor4fv(blue); + } else { + if (mono) + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, gray); + else + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, blue); + } gear(1.3, 2.0, 0.5, 10, 0.7, wire); glEndList(); if (!wire) @@ -391,11 +430,6 @@ pinit(ModeInfo * mi) void init_gears(ModeInfo * mi) { -#if 0 - Display *display = MI_DISPLAY(mi); - Window window = MI_WINDOW(mi); - -#endif int screen = MI_SCREEN(mi); /*Colormap cmap; */ @@ -409,19 +443,18 @@ init_gears(ModeInfo * mi) } gp = &gears[screen]; -#if 0 - gp->win = window; -#endif + gp->window = MI_WINDOW(mi); gp->view_rotx = NRAND(360); gp->view_roty = NRAND(360); gp->view_rotz = NRAND(360); gp->angle = NRAND(360); - gp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0); - gp->glx_context = init_GL(mi); - - reshape(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); - pinit(mi); + if ((gp->glx_context = init_GL(mi)) != NULL) { + reshape(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + pinit(mi); + } else { + MI_CLEARWINDOW(mi); + } } void @@ -433,9 +466,12 @@ draw_gears(ModeInfo * mi) int angle_incr = MI_CYCLES(mi) ? MI_CYCLES(mi) : 2; int rot_incr = MI_BATCHCOUNT(mi) ? MI_BATCHCOUNT(mi) : 1; + if (!gp->glx_context) + return; + glDrawBuffer(GL_BACK); - glXMakeCurrent(display, window, gp->glx_context); + glXMakeCurrent(display, window, *(gp->glx_context)); draw(mi); /* let's do something so we don't get bored */ @@ -457,22 +493,23 @@ release_gears(ModeInfo * mi) for (screen = 0; screen < MI_NUM_SCREENS(mi); screen++) { gearsstruct *gp = &gears[screen]; - /* Display lists MUST be freed while their glXContext is current. */ - glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), gp->glx_context); - - if (glIsList(gp->gear1)) - glDeleteLists(gp->gear1, 1); - if (glIsList(gp->gear2)) - glDeleteLists(gp->gear2, 1); - if (glIsList(gp->gear3)) - glDeleteLists(gp->gear3, 1); + if (gp->glx_context) { + /* Display lists MUST be freed while their glXContext is current. */ + glXMakeCurrent(MI_DISPLAY(mi), gp->window, *(gp->glx_context)); - /* Don't destroy the glXContext. init_GL does that. */ + if (glIsList(gp->gear1)) + glDeleteLists(gp->gear1, 1); + if (glIsList(gp->gear2)) + glDeleteLists(gp->gear2, 1); + if (glIsList(gp->gear3)) + glDeleteLists(gp->gear3, 1); + } } (void) free((void *) gears); gears = NULL; } + FreeAllGL(mi); } diff --git a/hacks/glx/moebius.c b/hacks/glx/moebius.c new file mode 100644 index 00000000..3fd933c7 --- /dev/null +++ b/hacks/glx/moebius.c @@ -0,0 +1,711 @@ +/* -*- Mode: C; tab-width: 4 -*- */ +/* moebius --- Moebius Strip II, an Escher-like GL scene with ants. */ + +#if !defined( lint ) && !defined( SABER ) +static const char sccsid[] = "@(#)moebius.c 4.08 97/01/04 xlockmore"; + +#endif + +#undef DEBUG_LISTS + +/*- + * Permission to use, copy, modify, and distribute this software and its + * documentation for any purpose and without fee is hereby granted, + * provided that the above copyright notice appear in all copies and that + * both that copyright notice and this permission notice appear in + * supporting documentation. + * + * This file is provided AS IS with no warranties of any kind. The author + * shall have no liability with respect to the infringement of copyrights, + * trade secrets or any patents by this file or any part thereof. In no + * event will the author be liable for any lost revenue or profits or + * other special, indirect and consequential damages. + * + * The RotateAroundU() routine was adapted from the book + * "Computer Graphics Principles and Practice + * Foley - vanDam - Feiner - Hughes + * Second Edition" Pag. 227, exercise 5.15. + * + * This mode shows some interesting scenes that are impossible OR very + * wierd to build in the real universe. Much of the scenes are inspirated + * on Mauritz Cornelis Escher's works which derivated the mode's name. + * M.C. Escher (1898-1972) was a dutch artist and many people prefer to + * say he was a mathematician. + * + * Thanks goes to Brian Paul for making it possible and inexpensive to use + * OpenGL at home. + * + * Since I'm not a native English speaker, my apologies for any grammatical + * mistake. + * + * My e-mail addresses are + * vianna@cat.cbpf.br + * and + * m-vianna@usa.net + * + * Marcelo F. Vianna (Jun-01-1997) + * + * Revision History: + * 01-Jan-98: Mode separated from escher and renamed + * 08-Jun-97: New scene implemented: "Impossible Cage" based in a M.C. Escher's + * painting with the same name (quite similar). The first GL mode + * to use texture mapping. + * The "Impossible Cage" scene doesn't use DEPTH BUFFER, the + * wood planks are drawn consistently using GL_CULL_FACE, and + * the painter's algorithm is used to sort the planks. + * Marcelo F. Vianna. + * 07-Jun-97: Speed ups in Moebius Strip using GL_CULL_FACE. + * Marcelo F. Vianna. + * 03-Jun-97: Initial Release (Only one scene: "Moebius Strip") + * The Moebius Strip scene was inspirated in a M.C. Escher's + * painting named Moebius Strip II in wich ants walk across a + * Moebius Strip path, sometimes meeting each other and sometimes + * being in "opposite faces" (note that the moebius strip has + * only one face and one edge). + * Marcelo F. Vianna. + * + */ + +/*- + * Texture mapping is only available on RGBA contexts, Mono and color index + * visuals DO NOT support texture mapping in OpenGL. + * + * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture + * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono + * is not officially supported for both OpenGL and Mesa, but seems to not crash + * Mesa. + * + * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know). + */ + +#include + +#ifdef STANDALONE +# define PROGCLASS "Moebius" +# define HACK_INIT init_moebius +# define HACK_DRAW draw_moebius +# define moebius_opts xlockmore_opts +# define DEFAULTS "*cycles: 1 \n" \ + "*delay: 1000 \n" \ + "*wireframe: False \n" +# include "xlockmore.h" /* from the xscreensaver distribution */ +#else /* !STANDALONE */ +# include "xlock.h" /* from the xlockmore distribution */ + +#endif /* !STANDALONE */ + +#ifdef USE_GL + + +#include +#include "e_textures.h" + +#define DEF_SOLIDMOEBIUS "False" +#define DEF_NOANTS "False" + +static int solidmoebius; +static int noants; + +static XrmOptionDescRec opts[] = +{ + {"-solidmoebius", ".moebius.solidmoebius", XrmoptionNoArg, (caddr_t) "on"}, + {"+solidmoebius", ".moebius.solidmoebius", XrmoptionNoArg, (caddr_t) "off"}, + {"-noants", ".moebius.noants", XrmoptionNoArg, (caddr_t) "on"}, + {"+noants", ".moebius.noants", XrmoptionNoArg, (caddr_t) "off"} +}; +static argtype vars[] = +{ + {(caddr_t *) & solidmoebius, "solidmoebius", "Solidmoebius", DEF_SOLIDMOEBIUS, t_Bool}, + {(caddr_t *) & noants, "noants", "Noants", DEF_NOANTS, t_Bool} +}; +static OptionStruct desc[] = +{ + {"-/+solidmoebius", "select between a SOLID or a NET Moebius Strip"}, + {"-/+noants", "turn on/off walking ants"} +}; + +ModeSpecOpt moebius_opts = +{4, opts, 2, vars, desc}; + +#ifdef USE_MODULES +ModStruct moebius_description = +{"moebius", "init_moebius", "draw_moebius", "release_moebius", + "draw_moebius", "change_moebius", NULL, &moebius_opts, + 1000, 1, 1, 1, 1.0, "", + "Shows Moebius Strip II, an Escher-like GL scene with ants", 0, NULL}; + +#endif + +#define Scale4Window 0.3 +#define Scale4Iconic 0.4 + +#define sqr(A) ((A)*(A)) + +#ifndef Pi +#define Pi M_PI +#endif + +/*************************************************************************/ + +typedef struct { + GLint WindH, WindW; + GLfloat step; + GLfloat ant_position; + int AreObjectsDefined[2]; + GLXContext *glx_context; +} moebiusstruct; + +static float front_shininess[] = +{60.0}; +static float front_specular[] = +{0.7, 0.7, 0.7, 1.0}; +static float ambient[] = +{0.0, 0.0, 0.0, 1.0}; +static float diffuse[] = +{1.0, 1.0, 1.0, 1.0}; +static float position0[] = +{1.0, 1.0, 1.0, 0.0}; +static float position1[] = +{-1.0, -1.0, 1.0, 0.0}; +static float lmodel_ambient[] = +{0.5, 0.5, 0.5, 1.0}; +static float lmodel_twoside[] = +{GL_TRUE}; + +static float MaterialRed[] = +{0.7, 0.0, 0.0, 1.0}; +static float MaterialGreen[] = +{0.1, 0.5, 0.2, 1.0}; +static float MaterialBlue[] = +{0.0, 0.0, 0.7, 1.0}; +static float MaterialCyan[] = +{0.2, 0.5, 0.7, 1.0}; +static float MaterialYellow[] = +{0.7, 0.7, 0.0, 1.0}; +static float MaterialMagenta[] = +{0.6, 0.2, 0.5, 1.0}; +static float MaterialWhite[] = +{0.7, 0.7, 0.7, 1.0}; +static float MaterialGray[] = +{0.2, 0.2, 0.2, 1.0}; +static float MaterialGray5[] = +{0.5, 0.5, 0.5, 1.0}; +static float MaterialGray6[] = +{0.6, 0.6, 0.6, 1.0}; +static float MaterialGray8[] = +{0.8, 0.8, 0.8, 1.0}; + +static moebiusstruct *moebius = NULL; +static GLuint objects; + +#define NUM_SCENES 2 + +#define ObjMoebiusStrip 0 +#define ObjAntBody 1 + +static void +mySphere(float radius) +{ + GLUquadricObj *quadObj; + + quadObj = gluNewQuadric(); + gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL); + gluSphere(quadObj, radius, 16, 16); + gluDeleteQuadric(quadObj); +} + +static void +myCone(float radius) +{ + GLUquadricObj *quadObj; + + quadObj = gluNewQuadric(); + gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL); + gluCylinder(quadObj, radius, 0, radius * 3, 8, 1); + gluDeleteQuadric(quadObj); +} + +static void +draw_moebius_ant(moebiusstruct * mp, float *Material, int mono) +{ + static float ant_step = 0; + float cos1 = cos(ant_step); + float cos2 = cos(ant_step + 2 * Pi / 3); + float cos3 = cos(ant_step + 4 * Pi / 3); + float sin1 = sin(ant_step); + float sin2 = sin(ant_step + 2 * Pi / 3); + float sin3 = sin(ant_step + 4 * Pi / 3); + + if (mono) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray5); + else + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, Material); + if (!mp->AreObjectsDefined[ObjAntBody]) { + glNewList(objects + ObjAntBody, GL_COMPILE_AND_EXECUTE); + glEnable(GL_CULL_FACE); + glPushMatrix(); + glScalef(1, 1.3, 1); + mySphere(0.18); + glScalef(1, 1 / 1.3, 1); + glTranslatef(0.00, 0.30, 0.00); + mySphere(0.2); + + glTranslatef(-0.05, 0.17, 0.05); + glRotatef(-90, 1, 0, 0); + glRotatef(-25, 0, 1, 0); + myCone(0.05); + glTranslatef(0.00, 0.10, 0.00); + myCone(0.05); + glRotatef(25, 0, 1, 0); + glRotatef(90, 1, 0, 0); + + glScalef(1, 1.3, 1); + glTranslatef(0.15, -0.65, 0.05); + mySphere(0.25); + glScalef(1, 1 / 1.3, 1); + glPopMatrix(); + glDisable(GL_CULL_FACE); + glEndList(); + mp->AreObjectsDefined[ObjAntBody] = 1; +#ifdef DEBUG_LISTS + (void) printf("Ant drawn SLOWLY\n"); +#endif + } else { + glCallList(objects + ObjAntBody); +#ifdef DEBUG_LISTS + (void) printf("Ant drawn quickly\n"); +#endif + } + + glDisable(GL_LIGHTING); + /* ANTENNAS */ + glBegin(GL_LINES); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, 0.30, 0.00); + glColor3fv(MaterialGray); + glVertex3f(0.40, 0.70, 0.40); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, 0.30, 0.00); + glColor3fv(MaterialGray); + glVertex3f(0.40, 0.70, -0.40); + glEnd(); + glBegin(GL_POINTS); + if (mono) + glColor3fv(MaterialGray6); + else + glColor3fv(MaterialRed); + glVertex3f(0.40, 0.70, 0.40); + glVertex3f(0.40, 0.70, -0.40); + glEnd(); + + /* LEFT-FRONT ARM */ + glBegin(GL_LINE_STRIP); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, 0.05, 0.18); + glVertex3f(0.35 + 0.05 * cos1, 0.15, 0.25); + glColor3fv(MaterialGray); + glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45); + glEnd(); + + /* LEFT-CENTER ARM */ + glBegin(GL_LINE_STRIP); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, 0.00, 0.18); + glVertex3f(0.35 + 0.05 * cos2, 0.00, 0.25); + glColor3fv(MaterialGray); + glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45); + glEnd(); + + /* LEFT-BACK ARM */ + glBegin(GL_LINE_STRIP); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, -0.05, 0.18); + glVertex3f(0.35 + 0.05 * cos3, -0.15, 0.25); + glColor3fv(MaterialGray); + glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45); + glEnd(); + + /* RIGHT-FRONT ARM */ + glBegin(GL_LINE_STRIP); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, 0.05, -0.18); + glVertex3f(0.35 - 0.05 * sin1, 0.15, -0.25); + glColor3fv(MaterialGray); + glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45); + glEnd(); + + /* RIGHT-CENTER ARM */ + glBegin(GL_LINE_STRIP); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, 0.00, -0.18); + glVertex3f(0.35 - 0.05 * sin2, 0.00, -0.25); + glColor3fv(MaterialGray); + glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45); + glEnd(); + + /* RIGHT-BACK ARM */ + glBegin(GL_LINE_STRIP); + if (mono) + glColor3fv(MaterialGray5); + else + glColor3fv(Material); + glVertex3f(0.00, -0.05, -0.18); + glVertex3f(0.35 - 0.05 * sin3, -0.15, -0.25); + glColor3fv(MaterialGray); + glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45); + glEnd(); + + glBegin(GL_POINTS); + if (mono) + glColor3fv(MaterialGray8); + else + glColor3fv(MaterialMagenta); + glVertex3f(-0.20 + 0.05 * cos1, 0.25 + 0.1 * sin1, 0.45); + glVertex3f(-0.20 + 0.05 * cos2, 0.00 + 0.1 * sin2, 0.45); + glVertex3f(-0.20 + 0.05 * cos3, -0.25 + 0.1 * sin3, 0.45); + glVertex3f(-0.20 - 0.05 * sin1, 0.25 + 0.1 * cos1, -0.45); + glVertex3f(-0.20 - 0.05 * sin2, 0.00 + 0.1 * cos2, -0.45); + glVertex3f(-0.20 - 0.05 * sin3, -0.25 + 0.1 * cos3, -0.45); + glEnd(); + + glEnable(GL_LIGHTING); + + ant_step += 0.3; +} + +static void +RotateAaroundU(float Ax, float Ay, float Az, + float Ux, float Uy, float Uz, + float *Cx, float *Cy, float *Cz, + float Theta) +{ + float cosO = cos(Theta); + float sinO = sin(Theta); + float one_cosO = 1 - cosO; + float Ux2 = sqr(Ux); + float Uy2 = sqr(Uy); + float Uz2 = sqr(Uz); + float UxUy = Ux * Uy; + float UxUz = Ux * Uz; + float UyUz = Uy * Uz; + + *Cx = (Ux2 + cosO * (1 - Ux2)) * Ax + (UxUy * one_cosO - Uz * sinO) * Ay + (UxUz * one_cosO + Uy * sinO) * Az; + *Cy = (UxUy * one_cosO + Uz * sinO) * Ax + (Uy2 + cosO * (1 - Uy2)) * Ay + (UyUz * one_cosO - Ux * sinO) * Az; + *Cz = (UxUz * one_cosO - Uy * sinO) * Ax + (UyUz * one_cosO + Ux * sinO) * Ay + (Uz2 + cosO * (1 - Uz2)) * Az; +} + +#define MoebiusDivisions 40 +#define MoebiusTransversals 4 +static void +draw_moebius_strip(ModeInfo * mi) +{ + GLfloat Phi, Theta; + GLfloat cPhi, sPhi; + moebiusstruct *mp = &moebius[MI_SCREEN(mi)]; + int i, j; + int mono = MI_WIN_IS_MONO(mi); + + float Cx, Cy, Cz; + + if (!mp->AreObjectsDefined[ObjMoebiusStrip]) { + glNewList(objects + ObjMoebiusStrip, GL_COMPILE_AND_EXECUTE); + + if (solidmoebius) { + glBegin(GL_QUAD_STRIP); + Phi = 0; + i = 0; + while (i < (MoebiusDivisions * 2 + 1)) { + Theta = Phi / 2; + cPhi = cos(Phi); + sPhi = sin(Phi); + + i++; + if (mono) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); + else if (i % 2) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed); + else + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray); + + RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); + glNormal3f(Cx, Cy, Cz); + RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); + glVertex3f(cPhi * 3 + Cx, sPhi * 3 + Cy, +Cz); + glVertex3f(cPhi * 3 - Cx, sPhi * 3 - Cy, -Cz); + + Phi += Pi / MoebiusDivisions; + } + glEnd(); + } else { + for (j = -MoebiusTransversals; j < MoebiusTransversals; j++) { + glPolygonMode(GL_FRONT_AND_BACK, GL_LINE); + glBegin(GL_QUAD_STRIP); + Phi = 0; + i = 0; + while (i < (MoebiusDivisions * 2 + 1)) { + Theta = Phi / 2; + cPhi = cos(Phi); + sPhi = sin(Phi); + + RotateAaroundU(cPhi, sPhi, 0, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); + glNormal3f(Cx, Cy, Cz); + RotateAaroundU(0, 0, 1, -sPhi, cPhi, 0, &Cx, &Cy, &Cz, Theta); + j++; + if (j == MoebiusTransversals || mono) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); + else if (i % 2) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed); + else + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray); + glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j); + j--; + if (j == -MoebiusTransversals || mono) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); + else if (i % 2) + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialRed); + else + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialGray); + glVertex3f(cPhi * 3 + Cx / MoebiusTransversals * j, sPhi * 3 + Cy / MoebiusTransversals * j, +Cz / MoebiusTransversals * j); + + Phi += Pi / MoebiusDivisions; + i++; + } + glEnd(); + } + glPolygonMode(GL_FRONT_AND_BACK, GL_FILL); + } + + glEndList(); + mp->AreObjectsDefined[ObjMoebiusStrip] = 1; +#ifdef DEBUG_LISTS + (void) printf("Strip drawn SLOWLY\n"); +#endif + } else { + glCallList(objects + ObjMoebiusStrip); +#ifdef DEBUG_LISTS + (void) printf("Strip drawn quickly\n"); +#endif + } + + if (!noants) { + /* DRAW BLUE ANT */ + glPushMatrix(); + glRotatef(mp->ant_position + 180, 0, 0, 1); + glTranslatef(3, 0, 0); + glRotatef(mp->ant_position / 2 + 90, 0, 1, 0); + glTranslatef(0.28, 0, -0.45); + draw_moebius_ant(mp, MaterialYellow, mono); + glPopMatrix(); + + /* DRAW YELLOW ANT */ + glPushMatrix(); + glRotatef(mp->ant_position, 0, 0, 1); + glTranslatef(3, 0, 0); + glRotatef(mp->ant_position / 2, 0, 1, 0); + glTranslatef(0.28, 0, -0.45); + draw_moebius_ant(mp, MaterialBlue, mono); + glPopMatrix(); + + /* DRAW GREEN ANT */ + glPushMatrix(); + glRotatef(-mp->ant_position, 0, 0, 1); + glTranslatef(3, 0, 0); + glRotatef(-mp->ant_position / 2, 0, 1, 0); + glTranslatef(0.28, 0, 0.45); + glRotatef(180, 1, 0, 0); + draw_moebius_ant(mp, MaterialGreen, mono); + glPopMatrix(); + + /* DRAW CYAN ANT */ + glPushMatrix(); + glRotatef(-mp->ant_position + 180, 0, 0, 1); + glTranslatef(3, 0, 0); + glRotatef(-mp->ant_position / 2 + 90, 0, 1, 0); + glTranslatef(0.28, 0, 0.45); + glRotatef(180, 1, 0, 0); + draw_moebius_ant(mp, MaterialCyan, mono); + glPopMatrix(); + } + mp->ant_position += 1; +} +#undef MoebiusDivisions +#undef MoebiusTransversals + +static void +reshape(ModeInfo * mi, int width, int height) +{ + moebiusstruct *mp = &moebius[MI_SCREEN(mi)]; + + glViewport(0, 0, mp->WindW = (GLint) width, mp->WindH = (GLint) height); + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); + glMatrixMode(GL_MODELVIEW); + if (width >= 1024) { + glLineWidth(3); + glPointSize(3); + } else if (width >= 512) { + glLineWidth(2); + glPointSize(2); + } else { + glLineWidth(1); + glPointSize(1); + } + mp->AreObjectsDefined[ObjMoebiusStrip] = 0; + mp->AreObjectsDefined[ObjAntBody] = 0; +} + +static void +pinit(void) +{ + glClearDepth(1.0); + glClearColor(0.0, 0.0, 0.0, 1.0); + + glLightfv(GL_LIGHT0, GL_AMBIENT, ambient); + glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse); + glLightfv(GL_LIGHT0, GL_POSITION, position0); + glLightfv(GL_LIGHT1, GL_AMBIENT, ambient); + glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse); + glLightfv(GL_LIGHT1, GL_POSITION, position1); + glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient); + glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside); + glEnable(GL_LIGHTING); + glEnable(GL_LIGHT0); + glEnable(GL_LIGHT1); + glEnable(GL_NORMALIZE); + glFrontFace(GL_CCW); + glCullFace(GL_BACK); + + /* moebius */ + glShadeModel(GL_SMOOTH); + glEnable(GL_DEPTH_TEST); + glDisable(GL_TEXTURE_2D); + glDisable(GL_CULL_FACE); + + glPixelStorei(GL_UNPACK_ALIGNMENT, 1); + gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight, + GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData); + glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); + + glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess); + glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular); +} + +void +init_moebius(ModeInfo * mi) +{ + int screen = MI_SCREEN(mi); + moebiusstruct *mp; + + if (moebius == NULL) { + if ((moebius = (moebiusstruct *) calloc(MI_NUM_SCREENS(mi), + sizeof (moebiusstruct))) == NULL) + return; + } + mp = &moebius[screen]; + mp->step = NRAND(90); + mp->ant_position = NRAND(90); + + if ((mp->glx_context = init_GL(mi)) != NULL) { + + reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + glDrawBuffer(GL_BACK); + if (!glIsList(objects)) + objects = glGenLists(3); + pinit(); + } else { + MI_CLEARWINDOW(mi); + } +} + +void +draw_moebius(ModeInfo * mi) +{ + moebiusstruct *mp = &moebius[MI_SCREEN(mi)]; + + Display *display = MI_DISPLAY(mi); + Window window = MI_WINDOW(mi); + + if (!mp->glx_context) + return; + + glXMakeCurrent(display, window, *(mp->glx_context)); + + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + glPushMatrix(); + + glTranslatef(0.0, 0.0, -10.0); + + if (!MI_WIN_IS_ICONIC(mi)) { + glScalef(Scale4Window * mp->WindH / mp->WindW, Scale4Window, Scale4Window); + } else { + glScalef(Scale4Iconic * mp->WindH / mp->WindW, Scale4Iconic, Scale4Iconic); + } + + /* moebius */ + glRotatef(mp->step * 100, 1, 0, 0); + glRotatef(mp->step * 95, 0, 1, 0); + glRotatef(mp->step * 90, 0, 0, 1); + draw_moebius_strip(mi); + + glPopMatrix(); + + glFlush(); + + glXSwapBuffers(display, window); + + mp->step += 0.025; +} + +void +change_moebius(ModeInfo * mi) +{ + moebiusstruct *mp = &moebius[MI_SCREEN(mi)]; + + if (!mp->glx_context) + return; + + glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(mp->glx_context)); + pinit(); +} + +void +release_moebius(ModeInfo * mi) +{ + if (moebius != NULL) { + (void) free((void *) moebius); + moebius = NULL; + } + if (glIsList(objects)) { + glDeleteLists(objects, 3); + } + FreeAllGL(mi); +} + +#endif diff --git a/hacks/glx/morph3d.c b/hacks/glx/morph3d.c index 99316b07..41aa301d 100644 --- a/hacks/glx/morph3d.c +++ b/hacks/glx/morph3d.c @@ -1,14 +1,25 @@ +/* -*- Mode: C; tab-width: 4 -*- */ +/* morph3d --- Shows 3D morphing objects */ + #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)morph3d.c 4.02 97/04/01 xlockmore"; +static const char sccsid[] = "@(#)morph3d.c 4.07 97/11/24 xlockmore"; #endif #undef DEBUG_CULL_FACE /*- - * morph3d.c - Shows 3D morphing objects (XLock Version) + * Permission to use, copy, modify, and distribute this software and its + * documentation for any purpose and without fee is hereby granted, + * provided that the above copyright notice appear in all copies and that + * both that copyright notice and this permission notice appear in + * supporting documentation. * - * See xlock.c for copying information. + * This file is provided AS IS with no warranties of any kind. The author + * shall have no liability with respect to the infringement of copyrights, + * trade secrets or any patents by this file or any part thereof. In no + * event will the author be liable for any lost revenue or profits or + * other special, indirect and consequential damages. * * The original code for this mode was written by Marcelo Fernandes Vianna * (me...) and was inspired on a WindowsNT(R)'s screen saver. It was written @@ -25,13 +36,13 @@ static const char sccsid[] = "@(#)morph3d.c 4.02 97/04/01 xlockmore"; * If you are interested in the original version of this program (not a xlock * mode, please refer to the Mesa package (ftp iris.ssec.wisc.edu on /pub/Mesa) * - * Since I'm not a native english speaker, my apologies for any gramatical + * Since I'm not a native English speaker, my apologies for any grammatical * mistake. * * My e-mail addresses are * vianna@cat.cbpf.br * and - * marcelo@venus.rdc.puc-rio.br + * m-vianna@usa.net * * Marcelo F. Vianna (Feb-13-1997) * @@ -71,6 +82,15 @@ static const char sccsid[] = "@(#)morph3d.c 4.02 97/04/01 xlockmore"; ModeSpecOpt morph3d_opts = {0, NULL, 0, NULL, NULL}; +#ifdef USE_MODULES +ModStruct morph3d_description = +{"morph3d", "init_morph3d", "draw_morph3d", "release_morph3d", + "draw_morph3d", "change_morph3d", NULL, &morph3d_opts, + 1000, 0, 1, 1, 1.0, "", + "Shows GL morphing polyhedra", 0, NULL}; + +#endif + #define Scale4Window 0.3 #define Scale4Iconic 1.0 @@ -116,7 +136,7 @@ typedef struct { void (*draw_object) (ModeInfo * mi); float Magnitude; float *MaterialColor[20]; - GLXContext glx_context; + GLXContext *glx_context; } morph3dstruct; static float front_shininess[] = @@ -151,7 +171,7 @@ static float MaterialMagenta[] = static float MaterialWhite[] = {0.7, 0.7, 0.7, 1.0}; static float MaterialGray[] = -{0.2, 0.2, 0.2, 1.0}; +{0.5, 0.5, 0.5, 1.0}; static morph3dstruct *morph3d = NULL; @@ -632,65 +652,6 @@ draw_icosa(ModeInfo * mi) glDeleteLists(list, 1); } -void -draw_morph3d(ModeInfo * mi) -{ - morph3dstruct *mp = &morph3d[MI_SCREEN(mi)]; - - Display *display = MI_DISPLAY(mi); - Window window = MI_WINDOW(mi); - - glDrawBuffer(GL_BACK); - glXMakeCurrent(display, window, mp->glx_context); - - glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); - - glPushMatrix(); - - glTranslatef(0.0, 0.0, -10.0); - - if (!MI_WIN_IS_ICONIC(mi)) { - glScalef(Scale4Window * mp->WindH / mp->WindW, Scale4Window, Scale4Window); - glTranslatef(2.5 * mp->WindW / mp->WindH * sin(mp->step * 1.11), 2.5 * cos(mp->step * 1.25 * 1.11), 0); - } else { - glScalef(Scale4Iconic * mp->WindH / mp->WindW, Scale4Iconic, Scale4Iconic); - } - - glRotatef(mp->step * 100, 1, 0, 0); - glRotatef(mp->step * 95, 0, 1, 0); - glRotatef(mp->step * 90, 0, 0, 1); - - mp->seno = (sin(mp->step) + 1.0 / 3.0) * (4.0 / 5.0) * mp->Magnitude; - - if (mp->VisibleSpikes) { -#ifdef DEBUG_CULL_FACE - int loop; - - for (loop = 0; loop < 20; loop++) - mp->MaterialColor[loop] = MaterialGray; -#endif - glDisable(GL_CULL_FACE); - } else { -#ifdef DEBUG_CULL_FACE - int loop; - - for (loop = 0; loop < 20; loop++) - mp->MaterialColor[loop] = MaterialWhite; -#endif - glEnable(GL_CULL_FACE); - } - - mp->draw_object(mi); - - glPopMatrix(); - - glFlush(); - - glXSwapBuffers(display, window); - - mp->step += 0.05; -} - static void reshape(ModeInfo * mi, int width, int height) { @@ -830,13 +791,78 @@ init_morph3d(ModeInfo * mi) mp->step = NRAND(90); mp->VisibleSpikes = 1; - mp->glx_context = init_GL(mi); + if ((mp->glx_context = init_GL(mi)) != NULL) { - reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); - mp->object = MI_BATCHCOUNT(mi); - if (mp->object <= 0 || mp->object > 5) - mp->object = NRAND(5) + 1; - pinit(mi); + reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + mp->object = MI_BATCHCOUNT(mi); + if (mp->object <= 0 || mp->object > 5) + mp->object = NRAND(5) + 1; + pinit(mi); + } else { + MI_CLEARWINDOW(mi); + } +} + +void +draw_morph3d(ModeInfo * mi) +{ + morph3dstruct *mp = &morph3d[MI_SCREEN(mi)]; + + Display *display = MI_DISPLAY(mi); + Window window = MI_WINDOW(mi); + + if (!mp->glx_context) + return; + + glDrawBuffer(GL_BACK); + glXMakeCurrent(display, window, *(mp->glx_context)); + + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + glPushMatrix(); + + glTranslatef(0.0, 0.0, -10.0); + + if (!MI_WIN_IS_ICONIC(mi)) { + glScalef(Scale4Window * mp->WindH / mp->WindW, Scale4Window, Scale4Window); + glTranslatef(2.5 * mp->WindW / mp->WindH * sin(mp->step * 1.11), 2.5 * cos(mp->step * 1.25 * 1.11), 0); + } else { + glScalef(Scale4Iconic * mp->WindH / mp->WindW, Scale4Iconic, Scale4Iconic); + } + + glRotatef(mp->step * 100, 1, 0, 0); + glRotatef(mp->step * 95, 0, 1, 0); + glRotatef(mp->step * 90, 0, 0, 1); + + mp->seno = (sin(mp->step) + 1.0 / 3.0) * (4.0 / 5.0) * mp->Magnitude; + + if (mp->VisibleSpikes) { +#ifdef DEBUG_CULL_FACE + int loop; + + for (loop = 0; loop < 20; loop++) + mp->MaterialColor[loop] = MaterialGray; +#endif + glDisable(GL_CULL_FACE); + } else { +#ifdef DEBUG_CULL_FACE + int loop; + + for (loop = 0; loop < 20; loop++) + mp->MaterialColor[loop] = MaterialWhite; +#endif + glEnable(GL_CULL_FACE); + } + + mp->draw_object(mi); + + glPopMatrix(); + + glFlush(); + + glXSwapBuffers(display, window); + + mp->step += 0.05; } void @@ -844,6 +870,9 @@ change_morph3d(ModeInfo * mi) { morph3dstruct *mp = &morph3d[MI_SCREEN(mi)]; + if (!mp->glx_context) + return; + mp->object = (mp->object) % 5 + 1; pinit(mi); } @@ -855,6 +884,7 @@ release_morph3d(ModeInfo * mi) (void) free((void *) morph3d); morph3d = NULL; } + FreeAllGL(mi); } #endif diff --git a/hacks/glx/pipeobjs.c b/hacks/glx/pipeobjs.c index 28d9e6a2..e89f7009 100644 --- a/hacks/glx/pipeobjs.c +++ b/hacks/glx/pipeobjs.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)pipeobjs.c 4.2 97/04/27 xlockmore"; +static const char sccsid[] = "@(#)pipeobjs.c 4.04 97/07/28 xlockmore"; #endif @@ -12,9 +12,9 @@ static const char sccsid[] = "@(#)pipeobjs.c 4.2 97/04/27 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/pipes.c b/hacks/glx/pipes.c index c6f35d90..8ee15389 100644 --- a/hacks/glx/pipes.c +++ b/hacks/glx/pipes.c @@ -1,10 +1,13 @@ -/* -*- Mode: C; tab-width: 4 -*- - * pipes.c - Shows 3D selfbuiding pipe system (xlock Version) - */ +/* -*- Mode: C; tab-width: 4 -*- */ +/* pipes --- 3D selfbuiding pipe system */ + #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)pipes.c 4.04 97/07/28 xlockmore"; +static const char sccsid[] = "@(#)pipes.c 4.07 97/11/24 xlockmore"; + #endif -/* Permission to use, copy, modify, and distribute this software and its + +/*- + * Permission to use, copy, modify, and distribute this software and its * documentation for any purpose and without fee is hereby granted, * provided that the above copyright notice appear in all copies and that * both that copyright notice and this permission notice appear in @@ -27,15 +30,14 @@ static const char sccsid[] = "@(#)pipes.c 4.04 97/07/28 xlockmore"; * Thanks goes to Brian Paul for making it possible and inexpensive to use * OpenGL at home. * - * Since I'm not a native english speaker, my apologies for any gramatical + * Since I'm not a native English speaker, my apologies for any grammatical * mistake. * * My e-mail addresses are * * vianna@cat.cbpf.br * and - * marcelo@venus.rdc.puc-rio.br - * + * m-vianna@usa.net * Marcelo F. Vianna (Apr-09-1997) * * Revision History: @@ -56,10 +58,10 @@ static const char sccsid[] = "@(#)pipes.c 4.04 97/07/28 xlockmore"; # define HACK_INIT init_pipes # define HACK_DRAW draw_pipes # define pipes_opts xlockmore_opts -# define DEFAULTS "*count: 2 \n" \ +# define DEFAULTS "*delay: 100 \n" \ + "*count: 2 \n" \ "*cycles: 5 \n" \ "*size: 500 \n" \ - "*delay: 100 \n" \ "*fisheye: True \n" \ "*tightturns: False \n" \ "*rotatepipes: True \n" \ @@ -111,6 +113,20 @@ static OptionStruct desc[] = ModeSpecOpt pipes_opts = {7, opts, 4, vars, desc}; +#ifdef USE_MODULES +ModStruct pipes_description = +{"pipes", "init_pipes", "draw_pipes", "release_pipes", +#if defined( MESA ) && defined( SLOW ) + "draw_pipes", +#else + "change_pipes", +#endif + "change_pipes", NULL, &pipes_opts, + 1000, 2, 5, 500, 1.0, "", + "Shows a selfbuilding pipe system", 0, NULL}; + +#endif + #define Scale4Window 0.1 #define Scale4Iconic 0.07 @@ -148,11 +164,12 @@ typedef struct { int system_type; int system_length; int turncounter; + Window window; float *system_color; GLfloat initial_rotation; GLuint valve, bolts, betweenbolts, elbowbolts, elbowcoins; GLuint guagehead, guageface, guagedial, guageconnector; - GLXContext glx_context; + GLXContext *glx_context; } pipesstruct; extern struct lwo LWO_BigValve, LWO_PipeBetweenBolts, LWO_Bolts3D; @@ -213,8 +230,10 @@ MakeTube(int direction) /*dirNEAR = 00000100 */ /*dirFAR = 00000101 */ - glRotatef(90.0, (direction & 6) ? 0.0 : 1.0, (direction & 2) ? 1.0 : 0.0, 0.0); - + if (!(direction & 4)) { + glRotatef(90.0, (direction & 2) ? 0.0 : 1.0, + (direction & 2) ? 1.0 : 0.0, 0.0); + } glBegin(GL_QUAD_STRIP); for (an = 0.0; an <= 2.0 * M_PI; an += M_PI / 12.0) { glNormal3f((COSan_3 = cos(an) / 3.0), (SINan_3 = sin(an) / 3.0), 0.0); @@ -475,7 +494,193 @@ MakeShape(ModeInfo * mi, int newdir) } } -static void pinit(ModeInfo * mi, int zera); +static void +reshape(ModeInfo * mi, int width, int height) +{ + pipesstruct *pp = &pipes[MI_SCREEN(mi)]; + + glViewport(0, 0, pp->WindW = (GLint) width, pp->WindH = (GLint) height); + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + /*glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); */ + gluPerspective(65.0, (GLfloat) width / (GLfloat) height, 0.1, 20.0); + glMatrixMode(GL_MODELVIEW); +} + +static void +pinit(ModeInfo * mi, int zera) +{ + pipesstruct *pp = &pipes[MI_SCREEN(mi)]; + int X, Y, Z; + + glClearDepth(1.0); + glClearColor(0.0, 0.0, 0.0, 1.0); + glColor3f(1.0, 1.0, 1.0); + + glLightfv(GL_LIGHT0, GL_AMBIENT, ambient0); + glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse0); + glLightfv(GL_LIGHT0, GL_POSITION, position0); + glLightfv(GL_LIGHT1, GL_AMBIENT, ambient1); + glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse1); + glLightfv(GL_LIGHT1, GL_POSITION, position1); + glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient); + glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside); + glEnable(GL_LIGHTING); + glEnable(GL_LIGHT0); + glEnable(GL_LIGHT1); + glEnable(GL_DEPTH_TEST); + glEnable(GL_NORMALIZE); + glEnable(GL_CULL_FACE); + + glShadeModel(GL_SMOOTH); + glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess); + glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular); + + if (zera) { + pp->system_number = 1; + glDrawBuffer(GL_FRONT_AND_BACK); + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + (void) memset(pp->Cells, 0, sizeof (pp->Cells)); + for (X = 0; X < HCELLS; X++) { + for (Y = 0; Y < VCELLS; Y++) { + pp->Cells[X][Y][0] = 1; + pp->Cells[X][Y][HCELLS - 1] = 1; + pp->Cells[0][Y][X] = 1; + pp->Cells[HCELLS - 1][Y][X] = 1; + } + } + for (X = 0; X < HCELLS; X++) { + for (Z = 0; Z < HCELLS; Z++) { + pp->Cells[X][0][Z] = 1; + pp->Cells[X][VCELLS - 1][Z] = 1; + } + } + (void) memset(pp->usedcolors, 0, sizeof (pp->usedcolors)); + if ((pp->initial_rotation += 10.0) > 45.0) { + pp->initial_rotation -= 90.0; + } + } + pp->counter = 0; + pp->turncounter = 0; + + if (!MI_WIN_IS_MONO(mi)) { + int collist[DEFINEDCOLORS]; + int i, j, lower = 1000; + + /* Avoid repeating colors on the same screen unless necessary */ + for (i = 0; i < DEFINEDCOLORS; i++) { + if (lower > pp->usedcolors[i]) + lower = pp->usedcolors[i]; + } + for (i = 0, j = 0; i < DEFINEDCOLORS; i++) { + if (pp->usedcolors[i] == lower) { + collist[j] = i; + j++; + } + } + i = collist[NRAND(j)]; + pp->usedcolors[i]++; + switch (i) { + case 0: + pp->system_color = MaterialRed; + break; + case 1: + pp->system_color = MaterialGreen; + break; + case 2: + pp->system_color = MaterialBlue; + break; + case 3: + pp->system_color = MaterialCyan; + break; + case 4: + pp->system_color = MaterialYellow; + break; + case 5: + pp->system_color = MaterialMagenta; + break; + case 6: + pp->system_color = MaterialWhite; + break; + } + } else { + pp->system_color = MaterialGray; + } + + do { + pp->PX = NRAND((HCELLS - 1)) + 1; + pp->PY = NRAND((VCELLS - 1)) + 1; + pp->PZ = NRAND((HCELLS - 1)) + 1; + } while (pp->Cells[pp->PX][pp->PY][pp->PZ] || + (pp->Cells[pp->PX + 1][pp->PY][pp->PZ] && pp->Cells[pp->PX - 1][pp->PY][pp->PZ] && + pp->Cells[pp->PX][pp->PY + 1][pp->PZ] && pp->Cells[pp->PX][pp->PY - 1][pp->PZ] && + pp->Cells[pp->PX][pp->PY][pp->PZ + 1] && pp->Cells[pp->PX][pp->PY][pp->PZ - 1])); + pp->Cells[pp->PX][pp->PY][pp->PZ] = 1; + pp->olddir = dirNone; + + FindNeighbors(mi); + + pp->nowdir = SelectNeighbor(mi); +} + +void +init_pipes(ModeInfo * mi) +{ + int screen = MI_SCREEN(mi); + pipesstruct *pp; + + if (pipes == NULL) { + if ((pipes = (pipesstruct *) calloc(MI_NUM_SCREENS(mi), + sizeof (pipesstruct))) == NULL) + return; + } + pp = &pipes[screen]; + + pp->window = MI_WINDOW(mi); + if ((pp->glx_context = init_GL(mi)) != NULL) { + + reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + pp->initial_rotation = -10.0; + pinit(mi, 1); + + if (factory > 0) { + pp->valve = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_BigValve); + pp->bolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_Bolts3D); + pp->betweenbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_PipeBetweenBolts); + + pp->elbowbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowBolts); + pp->elbowcoins = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowCoins); + + pp->guagehead = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageHead); + pp->guageface = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageFace); + pp->guagedial = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageDial); + pp->guageconnector = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageConnector); + } + /* else they are all 0, thanks to calloc(). */ + + if (MI_BATCHCOUNT(mi) < 1 || MI_BATCHCOUNT(mi) > NofSysTypes + 1) { + pp->system_type = NRAND(NofSysTypes) + 1; + } else { + pp->system_type = MI_BATCHCOUNT(mi); + } + + if (MI_CYCLES(mi) > 0 && MI_CYCLES(mi) < 11) { + pp->number_of_systems = MI_CYCLES(mi); + } else { + pp->number_of_systems = 5; + } + + if (MI_SIZE(mi) < 10) { + pp->system_length = 10; + } else if (MI_SIZE(mi) > 1000) { + pp->system_length = 1000; + } else { + pp->system_length = MI_SIZE(mi); + } + } else { + MI_CLEARWINDOW(mi); + } +} void draw_pipes(ModeInfo * mi) @@ -488,7 +693,10 @@ draw_pipes(ModeInfo * mi) int newdir; int OPX, OPY, OPZ; - glXMakeCurrent(display, window, pp->glx_context); + if (!pp->glx_context) + return; + + glXMakeCurrent(display, window, *(pp->glx_context)); #if defined( MESA ) && defined( SLOW ) glDrawBuffer(GL_BACK); @@ -770,197 +978,15 @@ draw_pipes(ModeInfo * mi) #endif } -static void -reshape(ModeInfo * mi, int width, int height) -{ - pipesstruct *pp = &pipes[MI_SCREEN(mi)]; - - glViewport(0, 0, pp->WindW = (GLint) width, pp->WindH = (GLint) height); - glMatrixMode(GL_PROJECTION); - glLoadIdentity(); - /*glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); */ - gluPerspective(65.0, (GLfloat) width / (GLfloat) height, 0.1, 20.0); - glMatrixMode(GL_MODELVIEW); -} - -static void -pinit(ModeInfo * mi, int zera) -{ - pipesstruct *pp = &pipes[MI_SCREEN(mi)]; - int X, Y, Z; - - glClearDepth(1.0); - glClearColor(0.0, 0.0, 0.0, 1.0); - glColor3f(1.0, 1.0, 1.0); - - glLightfv(GL_LIGHT0, GL_AMBIENT, ambient0); - glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse0); - glLightfv(GL_LIGHT0, GL_POSITION, position0); - glLightfv(GL_LIGHT1, GL_AMBIENT, ambient1); - glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse1); - glLightfv(GL_LIGHT1, GL_POSITION, position1); - glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient); - glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside); - glEnable(GL_LIGHTING); - glEnable(GL_LIGHT0); - glEnable(GL_LIGHT1); - glEnable(GL_DEPTH_TEST); - glEnable(GL_NORMALIZE); - glEnable(GL_CULL_FACE); - - glShadeModel(GL_SMOOTH); - glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess); - glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular); - - if (zera) { - pp->system_number = 1; - glDrawBuffer(GL_FRONT_AND_BACK); - glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); - (void) memset(pp->Cells, 0, sizeof (pp->Cells)); - for (X = 0; X < HCELLS; X++) { - for (Y = 0; Y < VCELLS; Y++) { - pp->Cells[X][Y][0] = 1; - pp->Cells[X][Y][HCELLS - 1] = 1; - pp->Cells[0][Y][X] = 1; - pp->Cells[HCELLS - 1][Y][X] = 1; - } - } - for (X = 0; X < HCELLS; X++) { - for (Z = 0; Z < HCELLS; Z++) { - pp->Cells[X][0][Z] = 1; - pp->Cells[X][VCELLS - 1][Z] = 1; - } - } - (void) memset(pp->usedcolors, 0, sizeof (pp->usedcolors)); - if ((pp->initial_rotation += 10.0) > 45.0) { - pp->initial_rotation -= 90.0; - } - } - pp->counter = 0; - pp->turncounter = 0; - - if (!MI_WIN_IS_MONO(mi)) { - int collist[DEFINEDCOLORS]; - int i, j, lower = 1000; - - /* Avoid repeating colors on the same screen unless necessary */ - for (i = 0; i < DEFINEDCOLORS; i++) { - if (lower > pp->usedcolors[i]) - lower = pp->usedcolors[i]; - } - for (i = 0, j = 0; i < DEFINEDCOLORS; i++) { - if (pp->usedcolors[i] == lower) { - collist[j] = i; - j++; - } - } - i = collist[NRAND(j)]; - pp->usedcolors[i]++; - switch (i) { - case 0: - pp->system_color = MaterialRed; - break; - case 1: - pp->system_color = MaterialGreen; - break; - case 2: - pp->system_color = MaterialBlue; - break; - case 3: - pp->system_color = MaterialCyan; - break; - case 4: - pp->system_color = MaterialYellow; - break; - case 5: - pp->system_color = MaterialMagenta; - break; - case 6: - pp->system_color = MaterialWhite; - break; - } - } else { - pp->system_color = MaterialGray; - } - - do { - pp->PX = NRAND((HCELLS - 1)) + 1; - pp->PY = NRAND((VCELLS - 1)) + 1; - pp->PZ = NRAND((HCELLS - 1)) + 1; - } while (pp->Cells[pp->PX][pp->PY][pp->PZ] || - (pp->Cells[pp->PX + 1][pp->PY][pp->PZ] && pp->Cells[pp->PX - 1][pp->PY][pp->PZ] && - pp->Cells[pp->PX][pp->PY + 1][pp->PZ] && pp->Cells[pp->PX][pp->PY - 1][pp->PZ] && - pp->Cells[pp->PX][pp->PY][pp->PZ + 1] && pp->Cells[pp->PX][pp->PY][pp->PZ - 1])); - pp->Cells[pp->PX][pp->PY][pp->PZ] = 1; - pp->olddir = dirNone; - - FindNeighbors(mi); - - pp->nowdir = SelectNeighbor(mi); -} - -void -init_pipes(ModeInfo * mi) -{ - int screen = MI_SCREEN(mi); - pipesstruct *pp; - - if (pipes == NULL) { - if ((pipes = (pipesstruct *) calloc(MI_NUM_SCREENS(mi), - sizeof (pipesstruct))) == NULL) - return; - } - pp = &pipes[screen]; - - pp->glx_context = init_GL(mi); - - reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); - pp->initial_rotation = -10.0; - pinit(mi, 1); - - if (factory > 0) { - pp->valve = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_BigValve); - pp->bolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_Bolts3D); - pp->betweenbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_PipeBetweenBolts); - - pp->elbowbolts = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowBolts); - pp->elbowcoins = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_ElbowCoins); - - pp->guagehead = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageHead); - pp->guageface = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageFace); - pp->guagedial = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageDial); - pp->guageconnector = BuildLWO(MI_WIN_IS_WIREFRAME(mi), &LWO_GuageConnector); - } - /* else they are all 0, thanks to calloc(). */ - - if (MI_BATCHCOUNT(mi) < 1 || MI_BATCHCOUNT(mi) > NofSysTypes + 1) { - pp->system_type = NRAND(NofSysTypes) + 1; - } else { - pp->system_type = MI_BATCHCOUNT(mi); - } - - if (MI_CYCLES(mi) > 0 && MI_CYCLES(mi) < 11) { - pp->number_of_systems = MI_CYCLES(mi); - } else { - pp->number_of_systems = 5; - } - - if (MI_SIZE(mi) < 10) { - pp->system_length = 10; - } else if (MI_SIZE(mi) > 1000) { - pp->system_length = 1000; - } else { - pp->system_length = MI_SIZE(mi); - } - -} - void change_pipes(ModeInfo * mi) { pipesstruct *pp = &pipes[MI_SCREEN(mi)]; - glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), pp->glx_context); + if (!pp->glx_context) + return; + + glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(pp->glx_context)); pinit(mi, 1); } @@ -973,36 +999,38 @@ release_pipes(ModeInfo * mi) for (screen = 0; screen < MI_NUM_SCREENS(mi); screen++) { pipesstruct *pp = &pipes[screen]; - /* Display lists MUST be freed while their glXContext is current. */ - glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), pp->glx_context); - - if (pp->valve) - glDeleteLists(pp->valve, 1); - if (pp->bolts) - glDeleteLists(pp->bolts, 1); - if (pp->betweenbolts) - glDeleteLists(pp->betweenbolts, 1); - - if (pp->elbowbolts) - glDeleteLists(pp->elbowbolts, 1); - if (pp->elbowcoins) - glDeleteLists(pp->elbowcoins, 1); - - if (pp->guagehead) - glDeleteLists(pp->guagehead, 1); - if (pp->guageface) - glDeleteLists(pp->guageface, 1); - if (pp->guagedial) - glDeleteLists(pp->guagedial, 1); - if (pp->guageconnector) - glDeleteLists(pp->guageconnector, 1); + if (pp->glx_context) { + + /* Display lists MUST be freed while their glXContext is current. */ + glXMakeCurrent(MI_DISPLAY(mi), pp->window, *(pp->glx_context)); + + if (pp->valve) + glDeleteLists(pp->valve, 1); + if (pp->bolts) + glDeleteLists(pp->bolts, 1); + if (pp->betweenbolts) + glDeleteLists(pp->betweenbolts, 1); + + if (pp->elbowbolts) + glDeleteLists(pp->elbowbolts, 1); + if (pp->elbowcoins) + glDeleteLists(pp->elbowcoins, 1); + + if (pp->guagehead) + glDeleteLists(pp->guagehead, 1); + if (pp->guageface) + glDeleteLists(pp->guageface, 1); + if (pp->guagedial) + glDeleteLists(pp->guagedial, 1); + if (pp->guageconnector) + glDeleteLists(pp->guageconnector, 1); + } } - /* Don't destroy the glXContext. init_GL does that. */ - (void) free((void *) pipes); pipes = NULL; } + FreeAllGL(mi); } #endif diff --git a/hacks/glx/rubik.c b/hacks/glx/rubik.c index 136142d5..d52dda15 100644 --- a/hacks/glx/rubik.c +++ b/hacks/glx/rubik.c @@ -2,7 +2,7 @@ /* rubik --- Shows a auto-solving Rubik's cube */ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)rubik.c 4.04 97/07/28 xlockmore"; +static const char sccsid[] = "@(#)rubik.c 4.07 97/11/24 xlockmore"; #endif @@ -160,6 +160,15 @@ static OptionStruct desc[] = ModeSpecOpt rubik_opts = {2, opts, 1, vars, desc}; +#ifdef USE_MODULES +ModStruct rubik_description = +{"rubik", "init_rubik", "draw_rubik", "release_rubik", + "draw_rubik", "change_rubik", NULL, &rubik_opts, + 1000, -30, 5, -6, 1.0, "", + "Shows an auto-solving Rubik's Cube", 0, NULL}; + +#endif + #define VectMul(X1,Y1,Z1,X2,Y2,Z2) (Y1)*(Z2)-(Z1)*(Y2),(Z1)*(X2)-(X1)*(Z2),(X1)*(Y2)-(Y1)*(X2) #define sqr(A) ((A)*(A)) @@ -372,7 +381,7 @@ typedef struct { RubikLoc *rowLoc[MAXORIENT]; RubikMove movement; GLfloat rotatestep; - GLXContext glx_context; + GLXContext *glx_context; int AreObjectsDefined[1]; } rubikstruct; @@ -709,7 +718,6 @@ draw_cubit(ModeInfo * mi, glVertex3f(-0.35, 0.51, -0.40); glEnd(); } - glEnd(); } @@ -1669,6 +1677,8 @@ init_rubik(ModeInfo * mi) reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); objects = glGenLists(1); pinit(mi); + } else { + MI_CLEARWINDOW(mi); } } @@ -1683,7 +1693,7 @@ draw_rubik(ModeInfo * mi) return; glDrawBuffer(GL_BACK); - glXMakeCurrent(display, window, rp->glx_context); + glXMakeCurrent(display, window, *(rp->glx_context)); glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); @@ -1796,7 +1806,7 @@ release_rubik(ModeInfo * mi) (void) free((void *) rubik); rubik = NULL; } - FreeAllGL(MI_DISPLAY(mi)); + FreeAllGL(mi); } #endif diff --git a/hacks/glx/s1_1.c b/hacks/glx/s1_1.c index b7e22271..61dd91fe 100644 --- a/hacks/glx/s1_1.c +++ b/hacks/glx/s1_1.c @@ -1,6 +1,5 @@ - #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_1.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_1.c 4.04 97/07/28 xlockmore"; #endif @@ -14,9 +13,9 @@ static const char sccsid[] = "@(#)s1_1.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/s1_2.c b/hacks/glx/s1_2.c index 068a5a4e..bb7a35bd 100644 --- a/hacks/glx/s1_2.c +++ b/hacks/glx/s1_2.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_2.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_2.c 4.04 97/07/28 xlockmore"; #endif @@ -13,9 +13,9 @@ static const char sccsid[] = "@(#)s1_2.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/s1_3.c b/hacks/glx/s1_3.c index 53057ac8..1e6f868a 100644 --- a/hacks/glx/s1_3.c +++ b/hacks/glx/s1_3.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_3.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_3.c 4.04 97/07/28 xlockmore"; #endif @@ -13,9 +13,9 @@ static const char sccsid[] = "@(#)s1_3.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/s1_4.c b/hacks/glx/s1_4.c index 46e19cc2..1b3406db 100644 --- a/hacks/glx/s1_4.c +++ b/hacks/glx/s1_4.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_4.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_4.c 4.04 97/07/28 xlockmore"; #endif @@ -13,9 +13,9 @@ static const char sccsid[] = "@(#)s1_4.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/s1_5.c b/hacks/glx/s1_5.c index 66751851..53cd0bfb 100644 --- a/hacks/glx/s1_5.c +++ b/hacks/glx/s1_5.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_5.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_5.c 4.04 97/07/28 xlockmore"; #endif @@ -13,9 +13,9 @@ static const char sccsid[] = "@(#)s1_5.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/s1_6.c b/hacks/glx/s1_6.c index 7a31fe09..fb9c60e0 100644 --- a/hacks/glx/s1_6.c +++ b/hacks/glx/s1_6.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_6.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_6.c 4.04 97/07/28 xlockmore"; #endif @@ -13,9 +13,9 @@ static const char sccsid[] = "@(#)s1_6.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/s1_b.c b/hacks/glx/s1_b.c index 5aca3911..8510d916 100644 --- a/hacks/glx/s1_b.c +++ b/hacks/glx/s1_b.c @@ -1,5 +1,5 @@ #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)s1_b.c 4.2 97/04/20 xlockmore"; +static const char sccsid[] = "@(#)s1_b.c 4.04 97/07/28 xlockmore"; #endif @@ -13,9 +13,9 @@ static const char sccsid[] = "@(#)s1_b.c 4.2 97/04/20 xlockmore"; #ifndef STANDALONE #include "xlock.h" #endif - + #ifdef USE_GL - + #ifdef STANDALONE #include #endif diff --git a/hacks/glx/sproingies.c b/hacks/glx/sproingies.c index e48c639a..aa790456 100644 --- a/hacks/glx/sproingies.c +++ b/hacks/glx/sproingies.c @@ -1,10 +1,14 @@ -/* -*- Mode: C; tab-width: 4 -*- - * sproingies.c --- 3D sproingies - */ +/* -*- Mode: C; tab-width: 4 -*- */ +/* sproingies.c - 3D sproingies */ + #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)sproingies.c 4.04 97/07/26 xlockmore"; +static const char sccsid[] = "@(#)sproingies.c 4.04 97/07/28 xlockmore"; + #endif -/* Copyright 1996 by Ed Mackey, 12/7/96 freely distributable. + +/*- + * sproingies.c - Copyright 1996 by Ed Mackey, freely distributable. + * * Permission to use, copy, modify, and distribute this software and its * documentation for any purpose and without fee is hereby granted, * provided that the above copyright notice appear in all copies and that @@ -16,12 +20,15 @@ static const char sccsid[] = "@(#)sproingies.c 4.04 97/07/26 xlockmore"; * trade secrets or any patents by this file or any part thereof. In no * event will the author be liable for any lost revenue or profits or * other special, indirect and consequential damages. + * + * Revision History: + * 07-Dec-96: Written. */ #ifdef STANDALONE -# include "xlockmoreI.h" /* from the xscreensaver distribution */ -#else /* !STANDALONE */ -# include "xlock.h" /* from the xlockmore distribution */ +# include "xlockmoreI.h" /* from the xscreensaver distribution */ +#else /* !STANDALONE */ +# include "xlock.h" /* from the xlockmore distribution */ #endif /* !STANDALONE */ #ifdef USE_GL diff --git a/hacks/glx/sproingiewrap.c b/hacks/glx/sproingiewrap.c index 6fb283e5..ad11a1b7 100644 --- a/hacks/glx/sproingiewrap.c +++ b/hacks/glx/sproingiewrap.c @@ -1,13 +1,13 @@ -/* -*- Mode: C; tab-width: 4 -*- - * sproingies.c --- 3D sproingies - */ +/* -*- Mode: C; tab-width: 4 -*- */ +/* sproingiewrap.c - sproingies wrapper */ + #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)sproingiewrap.c 4.04 97/07/28 xlockmore"; +static const char sccsid[] = "@(#)sproingiewrap.c 4.07 97/11/24 xlockmore"; + #endif -/* + +/*- * sproingiewrap.c - Copyright 1996 Sproingie Technologies Incorporated. - * Source and binary freely distributable under the - * terms in xlock.c * * Permission to use, copy, modify, and distribute this software and its * documentation for any purpose and without fee is hereby granted, @@ -21,8 +21,7 @@ static const char sccsid[] = "@(#)sproingiewrap.c 4.04 97/07/28 xlockmore"; * event will the author be liable for any lost revenue or profits or * other special, indirect and consequential damages. * - *************************************************************************** - * Programming: Ed Mackey, http://www.early.com/~emackey/ + * Programming: Ed Mackey, http://www.netaxs.com/~emackey/ * Sproingie 3D objects modeled by: Al Mackey, al@iam.com * (using MetaNURBS in NewTek's Lightwave 3D v5). * @@ -35,8 +34,6 @@ static const char sccsid[] = "@(#)sproingiewrap.c 4.04 97/07/28 xlockmore"; * xlockmore's built-in Mesa/OpenGL support instead of * my own. Submitted for inclusion in xlockmore. * 09-Dec-96: Written. - * - * Ed Mackey */ /*- @@ -61,9 +58,9 @@ static const char sccsid[] = "@(#)sproingiewrap.c 4.04 97/07/28 xlockmore"; # define HACK_INIT init_sproingies # define HACK_DRAW draw_sproingies # define sproingies_opts xlockmore_opts -# define DEFAULTS "*count: 5 \n" \ +# define DEFAULTS "*delay: 100 \n" \ + "*count: 5 \n" \ "*cycles: 0 \n" \ - "*delay: 100 \n" \ "*size: 0 \n" \ "*wireframe: False \n" # include "xlockmore.h" /* from the xscreensaver distribution */ @@ -76,6 +73,15 @@ static const char sccsid[] = "@(#)sproingiewrap.c 4.04 97/07/28 xlockmore"; ModeSpecOpt sproingies_opts = { 0, NULL, 0, NULL, NULL }; +#ifdef USE_MODULES +ModStruct sproingies_description = +{"sproingies", "init_sproingies", "draw_sproingies", "release_sproingies", + "refresh_sproingies", "init_sproingies", NULL, &sproingies_opts, + 1000, 5, 0, 400, 1.0, "", + "Shows Sproingies! Nontoxic. Safe for pets and small children", 0, NULL}; + +#endif + #define MINSIZE 32 #include @@ -84,8 +90,10 @@ ModeSpecOpt sproingies_opts = { void NextSproingie(int screen); void NextSproingieDisplay(int screen); void DisplaySproingies(int screen); + #if 0 void ReshapeSproingies(int w, int h); + #endif void CleanupSproingies(int screen); void InitSproingies(int wfmode, int grnd, int mspr, int screen, int numscreens, int mono); @@ -96,8 +104,9 @@ typedef struct { GLfloat angle; GLuint limit; GLuint count; - GLXContext glx_context; + GLXContext *glx_context; int mono; + Window window; } sproingiesstruct; static sproingiesstruct *sproingies = NULL; @@ -113,6 +122,71 @@ SproingieSwap(void) } +void +init_sproingies(ModeInfo * mi) +{ + Display *display = MI_DISPLAY(mi); + Window window = MI_WINDOW(mi); + int screen = MI_SCREEN(mi); + + int cycles = MI_CYCLES(mi); + int batchcount = MI_BATCHCOUNT(mi); + int size = MI_SIZE(mi); + + sproingiesstruct *sp; + int wfmode = 0, grnd, mspr, w, h; + + if (sproingies == NULL) { + if ((sproingies = (sproingiesstruct *) calloc(MI_NUM_SCREENS(mi), + sizeof (sproingiesstruct))) == NULL) + return; + } + sp = &sproingies[screen]; + + sp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0); + sp->window = window; + if ((sp->glx_context = init_GL(mi)) != NULL) { + + if ((cycles & 1) || MI_WIN_IS_WIREFRAME(mi)) + wfmode = 1; + grnd = (cycles >> 1); + if (grnd > 2) + grnd = 2; + + mspr = batchcount; + if (mspr > 100) + mspr = 100; + + /* wireframe, ground, maxsproingies */ + InitSproingies(wfmode, grnd, mspr, MI_SCREEN(mi), MI_NUM_SCREENS(mi), sp->mono); + + /* Viewport is specified size if size >= MINSIZE && size < screensize */ + if (size == 0) { + w = MI_WIN_WIDTH(mi); + h = MI_WIN_HEIGHT(mi); + } else if (size < MINSIZE) { + w = MINSIZE; + h = MINSIZE; + } else { + w = (size > MI_WIN_WIDTH(mi)) ? MI_WIN_WIDTH(mi) : size; + h = (size > MI_WIN_HEIGHT(mi)) ? MI_WIN_HEIGHT(mi) : size; + } + + glViewport((MI_WIN_WIDTH(mi) - w) / 2, (MI_WIN_HEIGHT(mi) - h) / 2, w, h); + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + gluPerspective(65.0, (GLfloat) w / (GLfloat) h, 0.1, 2000.0); /* was 200000.0 */ + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + + swap_display = display; + swap_window = window; + DisplaySproingies(MI_SCREEN(mi)); + } else { + MI_CLEARWINDOW(mi); + } +} + /* ARGSUSED */ void draw_sproingies(ModeInfo * mi) @@ -121,8 +195,11 @@ draw_sproingies(ModeInfo * mi) Display *display = MI_DISPLAY(mi); Window window = MI_WINDOW(mi); + if (!sp->glx_context) + return; + glDrawBuffer(GL_BACK); - glXMakeCurrent(display, window, sp->glx_context); + glXMakeCurrent(display, window, *(sp->glx_context)); swap_display = display; swap_window = window; @@ -149,77 +226,17 @@ release_sproingies(ModeInfo * mi) for (screen = 0; screen < MI_NUM_SCREENS(mi); screen++) { sproingiesstruct *sp = &sproingies[screen]; - glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), sp->glx_context); - CleanupSproingies(MI_SCREEN(mi)); - } + if (sp->glx_context) { - /* Don't destroy the glXContext. init_GL does that. */ + glXMakeCurrent(MI_DISPLAY(mi), sp->window, *(sp->glx_context)); + CleanupSproingies(MI_SCREEN(mi)); + } + } (void) free((void *) sproingies); sproingies = NULL; } -} - -void -init_sproingies(ModeInfo * mi) -{ - Display *display = MI_DISPLAY(mi); - Window window = MI_WINDOW(mi); - int screen = MI_SCREEN(mi); - - int cycles = MI_CYCLES(mi); - int batchcount = MI_BATCHCOUNT(mi); - int size = MI_SIZE(mi); - - sproingiesstruct *sp; - int wfmode = 0, grnd, mspr, w, h; - - if (sproingies == NULL) { - if ((sproingies = (sproingiesstruct *) calloc(MI_NUM_SCREENS(mi), - sizeof (sproingiesstruct))) == NULL) - return; - } - sp = &sproingies[screen]; - - sp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0); - - sp->glx_context = init_GL(mi); - - if ((cycles & 1) || MI_WIN_IS_WIREFRAME(mi) || sp->mono) - wfmode = 1; - grnd = (cycles >> 1); - if (grnd > 2) - grnd = 2; - - mspr = batchcount; - if (mspr > 100) - mspr = 100; - - /* wireframe, ground, maxsproingies */ - InitSproingies(wfmode, grnd, mspr, MI_SCREEN(mi), MI_NUM_SCREENS(mi), sp->mono); - - /* Viewport is specified size if size >= MINSIZE && size < screensize */ - if (size == 0) { - w = MI_WIN_WIDTH(mi); - h = MI_WIN_HEIGHT(mi); - } else if (size < MINSIZE) { - w = MINSIZE; - h = MINSIZE; - } else { - w = (size > MI_WIN_WIDTH(mi)) ? MI_WIN_WIDTH(mi) : size; - h = (size > MI_WIN_HEIGHT(mi)) ? MI_WIN_HEIGHT(mi) : size; - } - - glViewport((MI_WIN_WIDTH(mi) - w) / 2, (MI_WIN_HEIGHT(mi) - h) / 2, w, h); - glMatrixMode(GL_PROJECTION); - glLoadIdentity(); - gluPerspective(65.0, (GLfloat) w / (GLfloat) h, 0.1, 2000.0); /* was 200000.0 */ - glMatrixMode(GL_MODELVIEW); - glLoadIdentity(); - - swap_display = display; - swap_window = window; - DisplaySproingies(MI_SCREEN(mi)); + FreeAllGL(mi); } #endif diff --git a/hacks/glx/stairs.c b/hacks/glx/stairs.c new file mode 100644 index 00000000..5896e195 --- /dev/null +++ b/hacks/glx/stairs.c @@ -0,0 +1,495 @@ +/* -*- Mode: C; tab-width: 4 -*- */ +/* stairs --- Infinite Stairs, and Escher-like scene. */ + +#if !defined( lint ) && !defined( SABER ) +static const char sccsid[] = "@(#)stairs.c 4.07 97/11/24 xlockmore"; + +#endif + +#undef DEBUG_LISTS + +/*- + * Permission to use, copy, modify, and distribute this software and its + * documentation for any purpose and without fee is hereby granted, + * provided that the above copyright notice appear in all copies and that + * both that copyright notice and this permission notice appear in + * supporting documentation. + * + * This file is provided AS IS with no warranties of any kind. The author + * shall have no liability with respect to the infringement of copyrights, + * trade secrets or any patents by this file or any part thereof. In no + * event will the author be liable for any lost revenue or profits or + * other special, indirect and consequential damages. + * + * This mode shows some interesting scenes that are impossible OR very + * weird to build in the real universe. Much of the scenes are inspirated + * on Mauritz Cornelis stairs's works which derivated the mode's name. + * M.C. Escher (1898-1972) was a dutch artist and many people prefer to + * say he was a mathematician. + * + * Thanks goes to Brian Paul for making it possible and inexpensive to use + * OpenGL at home. + * + * Since I'm not a native English speaker, my apologies for any grammatical + * mistake. + * + * My e-mail addresses are + * vianna@cat.cbpf.br + * and + * m-vianna@usa.net + * + * Marcelo F. Vianna (Jun-01-1997) + * + * Revision History: + * 07-Jan-98: This would be a scene for the escher mode, but now escher mode + * was splitted in different modes for each scene. This is the + * initial release and is not working yet. + * Marcelo F. Vianna. + * + */ + +/*- + * Texture mapping is only available on RGBA contexts, Mono and color index + * visuals DO NOT support texture mapping in OpenGL. + * + * BUT Mesa do implements RGBA contexts in pseudo color visuals, so texture + * mapping shuld work on PseudoColor, DirectColor, TrueColor using Mesa. Mono + * is not officially supported for both OpenGL and Mesa, but seems to not crash + * Mesa. +z * + * In real OpenGL, PseudoColor DO NOT support texture map (as far as I know). + */ + +#include + +#ifdef STANDALONE +# define PROGCLASS "Stairs" +# define HACK_INIT init_stairs +# define HACK_DRAW draw_stairs +# define stairs_opts xlockmore_opts +# define DEFAULTS "*cycles: 1 \n" \ + "*delay: 200000 \n" \ + "*wireframe: False \n" +# include "xlockmore.h" /* from the xscreensaver distribution */ +#else /* !STANDALONE */ +# include "xlock.h" /* from the xlockmore distribution */ + +#endif /* !STANDALONE */ + +#ifdef USE_GL + +#include +#include "e_textures.h" + +ModeSpecOpt stairs_opts = +{0, NULL, 0, NULL, NULL}; + +#ifdef USE_MODULES +ModStruct stairs_description = +{"stairs", "init_stairs", "draw_stairs", "release_stairs", + "draw_stairs", "change_stairs", NULL, &stairs_opts, + 1000, 1, 1, 1, 1.0, "", + "Shows Infinite Stairs, an Escher-like scene", 0, NULL}; + +#endif + +#define Scale4Window 0.3 +#define Scale4Iconic 0.4 + +#define sqr(A) ((A)*(A)) + +#ifndef Pi +#define Pi M_PI +#endif + +/*************************************************************************/ + +typedef struct { + GLint WindH, WindW; + GLfloat step; + Bool direction; + int AreObjectsDefined[1]; + int sphere_position; + GLXContext *glx_context; +} stairsstruct; + +static float front_shininess[] = +{60.0}; +static float front_specular[] = +{0.7, 0.7, 0.7, 1.0}; +static float ambient[] = +{0.0, 0.0, 0.0, 1.0}; +static float diffuse[] = +{1.0, 1.0, 1.0, 1.0}; +static float position0[] = +{1.0, 1.0, 1.0, 0.0}; +static float position1[] = +{-1.0, -1.0, 1.0, 0.0}; +static float lmodel_ambient[] = +{0.5, 0.5, 0.5, 1.0}; +static float lmodel_twoside[] = +{GL_TRUE}; + +#if 0 +static float MaterialRed[] = +{0.7, 0.0, 0.0, 1.0}; +static float MaterialGreen[] = +{0.1, 0.5, 0.2, 1.0}; +static float MaterialBlue[] = +{0.0, 0.0, 0.7, 1.0}; +static float MaterialCyan[] = +{0.2, 0.5, 0.7, 1.0}; +static float MaterialMagenta[] = +{0.6, 0.2, 0.5, 1.0}; +static float MaterialGray[] = +{0.2, 0.2, 0.2, 1.0}; +static float MaterialGray5[] = +{0.5, 0.5, 0.5, 1.0}; +static float MaterialGray6[] = +{0.6, 0.6, 0.6, 1.0}; +static float MaterialGray8[] = +{0.8, 0.8, 0.8, 1.0}; +#endif +static float MaterialYellow[] = +{0.7, 0.7, 0.0, 1.0}; +static float MaterialWhite[] = +{0.7, 0.7, 0.7, 1.0}; + +static float positions[] = +{ + -2.5, 4.0, 0.0, /* First one is FUDGED :) */ + -3.0, 3.25, 1.0, + -3.0, 4.4, 1.5, + -3.0, 3.05, 2.0, + -3.0, 4.2, 2.5, + + -3.0, 2.85, 3.0, + -2.5, 4.0, 3.0, + -2.0, 2.75, 3.0, + -1.5, 3.9, 3.0, + -1.0, 2.65, 3.0, + -0.5, 3.8, 3.0, + 0.0, 2.55, 3.0, + 0.5, 3.7, 3.0, + 1.0, 2.45, 3.0, + 1.5, 3.6, 3.0, + 2.0, 2.35, 3.0, + + 2.0, 3.5, 2.5, + 2.0, 2.25, 2.0, + 2.0, 3.4, 1.5, + 2.0, 2.15, 1.0, + 2.0, 3.3, 0.5, + 2.0, 2.05, 0.0, + 2.0, 3.2, -0.5, + 2.0, 1.95, -1.0, + 2.0, 3.1, -1.5, + 2.0, 1.85, -2.0, + + 1.5, 2.9, -2.0, + 1.0, 1.65, -2.0, + 0.5, 2.7, -2.0, + 0.0, 1.55, -2.0, + -0.5, 2.5, -2.0, + -1.0, 1.45, -2.0, +}; +#define NPOSITIONS ((sizeof positions) / (sizeof positions[0])) + +static stairsstruct *stairs = NULL; +static GLuint objects; + +#define ObjSphere 0 + +#define PlankWidth 3.0 +#define PlankHeight 0.35 +#define PlankThickness 0.15 + +static void +mySphere(float radius) +{ + GLUquadricObj *quadObj; + + quadObj = gluNewQuadric(); + gluQuadricDrawStyle(quadObj, (GLenum) GLU_FILL); + gluSphere(quadObj, radius, 16, 16); + gluDeleteQuadric(quadObj); +} + +static void +draw_block(stairsstruct * sp, GLfloat width, GLfloat height, GLfloat thickness) +{ + glBegin(GL_QUADS); + glNormal3f(0, 0, 1); + glTexCoord2f(0, 0); + glVertex3f(-width, -height, thickness); + glTexCoord2f(1, 0); + glVertex3f(width, -height, thickness); + glTexCoord2f(1, 1); + glVertex3f(width, height, thickness); + glTexCoord2f(0, 1); + glVertex3f(-width, height, thickness); + glNormal3f(0, 0, -1); + glTexCoord2f(0, 0); + glVertex3f(-width, height, -thickness); + glTexCoord2f(1, 0); + glVertex3f(width, height, -thickness); + glTexCoord2f(1, 1); + glVertex3f(width, -height, -thickness); + glTexCoord2f(0, 1); + glVertex3f(-width, -height, -thickness); + glNormal3f(0, 1, 0); + glTexCoord2f(0, 0); + glVertex3f(-width, height, thickness); + glTexCoord2f(1, 0); + glVertex3f(width, height, thickness); + glTexCoord2f(1, 1); + glVertex3f(width, height, -thickness); + glTexCoord2f(0, 1); + glVertex3f(-width, height, -thickness); + glNormal3f(0, -1, 0); + glTexCoord2f(0, 0); + glVertex3f(-width, -height, -thickness); + glTexCoord2f(1, 0); + glVertex3f(width, -height, -thickness); + glTexCoord2f(1, 1); + glVertex3f(width, -height, thickness); + glTexCoord2f(0, 1); + glVertex3f(-width, -height, thickness); + glNormal3f(1, 0, 0); + glTexCoord2f(0, 0); + glVertex3f(width, -height, thickness); + glTexCoord2f(1, 0); + glVertex3f(width, -height, -thickness); + glTexCoord2f(1, 1); + glVertex3f(width, height, -thickness); + glTexCoord2f(0, 1); + glVertex3f(width, height, thickness); + glNormal3f(-1, 0, 0); + glTexCoord2f(0, 0); + glVertex3f(-width, height, thickness); + glTexCoord2f(1, 0); + glVertex3f(-width, height, -thickness); + glTexCoord2f(1, 1); + glVertex3f(-width, -height, -thickness); + glTexCoord2f(0, 1); + glVertex3f(-width, -height, thickness); + glEnd(); +} + +static void +draw_degree(stairsstruct * sp, GLfloat w, GLfloat h , GLfloat t) +{ + draw_block(sp, w, h, t); +} + +static void +draw_stairs_internal(ModeInfo *mi) +{ + stairsstruct *sp = &stairs[MI_SCREEN(mi)]; + GLfloat X; + + glPushMatrix(); + glPushMatrix(); + glTranslatef(-3.0, 0.1, 2.0); + for (X=0; X< 2; X++) { + draw_degree(sp, 0.5, 2.7+0.1*X, 0.5); + glTranslatef( 0.0, 0.1,-1.0); + } + glPopMatrix(); + glTranslatef(-3.0, 0.0, 3.0); + glPushMatrix(); + + for (X=0; X< 6; X++) { + draw_degree(sp, 0.5, 2.6-0.1*X, 0.5); + glTranslatef( 1.0,-0.1, 0.0); + } + glTranslatef(-1.0,-0.9,-1.0); + for (X=0; X< 5; X++) { + draw_degree(sp, 0.5, 3.0-0.1*X, 0.5); + glTranslatef( 0.0, 0.0,-1.0); + } + glTranslatef(-1.0,-1.1, 1.0); + for (X=0; X< 3; X++) { + draw_degree(sp, 0.5, 3.5-0.1*X, 0.5); + glTranslatef(-1.0,-0.1, 0.0); + } + glPopMatrix(); + glPopMatrix(); + + glPushMatrix(); + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialYellow); + + glTranslatef((GLfloat) positions[sp->sphere_position], + (GLfloat) positions[sp->sphere_position + 1], + (GLfloat) positions[sp->sphere_position + 2]); + if (sp->sphere_position == 0) /* FUDGE soo its not so obvious */ + mySphere(0.48); + else + mySphere(0.5); + glPopMatrix(); + sp->sphere_position += 3; + if (sp->sphere_position >= NPOSITIONS) + sp->sphere_position = 0; +} + +static void +reshape(ModeInfo * mi, int width, int height) +{ + stairsstruct *sp = &stairs[MI_SCREEN(mi)]; + + glViewport(0, 0, sp->WindW = (GLint) width, sp->WindH = (GLint) height); + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glFrustum(-1.0, 1.0, -1.0, 1.0, 5.0, 15.0); + glMatrixMode(GL_MODELVIEW); + if (width >= 1024) { + glLineWidth(3); + glPointSize(3); + } else if (width >= 512) { + glLineWidth(2); + glPointSize(2); + } else { + glLineWidth(1); + glPointSize(1); + } +} + +static void +pinit(ModeInfo * mi) +{ +/* stairsstruct *sp = &stairs[MI_SCREEN(mi)];*/ + + glClearDepth(1.0); + glClearColor(0.0, 0.0, 0.0, 1.0); + + glLightfv(GL_LIGHT0, GL_AMBIENT, ambient); + glLightfv(GL_LIGHT0, GL_DIFFUSE, diffuse); + glLightfv(GL_LIGHT0, GL_POSITION, position0); + glLightfv(GL_LIGHT1, GL_AMBIENT, ambient); + glLightfv(GL_LIGHT1, GL_DIFFUSE, diffuse); + glLightfv(GL_LIGHT1, GL_POSITION, position1); + glLightModelfv(GL_LIGHT_MODEL_AMBIENT, lmodel_ambient); + glLightModelfv(GL_LIGHT_MODEL_TWO_SIDE, lmodel_twoside); + glEnable(GL_LIGHTING); + glEnable(GL_LIGHT0); + glEnable(GL_LIGHT1); + glEnable(GL_NORMALIZE); + glFrontFace(GL_CCW); + glCullFace(GL_BACK); + + glMaterialfv(GL_FRONT_AND_BACK, GL_DIFFUSE, MaterialWhite); + glShadeModel(GL_FLAT); + glEnable(GL_DEPTH_TEST); + glEnable(GL_TEXTURE_2D); + glEnable(GL_CULL_FACE); + + glPixelStorei(GL_UNPACK_ALIGNMENT, 1); + gluBuild2DMipmaps(GL_TEXTURE_2D, 3, WoodTextureWidth, WoodTextureHeight, + GL_RGB, GL_UNSIGNED_BYTE, WoodTextureData); + glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); + glTexParameterf(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); + + glMaterialfv(GL_FRONT_AND_BACK, GL_SHININESS, front_shininess); + glMaterialfv(GL_FRONT_AND_BACK, GL_SPECULAR, front_specular); +} + +void +init_stairs(ModeInfo * mi) +{ + int screen = MI_SCREEN(mi); + stairsstruct *sp; + + if (stairs == NULL) { + if ((stairs = (stairsstruct *) calloc(MI_NUM_SCREENS(mi), + sizeof (stairsstruct))) == NULL) + return; + } + sp = &stairs[screen]; + sp->step = 0.0; + sp->direction = LRAND() & 1; + sp->sphere_position = NRAND(NPOSITIONS / 3) * 3; + + if ((sp->glx_context = init_GL(mi)) != NULL) { + + reshape(mi, MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + glDrawBuffer(GL_BACK); + if (!glIsList(objects)) + objects = glGenLists(1); + pinit(mi); + } else { + MI_CLEARWINDOW(mi); + } +} + +void +draw_stairs(ModeInfo * mi) +{ + stairsstruct *sp = &stairs[MI_SCREEN(mi)]; + + Display *display = MI_DISPLAY(mi); + Window window = MI_WINDOW(mi); + + if (!sp->glx_context) + return; + + glXMakeCurrent(display, window, *(sp->glx_context)); + + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + glPushMatrix(); + + glTranslatef(0.0, 0.0, -10.0); + + if (!MI_WIN_IS_ICONIC(mi)) { + glScalef(Scale4Window * sp->WindH / sp->WindW, Scale4Window, Scale4Window); + } else { + glScalef(Scale4Iconic * sp->WindH / sp->WindW, Scale4Iconic, Scale4Iconic); + } + + glRotatef(44.5, 1, 0, 0); + glRotatef(50 + ((sp->direction) ? 1 : -1 ) * + ((sp->step * 100 > 120) ? sp->step * 100 - 120 : 0), 0, 1, 0); + if (sp->step * 100 >= 360 + 120) { /* stop showing secrets */ + sp->step = 0; + sp->direction = LRAND() & 1; + } + draw_stairs_internal(mi); + + glPopMatrix(); + + glFlush(); + + glXSwapBuffers(display, window); + + sp->step += 0.025; +} + +void +change_stairs(ModeInfo * mi) +{ + stairsstruct *sp = &stairs[MI_SCREEN(mi)]; + + if (!sp->glx_context) + return; + + glXMakeCurrent(MI_DISPLAY(mi), MI_WINDOW(mi), *(sp->glx_context)); + pinit(mi); +} + +void +release_stairs(ModeInfo * mi) +{ + if (stairs != NULL) { + (void) free((void *) stairs); + stairs = NULL; + } + if (glIsList(objects)) { + glDeleteLists(objects, 1); + } + FreeAllGL(mi); +} + +#endif diff --git a/hacks/glx/superquadrics.c b/hacks/glx/superquadrics.c index 7e1d33e2..8e2a7636 100644 --- a/hacks/glx/superquadrics.c +++ b/hacks/glx/superquadrics.c @@ -1,10 +1,13 @@ -/* -*- Mode: C; tab-width: 4 -*- - * superquadrics.c --- 3D mathematical shapes - */ +/* -*- Mode: C; tab-width: 4 -*- */ +/* superquadrics --- 3D mathematical shapes */ + #if !defined( lint ) && !defined( SABER ) -static const char sccsid[] = "@(#)superquadrics.c 4.04 97/07/28 xlockmore"; +static const char sccsid[] = "@(#)superquadrics.c 4.07 97/11/24 xlockmore"; + #endif -/* Permission to use, copy, modify, and distribute this software and its + +/*- + * Permission to use, copy, modify, and distribute this software and its * documentation for any purpose and without fee is hereby granted, * provided that the above copyright notice appear in all copies and that * both that copyright notice and this permission notice appear in @@ -80,9 +83,9 @@ static const char sccsid[] = "@(#)superquadrics.c 4.04 97/07/28 xlockmore"; # define HACK_INIT init_superquadrics # define HACK_DRAW draw_superquadrics # define superquadrics_opts xlockmore_opts -# define DEFAULTS "*count: 25 \n" \ +# define DEFAULTS "*delay: 100 \n" \ + "*count: 25 \n" \ "*cycles: 40 \n" \ - "*delay: 100 \n" \ "*wireframe: False \n" # include "xlockmore.h" /* from the xscreensaver distribution */ #else /* !STANDALONE */ @@ -118,6 +121,15 @@ static OptionStruct desc[] = ModeSpecOpt superquadrics_opts = {1, opts, 1, vars, desc}; +#ifdef USE_MODULES +ModStruct superquadrics_description = +{"superquadrics", "init_superquadrics", "draw_superquadrics", "release_superquadrics", + "refresh_superquadrics", "init_superquadrics", NULL, &superquadrics_opts, + 1000, 25, 40, 1, 1.0, "", + "Shows 3D mathematical shapes", 0, NULL}; + +#endif + #include #define MaxRes 50 @@ -133,7 +145,7 @@ typedef struct { } state; typedef struct { - GLXContext glx_context; + GLXContext *glx_context; int dist, wireframe, flatshade, shownorms, maxcount, maxwait; int counter, viewcount, viewwait, mono; GLfloat curmat[4][4], rotx, roty, rotz, spinspeed; @@ -258,8 +270,13 @@ MakeUpStuff(int allstuff, superquadricsstruct * sp) } if (dostuff & 4) { if (sp->mono) { - b = g = r = (GLfloat) (140 + myrand(100)) / 255.0; - b2 = g2 = r2 = ((r > 0.69) ? (1.0 - r) : r); + if (sp->wireframe) { + b = g = r = 1.0; + b2 = g2 = r2 = 1.0; + } else { + b = g = r = (GLfloat) (140 + myrand(100)) / 255.0; + b2 = g2 = r2 = ((r > 0.69) ? (1.0 - r) : r); + } } else { r = (GLfloat) (40 + myrand(200)) / 255.0; g = (GLfloat) (40 + myrand(200)) / 255.0; @@ -707,21 +724,18 @@ init_superquadrics(ModeInfo * mi) sp = &superquadrics[screen]; sp->mono = (MI_WIN_IS_MONO(mi) ? 1 : 0); - sp->glx_context = init_GL(mi); - - InitSuperquadrics(MI_WIN_IS_WIREFRAME(mi) || sp->mono, 0, - MI_BATCHCOUNT(mi), MI_CYCLES(mi), spinspeed, sp); - ReshapeSuperquadrics(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); + if ((sp->glx_context = init_GL(mi)) != NULL) { - DisplaySuperquadrics(sp); - glFinish(); - glXSwapBuffers(display, window); -} + InitSuperquadrics(MI_WIN_IS_WIREFRAME(mi), 0, + MI_BATCHCOUNT(mi), MI_CYCLES(mi), spinspeed, sp); + ReshapeSuperquadrics(MI_WIN_WIDTH(mi), MI_WIN_HEIGHT(mi)); -void -refresh_superquadrics(ModeInfo * mi) -{ - /* Nothing happens here */ + DisplaySuperquadrics(sp); + glFinish(); + glXSwapBuffers(display, window); + } else { + MI_CLEARWINDOW(mi); + } } void @@ -731,7 +745,10 @@ draw_superquadrics(ModeInfo * mi) Display *display = MI_DISPLAY(mi); Window window = MI_WINDOW(mi); - glXMakeCurrent(display, window, sp->glx_context); + if (!sp->glx_context) + return; + + glXMakeCurrent(display, window, *(sp->glx_context)); NextSuperquadricDisplay(sp); @@ -739,16 +756,20 @@ draw_superquadrics(ModeInfo * mi) glXSwapBuffers(display, window); } +void +refresh_superquadrics(ModeInfo * mi) +{ + /* Nothing happens here */ +} + void release_superquadrics(ModeInfo * mi) { if (superquadrics != NULL) { - - /* Don't destroy the glXContext. init_GL does that. */ - (void) free((void *) superquadrics); superquadrics = NULL; } + FreeAllGL(mi); } diff --git a/hacks/glx/xlock-gl.c b/hacks/glx/xlock-gl.c index 28ee7ca3..d8cfd7a6 100644 --- a/hacks/glx/xlock-gl.c +++ b/hacks/glx/xlock-gl.c @@ -1,5 +1,5 @@ /* xlock-gc.c --- xscreensaver compatibility layer for xlockmore GL modules. - * xscreensaver, Copyright (c) 1997 Jamie Zawinski + * xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -40,7 +40,7 @@ BadValue_ehandler (Display *dpy, XErrorEvent *error) } -GLXContext +GLXContext * init_GL(ModeInfo * mi) { Display *dpy = mi->dpy; @@ -88,7 +88,14 @@ init_GL(ModeInfo * mi) } } - return (glx_context); + /* GLXContext is already a pointer type. + Why this function returns a pointer to a pointer, I have no idea... + */ + { + GLXContext *ptr = (GLXContext *) malloc(sizeof(GLXContext)); + *ptr = glx_context; + return ptr; + } } diff --git a/hacks/helix.c b/hacks/helix.c index 95ddb410..1fe62e47 100644 --- a/hacks/helix.c +++ b/hacks/helix.c @@ -284,15 +284,11 @@ char *progclass = "Helix"; char *defaults [] = { "Helix.background: black", /* to placate SGI */ "*delay: 5", - "*eraseSpeed: 400", - "*eraseMode: -1", 0 }; XrmOptionDescRec options [] = { { "-delay", ".delay", XrmoptionSepArg, 0 }, - { "-erase-speed", ".eraseSpeed", XrmoptionSepArg, 0 }, - { "-erase-mode", ".eraseMode", XrmoptionSepArg, 0 }, { 0 }, }; int options_size = (sizeof (options) / sizeof (options[0])); diff --git a/hacks/hopalong.c b/hacks/hopalong.c index 7d290f2d..cb663ac3 100644 --- a/hacks/hopalong.c +++ b/hacks/hopalong.c @@ -55,9 +55,7 @@ static const char sccsid[] = "@(#)hop.c 4.02 97/04/01 xlockmore"; # define DEFAULTS "*count: 1000 \n" \ "*cycles: 2500 \n" \ "*delay: 10000 \n" \ - "*ncolors: 200 \n" \ - "*eraseSpeed: 400 \n" \ - "*eraseMode: -1 \n" + "*ncolors: 200 \n" # define SMOOTH_COLORS # include "xlockmore.h" /* from the xscreensaver distribution */ # include "erase.h" diff --git a/hacks/images/bob.xbm b/hacks/images/bob.xbm new file mode 100644 index 00000000..f44adda4 --- /dev/null +++ b/hacks/images/bob.xbm @@ -0,0 +1,43 @@ +#define bob_width 61 +#define bob_height 75 +static unsigned char bob_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x07,0x00, + 0x00,0x00,0x00,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xfb, + 0x00,0x00,0x00,0xc0,0xff,0xcf,0x9f,0xd1,0x03,0x00,0x00,0xf0,0x7f,0x8c,0x33, + 0x91,0x07,0x00,0x00,0xf8,0xa7,0x18,0x27,0xb1,0x06,0x00,0x00,0xfc,0x47,0x31, + 0x4e,0xa6,0x0e,0x00,0x00,0xfe,0x4f,0x21,0x4c,0xae,0x3d,0x00,0x00,0xff,0xdf, + 0x23,0x8d,0xbe,0x7d,0x00,0x80,0xff,0xff,0x67,0xbd,0xfe,0xff,0x01,0x80,0xff, + 0xff,0x7f,0xbf,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,0xbf,0xff,0xf8,0x07,0xc0, + 0xff,0xff,0xff,0xbf,0x3f,0xf8,0x07,0xc0,0xff,0xff,0xff,0xff,0x07,0xf8,0x0f, + 0xc0,0xff,0xff,0xff,0x3f,0x00,0xf8,0x0f,0xe0,0x7f,0x00,0xf8,0x07,0x00,0xf0, + 0x0f,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00, + 0xf0,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xf4,0x07,0xe0,0x3f,0x00,0x00,0x00, + 0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe4,0x07,0xe0,0x3f,0x00,0x00, + 0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe7,0x07,0xe0,0x3f,0x00, + 0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f,0x00,0x00,0x00,0x00,0xe6,0x07,0xe0,0x3f, + 0x00,0x00,0x00,0x00,0xe6,0x07,0xc0,0x3f,0x00,0x00,0x00,0x78,0xf6,0x07,0xa0, + 0xbf,0xff,0x00,0x00,0xff,0xf7,0x07,0x70,0x9f,0xff,0x01,0x80,0xff,0xef,0x07, + 0xf0,0x1c,0x80,0x03,0xe0,0x01,0xef,0x07,0xf0,0x1f,0xbe,0x07,0xf0,0x3f,0xee, + 0x07,0xe0,0x9d,0x83,0x1f,0xf8,0xe1,0xdc,0x07,0xe0,0xc1,0x7f,0x1f,0xfc,0xff, + 0xc8,0x07,0xe0,0xc1,0x69,0x1e,0x7e,0xca,0xc0,0x03,0xe0,0x81,0xb8,0x1f,0xc0, + 0x0e,0xc0,0x03,0xe0,0x01,0xc0,0x1b,0xc0,0xcf,0xc1,0x03,0xc0,0x03,0xf7,0x11, + 0x00,0x7f,0xc0,0x03,0xc0,0x03,0x7c,0x18,0x00,0x1c,0xc0,0x02,0xc0,0x02,0x30, + 0x08,0x00,0x00,0x40,0x03,0x40,0x03,0x00,0x08,0x00,0x00,0x40,0x02,0x40,0x13, + 0x00,0x0c,0x00,0x00,0x60,0x02,0x40,0x12,0x00,0x0e,0x00,0x00,0xc0,0x03,0x80, + 0x33,0x80,0x0e,0x00,0x00,0xa8,0x01,0x00,0x33,0x40,0x0f,0xa0,0x03,0x2c,0x00, + 0x00,0x74,0x30,0x0f,0x38,0x07,0x2e,0x00,0x00,0x74,0x98,0x1f,0x1e,0x1e,0x2f, + 0x00,0x00,0xfc,0x8f,0xff,0x0f,0xfc,0x2f,0x00,0x00,0xf8,0xe3,0xff,0x03,0xf8, + 0x2f,0x00,0x00,0xf8,0xfd,0xff,0x81,0xff,0x3f,0x00,0x00,0xb8,0xf9,0x1f,0xf8, + 0x0f,0x1e,0x00,0x00,0x30,0xf1,0xf0,0x0f,0x03,0x0e,0x00,0x00,0x30,0xf1,0x01, + 0x80,0x01,0x0f,0x00,0x00,0x20,0xf1,0xf7,0xff,0x00,0x07,0x00,0x00,0x60,0xe3, + 0x01,0x60,0x80,0x07,0x00,0x00,0x60,0xc3,0xef,0x3f,0x80,0x03,0x00,0x00,0x40, + 0xc2,0xff,0x0f,0xc0,0x03,0x00,0x00,0xc0,0xe6,0x1f,0x00,0xc0,0x01,0x00,0x00, + 0x80,0xf4,0xfe,0x3f,0xe0,0x00,0x00,0x00,0x80,0x79,0xfe,0x1f,0xe0,0x00,0x00, + 0xc0,0x01,0x3d,0x3e,0x00,0x70,0x00,0x00,0x30,0x06,0x3e,0x0f,0x00,0x38,0x00, + 0x00,0xc8,0x8c,0x1f,0x07,0x00,0x38,0x00,0x00,0xf4,0xcc,0x8f,0x07,0x00,0x1c, + 0x00,0x00,0x72,0xee,0xf7,0x07,0x00,0x0e,0x00,0x00,0x02,0xff,0xe3,0x07,0x00, + 0x07,0x00,0x00,0x32,0xfe,0xc1,0xff,0x8f,0x03,0x00,0x00,0x3e,0xfe,0x80,0xff, + 0xff,0x01,0x00,0x00,0x7e,0x7c,0x00,0x00,0x7e,0x00,0x00,0x00,0x7c,0x3c,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfc,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x1c, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00}; diff --git a/hacks/images/bubbles/blood.pov b/hacks/images/bubbles/blood.pov new file mode 100644 index 00000000..8166f4ea --- /dev/null +++ b/hacks/images/bubbles/blood.pov @@ -0,0 +1,24 @@ +#include "colors.inc" +#include "shapes.inc" +#include "textures.inc" + +/* The following make the field of view as wide as it is high + * Thus, you should have the -W and -H command line options + * equal to each other. */ +camera { + location <5.8, 0, 0> + up <0, 1, 0> + right <1, 0, 0> + look_at <0, 0, 0> +} + +sphere { + <0,0,0>, 2.5 + texture { Blood_Marble + scale <2, 2, 2> + rotate <0, 20, 0> } + finish { Dull } +} + +light_source {<6, 1, 0> color White} +/* light_source {<6.1, 1, 0> color White} */ diff --git a/hacks/images/bubbles/blood1.xpm b/hacks/images/bubbles/blood1.xpm new file mode 100644 index 00000000..c76131a6 --- /dev/null +++ b/hacks/images/bubbles/blood1.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char *blood1[] = { +/* width height ncolors chars_per_pixel */ +"10 10 57 2", +/* colors */ +"`` c None", +"`a c #250000", +"`b c #415050", +"`c c #013232", +"`d c #000606", +"`e c #0E2E2E", +"`f c #60C0C0", +"`g c #002020", +"`h c #102222", +"`i c #4D5454", +"`j c #043737", +"`k c #000505", +"`l c #65A0A0", +"`m c #7ED6D6", +"`n c #196969", +"`o c #0C4545", +"`p c #642525", +"`q c #385C5C", +"`r c #002525", +"`s c #6D8686", +"`t c #354F4F", +"`u c #5A7D7D", +"`v c #030A0A", +"`w c #001E1E", +"`x c #71B1B1", +"`y c #274E4E", +"`z c #287373", +"a` c #0D1A1A", +"aa c #053333", +"ab c #001717", +"ac c #374343", +"ad c #000303", +"ae c #070000", +"af c #537272", +"ag c #520B0B", +"ah c #0C3636", +"ai c #297D7D", +"aj c #AF5C5C", +"ak c #003737", +"al c #010000", +"am c #042727", +"an c #0C3C3C", +"ao c #000202", +"ap c #042020", +"aq c #419A9A", +"ar c #420707", +"as c #064949", +"at c #071212", +"au c #1D4F4F", +"av c #154747", +"aw c #000101", +"ax c #264747", +"ay c #002828", +"az c #000707", +"b` c #364949", +"ba c #001414", +"bb c #002121", +/* pixels */ +"```````k`aamaeal````", +"````arahauai`nag`c``", +"``aw`o`zaqafajaxam`r", +"``akav`q`f`m`lb`anay", +"```dahac`u`x`s`t`hab", +"```aat`y`b`iaqai`ebb", +"```gaaah`p`yava``jba", +"````ad`c`vasaaap````", +"``````aeaz`waoae````", +"````````````````````" +}; diff --git a/hacks/images/bubbles/blood10.xpm b/hacks/images/bubbles/blood10.xpm new file mode 100644 index 00000000..7f948fb0 --- /dev/null +++ b/hacks/images/bubbles/blood10.xpm @@ -0,0 +1,257 @@ +/* XPM */ +static char *blood10[] = { +/* width height ncolors chars_per_pixel */ +"60 60 190 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #010404", +"`j c #013232", +"`k c #3C9090", +"`l c #251A1A", +"`m c #095454", +"`n c #190101", +"`o c #70D0D0", +"`p c #000606", +"`q c #003434", +"`r c #0E2E2E", +"`s c #001313", +"`t c #115555", +"`u c #213030", +"`v c #60C0C0", +"`w c #0F0404", +"`x c #002020", +"`y c #165D5D", +"`z c #636A6A", +"a` c #072A2A", +"aa c #445C5C", +"ab c #6C7676", +"ac c #000C0C", +"ad c #549393", +"ae c #001919", +"af c #102222", +"ag c #4D5454", +"ah c #002626", +"ai c #163535", +"aj c #043737", +"ak c #4F6363", +"al c #000505", +"am c #65A0A0", +"an c #052E2E", +"ao c #041616", +"ap c #044444", +"aq c #76C1C1", +"ar c #7ED6D6", +"as c #001212", +"at c #196969", +"au c #385656", +"av c #0C4545", +"aw c #767F7F", +"ax c #642525", +"ay c #360505", +"az c gray28", +"b` c #5FB4B4", +"ba c #002C2C", +"bb c #0E2626", +"bc c #8C9B9B", +"bd c #000B0B", +"be c #030404", +"bf c #001818", +"bg c #944040", +"bh c #280404", +"bi c #0A0E0E", +"bj c #385C5C", +"bk c #002525", +"bl c #6D8686", +"bm c #407E7E", +"bn c #000404", +"bo c #354F4F", +"bp c #739999", +"bq c #001111", +"br c #5A7D7D", +"bs c #347272", +"bt c #030A0A", +"bu c #5AABAB", +"bv c #010808", +"bw c #001E1E", +"bx c #6E3B3B", +"by c #71B1B1", +"bz c #183C3C", +"c` c #274E4E", +"ca c #266464", +"cb c #000A0A", +"cc c #287373", +"cd c #0D1A1A", +"ce c #2B3E3E", +"cf c #053333", +"cg c #121515", +"ch c #270C0C", +"ci c #001717", +"cj c #253838", +"ck c #418888", +"cl c #374343", +"cm c #013C3C", +"cn c #040707", +"co c #031D1D", +"cp c #192C2C", +"cq c #000303", +"cr c #070000", +"cs c #164040", +"ct c #537272", +"cu c #5B8787", +"cv c #120E0E", +"cw c #032A2A", +"cx c #520B0B", +"cy c #001010", +"cz c #062323", +"d` c #435555", +"da c #0C3636", +"db c #8EAFAF", +"dc c #282A2A", +"dd c #001D1D", +"de c #0C1515", +"df c #515C5C", +"dg c #1B5555", +"dh c #297D7D", +"di c #002A2A", +"dj c #2B3030", +"dk c #4F3939", +"dl c #AF5C5C", +"dm c #000909", +"dn c #003737", +"do c #010000", +"dp c #001616", +"dq c #042727", +"dr c #0C3C3C", +"ds c #030F0F", +"dt c #010D0D", +"du c #002323", +"dv c #074E4E", +"dw c #0C4949", +"dx c #295555", +"dy c #5E7272", +"dz c #011A1A", +"e` c #000202", +"ea c #55A1A1", +"eb c #000F0F", +"ec c #176464", +"ed c #042020", +"ee c #0F0000", +"ef c #001C1C", +"eg c #8A5B5B", +"eh c #419A9A", +"ei c #000808", +"ej c #205C5C", +"ek c #420707", +"el c #064949", +"em c #041919", +"en c #0C5C5C", +"eo c #001515", +"ep c #071212", +"eq c #1D4F4F", +"er c #171B1B", +"es c #154747", +"et c #2D8686", +"eu c #031B1B", +"ev c #000101", +"ew c #3C1B1B", +"ex c #286A6A", +"ey c #044040", +"ez c #000E0E", +"f` c #264747", +"fa c #0F4E4E", +"fb c #0D1E1E", +"fc c #396A6A", +"fd c #001B1B", +"fe c gray14", +"ff c #0C4141", +"fg c #031414", +"fh c #011212", +"fi c #172121", +"fj c #002828", +"fk c #060D0D", +"fl c #063B3B", +"fm c #2B5C5C", +"fn c #645C5C", +"fo c #000707", +"fp c #343A3A", +"fq c #396363", +"fr c #182525", +"fs c #364949", +"ft c #001414", +"fu c #467373", +"fv c #AA7979", +"fw c #506969", +"fx c #022323", +"fy c #002121", +"fz c #1C7171", +"g` c #213E3E", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````ebac`eefahahdi`jahdpe`aleb``````````````````````````````````````````````", +"``````````````````````````````````````````fodmftev`eacebeobw`x`sfodmfj`qan`jdudi````````````````````````````````````````", +"````````````````````````````````````du`p``cqdzdufydiebezeobq`ibvevdpbkek`ncr`dchdiefbw``````````````````````````````````", +"`````````````````````````````````xe`ebalft`qcmapcpeydnfjbfdsdsbtcofxfjcmcmdrek`ndocr`b`eci``````````````````````````````", +"``````````````````````````````bqebcbalftdicmff`n`davdvapeyajdqbtedajbh`wcr`hcmcmcmaydo`d`bdi````````````````````````````", +"````````````````````````````e``e`palaediapaicmfleldv`m`melcfa`btanenaydvdvel`jbwfx`q`bdn`ncrbheo````````````````````````", +"````````````````````````bd`e`easftae`jelapananflel`men`mfffbbidaencxdrcdepfkcnbtbedsfyfd`x`bfjbwei``````````````````````", +"``````````````````````bneofj`bac`pfg`japcfdqa`da`men`tffffaf`rfsecffcvfbdadwffcfczfgcnbteveo`xeb`ecq````````````````````", +"````````````````````cbdidn`q`qdudtfgcza`a`dadadrdwfa`aerfrcpecax`ybzercsavfaen`manczemfkbtbqftbqale`cq``````````````````", +"``````````````````ebbh`nchdnapeycofkbibicd`raififraiaiaiesejfcfzeqfrcseq`t`yatcxenavajeddsfg`bdidpebcyeo````````````````", +"````````````````cyan`nfrekeebhewcfa`dadacg`aficpeqdgcaeqejcadhdhdxfeg`ecatatcaewecdkcx`mcffgbtdp`jdmfybbcr``````````````", +"``````````````ciee`b`bfrapcwcfek`mfp`f`taifrbzejdxcaexdxdxccbmdhc`djc`exejatbj`fbo`tecek`medemfhcwdnbqchchdd````````````", +"``````````````eecycydncmcodsanekeqch`fatececcaexexccbsbsbsetdketbofpfmfmexcaccew`fececchendra`dscfcmdibdchef````````````", +"`````````````dbqe`dm`bcofgepflchcxdkfzaxagdhexcabsbsbmckehbxeg`kfqclaubsetetdhetbxaxew`faxavdqfkcwelapdpbwbwcb``````````", +"``````````bqdpbdfdaldsdsaoa`ffecbofz`ydhewfwdhbjfcbmckadazehckfuaaazfcckfnbx`kbmetazfzatatffdecncwapap`qaleecifo````````", +"``````````cdcbbqbwfhcncnczff`m`ycafzfzetfwbxetbmfuckehdlbuadbrctfwagbmehcubgbr`kfudhca`y`y`adeepczflewcmdiebchbw````````", +"````````ftduevbf`iedfgczav`fc`bobjfzccdhetbxeh`kehehbpegbucuctctdffwaddldlehbgehetexf`g`csfrcgfbdqflbheeeyddbk`d`e``````", +"````````cy`xale`fy`jajcxcvekew`laxccdhbs`kegazadadbufvbuamcu`zdycucub`dlfvbxbgehbsbof`fe`hercgbbdaeyel`wcmdi``crbw``````", +"````````cvdieobkdn`wbhesenecatdkaxbxetetehadbgbubudl`vam`cbl`zblam`v`vbydlbgbl`kbjfpdjdc`hfrerbbffeldc`n`l`b`sbacg``````", +"``````eodo`qahch`delbzce`t`tdgccewdcbxfpazbxegam`vdlb`byambpblabby`oaq`v`vawbuckclbjfmcecjcper`affdvekfebheydudpfycr````", +"``````cd`d`adnekekbzdjcv`f`ydgfzbsfudy`zbgdldlbcdbdl`oaqambpblabbpby`v`v`vdldlckazfqfqfmf`g`frfrdw`mewel`wcrdievdp`n````", +"``````bwee`dcmee`dbhekcxdk`ydgejfmexbs`keheab``v`vdlfv`oaqaqbybpawbpbpbybub``vadaa`gfcfmdxf`cp`aavdvdvel`hayahe`ezdu````", +"````bqfday`ddnfebhek`mfaescsg`g`cjclbjfuckadbu`v`vdbfvfvararar`obyawaw`camameacuak`gfsbof`g`fierdrfadrelap`qfjalcbddeb``", +"`````eae`ddnayapekeldabbfberfrcjcefsauaackeaeab`byaq`odbfvfvdbaraqbpabawblcudyakdfaaaufpdjfecper`adadrcfajbadn`eacefem``", +"````fofy`bbaaycpelancdbiaffr`hg`djfpbod`bmeabuamambybyaqararfvdb`obybpaw`z`zfndfakfcfqcldj`ubzfrcgcddrcfdq`bcmdu```xcv``", +"````bnbfbwefdncrdranbiafaifrficjdjfsboazfuadeaam`c`cbpbpbyaqarawarbybpbpab`zdyfwfwfubjboce`h`ufrafdefbedfxdq`bfyev`xdz``", +"````ebfoaccbbwapapdqbidreserfifef`bjauazfucuadam`cblblbpbpbyarfvfv`oaqambl`z`zfwfufuaufpcj`ucjcperafbifkco`bdueocbdpdp``", +"````cibnbde`dteyela`dedwesfierg`dxaucl`gfubrcucublabblblbpbpaqarfv`o`oby`c`zfwfwaaazfpfpceg`bzaiafbbcdcnfx`bfd`se`dmbf``", +"````ftfofdfy`papapdqep`rdaaifi`hcececl`gaaakctdybr`zabawabbpbyarfvfv`obybl`zakagd`aabofpcj`u`ucpafcdepbtdscwcidp``cqfy``", +"````bfasfyefev`japembibbbbfificjdcfpfsaud`agagdffn`zababblbpby`ofvbcbyambr`zakdfaafcaufscj`uerfrafdeepepemdnbabw`s`ebf``", +"````bfcyefftcbey`jdsdecdafercpg`f`ceclcl`gaaakctfn`zdy`zbl`cbyaqeg`obuamcubrbrfubmbsbjdxcjg`fierfbcdepepan`qdn`bfjfyfo``", +"````bw`sac`eahayfhfkepdedecgaig`c`dxfsfpauaaakfwfwdydydy`z`zblam`veg`vbyeaadckckehetexf`cj`hercgcdbicncodqcmdnereecrfo``", +"````cibfe`ei`b`qbeemepbidecgcseqeqexdxfpaud``gdfctbrctcudy`zdybr`cb`fndleg`cblabbg`ketfmg`cpercgdeepcndsed`q`b`dbkdu`s``", +"````fo`n`edzdn`bbvaoeubifbcdaidgdgcadxdjboboclaaakfwfwctctdfdffwbradawegawbgdkbxdkbxaxfzeqfrcgdebbczaobtedciduee`x`x`n``", +"````dmee`p`x`dbadtdsedemep`raicsesdgc`dcfsbofsd``gd`agagagdfagdffwctbmckehegegbxbxewdhatcsficgfb`rczcobebtacfyeefycieb``", +"``````eealfj`n`beodtcoedbi`affescscsg`fecefsfpfp`g`gd`d`d`agagagaaaaaafqbmbmetetaxax`gejcserbbdrfla`cobtdmbqbkdq`sbq````", +"``````asas`ser`qbfbvdsemfkfbdrfaesbzcp`h`udjdjclbjbjfqfqaa`gazazazclclaubjfcexcacafzaxdg`rcddrdweleydq`i`ifo`bahacdz````", +"``````acez`eahee`jacbtfgcocfffdwesesbzfrfefedccedxbofqfcfcfcauclclfpfpclfsfmdxc`eqfzecbzcv`rdvdcfecpfxftdmcy`bahbfac````", +"````````bdcifd`bchdufgaocfeleldwdwesaifrcpfe`hf`cafmexbsfcbsfqfscefsf`djcef`dxeqdgercscdcddrewbhfedrcwfte`ezdi`ddo``````", +"````````evacfyafan`j`xdqcfdrdv`mavdrdaaicscpbzdgcaccccexcaexexf`cjc`cedccjf`dgecdk`t`acvbbffayekapbabwfoe`e`fyfyfo``````", +"`````````pei`xdi`j`j`b`jcfajelapda`rdadacs`tatataxewazexc`c`c`cjfecj`u`hes`y`ydxcgfacdbicfdvbhewajcwftdmei``ft`edt``````", +"````````````ezdd`b`bbb`layeyeyapcfa`drfffa`f`fecbodx`fcaeqg`g`g`frfifrbz`y`ydkcxcedwcdcdfl`w`najfjaecbdmeifoevcq````````", +"````````````e`eodzchee`ncfeeekapana`a`ffavch`tesc`ax`lecesaibzaicpfifiesc``fceeq`mdabia`flfedadqaeezeicbefdzezei````````", +"````````````al``e`ef`bba`d`n`dcmdqdqanajelcvdwavencx`f`fescsaibzaibb`ravfpcxcjcxelanfkczcwfl`jcidmbdcy`xcv`dbi``````````", +"``````````````ev``eveobf`jcrbhfrajananapayela`bbdrfafacxfp`t`tfaavdrff`tewaycvcxflfkaocodq`jduftezbdftcgftee````````````", +"``````````````evcqbnalcyeo`b`qayaybhfebhapaja`deczffffg`g`dvchdvdvdwdwcvbzcncnekancncofjfxdufycieibf`xeedpal````````````", +"````````````````bnevevbdcqbq`xbafr`j`jflancoemfkbtdqczana`flelekcxchekflcfelcneydqbeedbk`xdzez`p``asbwefcq``````````````", +"``````````````````e`bn````cq`e`eftdzdpddfgbtbecncnbefgaoepedcfajflflcwcoedajflcfdpcyfydzacdmbneidmbweffo````````````````", +"````````````````````cbfoacezbnale`e`acfobde``p`pbebebtbecnfgemdseuaocodqdqdqahdp`pcidpcbevcq``fobdasdo``````````````````", +"```````````````````````ebqaecifdaccq`pcqaleodubwdddpfgbvdzcwbkfgbt`pfgco`xfdcicbdmddci````al`pdmevcb````````````````````", +"`````````````````````````e`n`naecieb`e`ecbebbfaedzbwbqdm`sbw`bbkcy`idmcibfeoebeicift`pezeodz`sfgev``````````````````````", +"``````````````````````````btbqepbwbfdpdpcbcqfodmac`sfobdaseo`xahae`sfo`pacfoevbdbne``eaecv`wee``````````````````````````", +"````````````````````````````````bneocr`nddbqcycyfocbevbnebdzbwduahbwbf`ee`cqe`dm`sbwcrdpciez````````````````````````````", +"````````````````````````````````evcqfobqefcvdzcieb```p``alfoeoftdddpdm``dmeicybfeecyezdsfo``````````````````````````````", +"````````````````````````````````````aleve`alacdzeecveo`sbdcbbqbqal``bneveibqciaebqdo`p``````````````````````````````````", +"``````````````````````````````````````````cqevcbasbiepcvdpebdmcbal`eei`pcqevcbal````````````````````````````````````````", +"````````````````````````````````````````````````eb`pbneidmbdcyeeeecycncrcr``````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood11.xpm b/hacks/images/bubbles/blood11.xpm new file mode 100644 index 00000000..b6daa933 --- /dev/null +++ b/hacks/images/bubbles/blood11.xpm @@ -0,0 +1,269 @@ +/* XPM */ +static char *blood11[] = { +/* width height ncolors chars_per_pixel */ +"72 72 190 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #010404", +"`j c #013232", +"`k c #3C9090", +"`l c #251A1A", +"`m c #095454", +"`n c #190101", +"`o c #70D0D0", +"`p c #000606", +"`q c #003434", +"`r c #0E2E2E", +"`s c #001313", +"`t c #115555", +"`u c #213030", +"`v c #60C0C0", +"`w c #0F0404", +"`x c #002020", +"`y c #165D5D", +"`z c #636A6A", +"a` c #072A2A", +"aa c #445C5C", +"ab c #6C7676", +"ac c #000C0C", +"ad c #549393", +"ae c #001919", +"af c #102222", +"ag c #4D5454", +"ah c #002626", +"ai c #163535", +"aj c #043737", +"ak c #4F6363", +"al c #000505", +"am c #65A0A0", +"an c #052E2E", +"ao c #041616", +"ap c #044444", +"aq c #76C1C1", +"ar c #7ED6D6", +"as c #001212", +"at c #196969", +"au c #385656", +"av c #0C4545", +"aw c #767F7F", +"ax c #642525", +"ay c #360505", +"az c gray28", +"b` c #5FB4B4", +"ba c #002C2C", +"bb c #0E2626", +"bc c #8C9B9B", +"bd c #000B0B", +"be c #030404", +"bf c #001818", +"bg c #944040", +"bh c #280404", +"bi c #0A0E0E", +"bj c #385C5C", +"bk c #002525", +"bl c #6D8686", +"bm c #407E7E", +"bn c #000404", +"bo c #354F4F", +"bp c #739999", +"bq c #001111", +"br c #5A7D7D", +"bs c #347272", +"bt c #030A0A", +"bu c #5AABAB", +"bv c #010808", +"bw c #001E1E", +"bx c #6E3B3B", +"by c #71B1B1", +"bz c #183C3C", +"c` c #274E4E", +"ca c #266464", +"cb c #000A0A", +"cc c #287373", +"cd c #0D1A1A", +"ce c #2B3E3E", +"cf c #053333", +"cg c #121515", +"ch c #270C0C", +"ci c #001717", +"cj c #253838", +"ck c #418888", +"cl c #374343", +"cm c #013C3C", +"cn c #040707", +"co c #031D1D", +"cp c #192C2C", +"cq c #000303", +"cr c #070000", +"cs c #164040", +"ct c #537272", +"cu c #5B8787", +"cv c #120E0E", +"cw c #032A2A", +"cx c #520B0B", +"cy c #001010", +"cz c #062323", +"d` c #435555", +"da c #0C3636", +"db c #8EAFAF", +"dc c #282A2A", +"dd c #001D1D", +"de c #0C1515", +"df c #515C5C", +"dg c #1B5555", +"dh c #297D7D", +"di c #002A2A", +"dj c #2B3030", +"dk c #4F3939", +"dl c #AF5C5C", +"dm c #000909", +"dn c #003737", +"do c #010000", +"dp c #001616", +"dq c #042727", +"dr c #0C3C3C", +"ds c #030F0F", +"dt c #010D0D", +"du c #002323", +"dv c #074E4E", +"dw c #0C4949", +"dx c #295555", +"dy c #5E7272", +"dz c #011A1A", +"e` c #000202", +"ea c #55A1A1", +"eb c #000F0F", +"ec c #176464", +"ed c #042020", +"ee c #0F0000", +"ef c #001C1C", +"eg c #8A5B5B", +"eh c #419A9A", +"ei c #000808", +"ej c #205C5C", +"ek c #420707", +"el c #064949", +"em c #041919", +"en c #0C5C5C", +"eo c #001515", +"ep c #071212", +"eq c #1D4F4F", +"er c #171B1B", +"es c #154747", +"et c #2D8686", +"eu c #031B1B", +"ev c #000101", +"ew c #3C1B1B", +"ex c #286A6A", +"ey c #044040", +"ez c #000E0E", +"f` c #264747", +"fa c #0F4E4E", +"fb c #0D1E1E", +"fc c #396A6A", +"fd c #001B1B", +"fe c gray14", +"ff c #0C4141", +"fg c #031414", +"fh c #011212", +"fi c #172121", +"fj c #002828", +"fk c #060D0D", +"fl c #063B3B", +"fm c #2B5C5C", +"fn c #645C5C", +"fo c #000707", +"fp c #343A3A", +"fq c #396363", +"fr c #182525", +"fs c #364949", +"ft c #001414", +"fu c #467373", +"fv c #AA7979", +"fw c #506969", +"fx c #022323", +"fy c #002121", +"fz c #1C7171", +"g` c #213E3E", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````ftcb`p`eacftasasace`cq````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````cqcqe`foeb`s`x`b`b`bahdpebcqezezasfdcv````````````````````````````````````````````````````", +"````````````````````````````````````````````````cqevbdal`pdpfycifdbfcyezas`sezevdp`qdodo`nafdibkah``````````````````````````````````````````````", +"````````````````````````````````````````````ei``ei`pbwdi`xfjbadz`sfhacacbddtbdbddufjapcrayee`day`jfydd``````````````````````````````````````````", +"````````````````````````````````````````cyeoeibnft`jdncmaiffeydnbacofgdsdsdsfgfyahdicmcmeyfeay`ndo`d`laedz``````````````````````````````````````", +"````````````````````````````````````ddbdebalcqbfdidnelaycrbhdcelapeyajanfxcnaoaneyayay`d`delapey`h`ddocr`qbkah``````````````````````````````````", +"``````````````````````````````````cqeoebcqe`aedidn`u`ueyapcj`mdv`mdveyfldqbtedajesekdcewdvap`jbkfjdn`qdndodnbh`n````````````````````````````````", +"``````````````````````````````foalcbbde`ebci`bey`hapancfcfey`mewen`mdafbdebidrenekdvcfczdqanembtbtfxduahdicmcm`qfydp````````````````````````````", +"````````````````````````````cbeidzdzfoasdpdq`qdveldqczajeydven`mdwavdrfbcdffceewdwbbbideczcoeufgbtbedzdzcbebbkfjbwbfei``````````````````````````", +"````````````````````````````cyah`bahcybdbtdqajeycfa`an`ravenen`tffda`rcgdrfsatfa`acdbbdadwdvffajdqemdscnbtcq`sftaee`dme`````````````````````````", +"````````````````````````cbdu`rdndndndufhbtcodqana`cfdrdaavfafaaificgfraiecewecfa`aafcsesdwenen`manededcndtdtbqci`sfo`pe`cq``````````````````````", +"``````````````````````ez`b`n`ddndncmajcocnfkembicd`rda`raffifrcpcpcpesdgfzfz`ycserbzeq`t`tendk`f`mdra`cocndsaoah`bbwcqcyebas````````````````````", +"````````````````````cy`baychayapekekdvajczfbbbbbcvafaieraieqeqeqeqdgcacafcdhejg``hf`ejececat`fch`fchfp`mapaocnfgeddifdfofyfyed``````````````````", +"``````````````````eo`bbh`jchayayapey`welffenenaverfieraieqeqejexdxc`fmexetfwfmg``uc`exatatfzax`lateneccvenflcofgdseu`qfdezer`nfy````````````````", +"```````````````````ndifd`jcpcmahedancxenf`chc``tesbzg`dgcacaccccfmdxfmdhbgetfmcjdjdxexcacafzbx`fdk`t`tekew`manaocnbw`qcmfdduaydi````````````````", +"````````````````cgciebdpdncmfxdsemflcvcechchdkfzfzatexexcaccccbsbsbsbm`kdk`kfcfpclfmcaexcaexdhewewfzat`f`fendrcfbefxcmey`jbn`bfdci``````````````", +"``````````````fyefeidmas`bedfgaoemavchch`ffzfzewagdhcccaexbsbsbmbm`kehdkeg`kbsbofsbjbsetetdhdhfqbxax`f`l`ffpava`aoedaj`hapbwe`anacfo````````````", +"``````````````dieifofdacfhbtdscoandwfpdkcaececagfebxdhfcfqbsbmckehbgbxehckfufc`g`gfcbm`kegbxetetdhaafqfzatejavcdepeucfelap`jbq`xdieb````````````", +"````````````efezfofyaedtbtcnfka`fffa`tatfmecfzdfdfbxetbmfcfcckeh`cazeaadckfufwaaaabmehbxbgbg`ketbmdhfzecec`y`rdebiemcfap`hcm`be``qdias``````````", +"````````````czcbeibw`ibfbtfkcfelenecfsdkfzfzccetckdk`kbmckck`keadldleacuctbrctagfwadbuegehbxckbretdhcaeqdgdg`adebifba`flbhekfefybq`n`d``````````", +"```````````efy`pasaceffxcoa`elcxchecboaxfzccccdhetbgbxehehadeadlfvb`adbrdy`zdfctbrbuegbgblbxab`ketexc`cj`ucpficdfba`aneydc`new`jaebk`nbf````````", +"``````````effy`edmefdqajeyaycncxayewew`fccdhdhdh`kbrbgeaadadb`dlbuam`ccu`zdycucuea`vdldlbxbgcu`kbsbocedj`ucpficgfb`rfleldv`dap`bah`peecd````````", +"````````eieedifdcydnapaybh`mf`enecatdkaxbxdhet`kehehazaweab`dlbyamam`cab`zblamb``v`vbydldldleackbjfpfpdc`h`hfrerfbdadrdvdcbeekcmdieibafb`n``````", +"````````aeee`jah`b`dek`ucsg`en`t`t`yd`fedcaxbxbxbxazbgdlb`bpdl`vambyam`cblabam`vdbaq`vbybpbpeafuclaubjcecj`ucpfi`adaav`mekekekaydndzdzbwfx``````", +"````````cgcr`q`q`lcrfedvg`cv`fec`tdgfzbxaxaxbgegbgbgagdl`vbcdl`vbybybpbpblabbpby`v`o`vb`fvdlbubmazbjfcfmf`g`cjfrfrdafa`mewelbhcrdaddcqcied``````", +"```````nbk`dcrcm`leebhewcxekay`yeqeqatccccdh`kcuawbub`by`vbcegfv`oaqbybybpawabbpbyby`vb``vdlbpckd`d`fcfqdxdxf`cpfi`rav`m`melek`day`xevfoducv````", +"``````ci`xayeednay`d`nbhcxg`en`tdgdgeqc`dxfqbsckadadea`v`v`ofvabdbar`o`obybybpawbl`camamamb`bucuaaazbjfqdxdxf``ufiaifa`meldv`hapeybwcqdmfyco````", +"``````aebwayay`q`dcp`ncj`mfaffbzaig`cjcjcebobjfuckadeab`b``v`ofvfvarararararaqbpawawbl`camamadctakd`clbofsf`cjfier`affavflapapaj`jdudmebeffd````", +"```````sahaydncmdaewfeapdabbafcger`hcjcjceauauaackeaeabub`byaq`oarbcfvfvdbar`obyblabawblblbrctakdfaabjclfpdjfecpfifibbdadrajajan`j`q`eacbffd````", +"````bd`efja``bdafeewelanfbdecvfrfi`ug`cjdjfs`gaabmeabuamamambybyaq`oarfvawdbaraqbpblab`z`zfndfdfakfwfqaudjdc`ucjfrercgbbffajedcw`jdn`xcqefbwez``", +"````foacciahdu`j`n`hapanepde`a`aerfecjdjfpfpcl`gfuadbubuam`cbpbpbpaqaqararfvaraqbpbpbpab`z`zakakakfufqbjcldj`u`uaificdde`randqcw`b`qbk`pftefeo``", +"````acbdebas`sahdnekapczbi`adaaierfe`hcjboaud`azfucuadamam`c`cbpbpbpbybyarfvdbarbybybpbl`zdydyctfufubjaucedj`h`uaifrcgcdbiaoeddq`bdudzcqacbfft``", +"````aeeve`fo`pfd`b`dapczdedrfaaifi`h`hc`fmau`g`gfucuad`c`cblblblbpbpbpbyardbawaraqaqby`cdy`zakfwfwfcbjclfpcjcjcjbzfrfb`abifkemcw`jfddpcqe``sci``", +"````eebnbdez`pdmcwbhapdqdeavdwbzerfig`dxdxfscld`fubrcucucuababawblblbpbyaqardbfv`o`oby`c`z`zfwfwagazclfpcececjcjbz`afbbbfbcnaoan`beoase`ev`seo``", +"`````ncbbqeffyevahayeyczep`rdaaicpfi`hcecefpbo`gaaakfwdydybr`zabababawbpby`odbfvaq`obybldyakakagd`aaaucldjcj`u`ucp`afbfbepfkcnedbaftdpcqe`ac`s``", +"````crbddpfybwfofxaycfeubibb`rbbfifr`udcdjclaud`aadfagak`z`z`zababblblbpby`ofvfv`obyambrdydfagagaafcaubocedj`herfiafdebibifkdsdq`qdibw`sbqe`dp``", +"````eeeidpfd`scqfybhcwepepfbafafercpg`g`cefpfsclazagakfwfwfn`zababab`camby`ofvfv`vbuamcubrctctfufubsfqfmf`cjg`cperaffbdedefkedcf`qdndifydudmbf``", +"````eeeiezftftebdndnfkbtaocddeaferaig`c`f`cefsfp`gaaakctfwdfdydy`z`zabbl`cby`veg`vb`b`eaadcubmbmckbmfcdxcecj`uficgcgfbbifkemfxdn`qcm`q`bdobfbd``", +"````fkftftfo`pfyeeahbefgepepbicgercsesf`fmfmfsfpauaad`dfakctdydybrdy`z`zbl`cbu`vfnfvdlb`eaad`k`kck`kdhcaf`cjfrerercvdebifkfgco`jcm`qayaydi`xfo``", +"````acfdeoeidmahfifxbtemepcncdcvafesdgeqcacac`fpboau`gd`akctbrctbrbrdyfn`zbrcuea`vfndlfnbgadbgbgbxfnetccc`g`cpercgcvdedecncnfg`b`bdi`nahducrdm``", +"``````cveocydzbacmcobtemeucncdfbafcsdgdgcaejc`djbobocl`gaafwfwfwctctfwdfdfakbrcueadlegegabbxbxbxdkbxaxaxejesfrcgcgfbbbczaofgaodzbwaheefybwdz````", +"``````fdbwcbbwficmdpe`aoedembi`a`aaicsesdgeqf`djfsbofs`gaad`aaagdfdfdfdfagdffwctbmckehehabbgegbgbgdcdhfcejcsficgdebbanczcodsdsebebah`nfyfyeo````", +"``````ez`xevahdo`qbwdtcncoczepfbdaffcsbzesf`g`dccefsfsclfpazazaz`gagagagagagakakakakfuck`k`kckfuaxaxagfzejbzercd`rdacfczcodtbvbv`sahafcidzbf````", +"``````cb`n`pfyaydnbkebbtaoedepep`rfffaescsai`ufecjcefpfpfsbjbjfqaaaad`d``g`g`g`g`g`gaufqbsbsbsccdhdhewateqcpcg`adreleycfedbtbvbvdp`bbacy`s`w````", +"````````ddbdcb`b`d`bft`ibtembtem`rdadwesesbzcp`h`hdcdcfpbobjbjfqfcfcbjd`azclfsclfpclbobofmcafmfmejateweccsafbbffdvelelflfxbtalaleobhdudm`n``````", +"````````ei`p`ebw`lerdidtbvdsdsandaffdwdwesesaififefefedjc`dxbobjfcbsfcfcaufsclfpfpfpfpcldxfmdxc`eqatdkes`rcdda`mcxbzelaibkbfdte`bfcvfjdpae``````", +"````````cb`eciefah`ndnfdfgaocwapeldvdwdwdwaiaifrcpfefecjdxcafmexbsbsfcbsfqbodjfsfscedjcecedxeqeqdg`f`t`rcgfbdrg``newaieycwcievalascg`d`ne```````", +"``````````e``ebw`bdoaydiddfxcwap`udvdvdwdrdaaiaibzcp`ug`ejcaccccccexexexexc`djc`c`cjdccjg`eqdgecfsecbzcdcdbbdrekbhekfl`bddezdmevcqdu`dfd````````", +"``````````al`pfybk`n`b`qdi`b`jflapeleldada`rdaaicseseq`yatexaxagcccafmdxfmf`dccjf``u`hg`dgej`yecew`y`acdcd`rav`nekapanahaealalevfofdase`````````", +"````````````aldpbwdi`bba`q`qdncmajapeyajcfa`dadres`ydkew`lewewaxfzejg`g`g`g``hfe`uer`ues`y`ycl`l`f`t`abicdeybhdcayey`bahebfodmfoeveial``````````", +"````````````fobdeffy`d`j`lee`n`nayapapcfananffavfa`fcx`tecdxecew`f`yesbzcsbzcpfrercpbz`y`yf`ewf`eqdwbbepa`ey`n`wajfjfycydmbdeiac`e`pfo``````````", +"``````````````evcbftbwcz`d`ddnbhbhayapana`ana`ffavew`tdwfaf`dk`lfsdgbzaibzaicpfierfres`y`fchenf``mdrcdcocfflaicp`bfdbqbddmcbbfbkdzac````````````", +"``````````````cqbneial`x`bdifiaydobhcmcwczananajelch`mavfa`tcx`fcg`tcsbzaibzai`rbbaiav`tcvfpdcewelcfepemdqcwfl`qfyac`p`ecybw`n`naeee````````````", +"```````````````````pe`alaebwdieedobhcmajcwcwcfapewewdaa`daavfafadjek`tfafafaavdrdrff`mdjchchcxeweyemdsemeddq`jfyfdcyac`e`sfjbwbwee``````````````", +"````````````````````ale`fo`sft`j`q`deeficmey`lcnekeyajedfbdadwav`mchdjchekfafaavavdwewcvcvek`wekcfdsemeddqfxdifyfdciacciddcoaeas````````````````", +"``````````````````e`evevfoezdmbqfyah`q`day`rbhayeyancwepfkedcfdaffeldrffewchdvdvg`djdceyelcnbhaicwbeaocwfxfy`xbfacfoalaebweebf``````````````````", +"````````````````````bne```foe`bnebbwdu`jbaah`b`bfxemdsbedscnemeuedczdqajapfeay`wbzapana`flewfeeyfx`idpah`xciezcbevcqfoas`naobn``````````````````", +"``````````````````````cqfo``e`ev`paceiacdpbfcydzfhbtbebebebebedsfgdsfkemdqananajanczededcfcmcmcwfhezfydzcifofoe``pev`sbwepei````````````````````", +"````````````````````````cbeicbacaccqalbnevdmacfobde``pbv`pbebebtcnbebtaoembtememaocodqdqahcwfyfh`peodzezalevcqe`eialcbeodo``````````````````````", +"``````````````````````````accyeoftbfdzac``eibdbn`pfhddbwdddzfgdsbvdsbwbadqfgbv`idtdzedfxbwdzeodmcbfdfdacale`e```aleibnac````````````````````````", +"`````````````````````````````eci`n`xciftbdei`pdmbdbddzbkfdef`x`sbdebciducwdudpac`pbddpfddzbfbdalebdzcycqdmcyaeasftacbn``````````````````````````", +"``````````````````````````````btcrcrddefaecibqbqe`eiasfteb`sdpeb`idmeoefahfyeodt`i`iebci`eace``sac`pe`bddpbffddo`w``````````````````````````````", +"``````````````````````````````````cbeb`nbwddddbfezdm`pacfodmbdbnevcb`sdpdzahduefascbfoe`bnbnale`bn`pasdz`nef`nas````````````````````````````````", +"````````````````````````````````````alevcbaeeedobwdpcyftcydmeie```ei`sdd`xbkahfjfdeodme`bn`pcbezdpefdoaeezdocb``````````````````````````````````", +"````````````````````````````````````````cq``bdbqefcrdzci`s`e``focqcqbncbeoftfdefcyei``eidmbdftefeeasasbqcb``````````````````````````````````````", +"````````````````````````````````````````````e```al`pbdddee`xddasebacbdbdasebfoe`evbnev`pebbfemciebcyez``````````````````````````````````````````", +"````````````````````````````````````````````````evevevalbqdzeeeebwdpezezcbcydmaldmeibncqevdmasfkbn``````````````````````````````````````````````", +"``````````````````````````````````````````````````````accqbdebcyeoeedpbqbqasezdmbdbdezacale`````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````cncbev``evbndmaccrdocb````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood2.xpm b/hacks/images/bubbles/blood2.xpm new file mode 100644 index 00000000..e2529854 --- /dev/null +++ b/hacks/images/bubbles/blood2.xpm @@ -0,0 +1,100 @@ +/* XPM */ +static char *blood2[] = { +/* width height ncolors chars_per_pixel */ +"12 12 81 2", +/* colors */ +"`` c None", +"`a c #002E2E", +"`b c #250000", +"`c c #000D0D", +"`d c #212A2A", +"`e c #000606", +"`f c #213030", +"`g c #636A6A", +"`h c #072A2A", +"`i c #445C5C", +"`j c #4D5454", +"`k c #163535", +"`l c #000505", +"`m c #052E2E", +"`n c #041616", +"`o c #044444", +"`p c #76C1C1", +"`q c #0C4545", +"`r c #767F7F", +"`s c #002C2C", +"`t c #000B0B", +"`u c #030404", +"`v c #280404", +"`w c #385C5C", +"`x c #354F4F", +"`y c #001111", +"`z c #347272", +"a` c #6E3B3B", +"aa c #71B1B1", +"ab c #000A0A", +"ac c #270C0C", +"ad c #001717", +"ae c #253838", +"af c #418888", +"ag c #013C3C", +"ah c #192C2C", +"ai c #000303", +"aj c #164040", +"ak c #032A2A", +"al c #520B0B", +"am c #001010", +"an c #435555", +"ao c #0C3636", +"ap c #8EAFAF", +"aq c #282A2A", +"ar c #515C5C", +"as c #1B5555", +"at c #002A2A", +"au c #2B3030", +"av c #4F3939", +"aw c #AF5C5C", +"ax c #003737", +"ay c #010000", +"az c #001616", +"b` c #042727", +"ba c #0C3C3C", +"bb c #030F0F", +"bc c #002323", +"bd c #0C4949", +"be c #011A1A", +"bf c #176464", +"bg c #0F0000", +"bh c #001C1C", +"bi c #8A5B5B", +"bj c #419A9A", +"bk c #064949", +"bl c #041919", +"bm c #001515", +"bn c #071212", +"bo c #031B1B", +"bp c #044040", +"bq c #0F4E4E", +"br c gray14", +"bs c #031414", +"bt c #063B3B", +"bu c #2B5C5C", +"bv c #396363", +"bw c #182525", +"bx c #001414", +"by c #506969", +"bz c #002121", +/* pixels */ +"````````bxbpbbagay``````", +"````abbc`hbqbfaj`m`yai``", +"`````aac`j`zbi`za``q`o``", +"``at`vavbjaw`gaa`wbwaq`s", +"``axaoaeaf`pap`rarbrba`c", +"``bzbn`d`i`gaaaaan`fbnaz", +"``beboas`xbyarbiavbw`nbg", +"``adbsbdahbubvauasbaak`b", +"`````aagbkal`k`qbkbtam``", +"````ab`l`t`ublb``eaiay``", +"````````bh``bm``bg``````", +"````````````````````````" +}; diff --git a/hacks/images/bubbles/blood3.xpm b/hacks/images/bubbles/blood3.xpm new file mode 100644 index 00000000..81fd4d4e --- /dev/null +++ b/hacks/images/bubbles/blood3.xpm @@ -0,0 +1,122 @@ +/* XPM */ +static char *blood3[] = { +/* width height ncolors chars_per_pixel */ +"14 14 101 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #250000", +"`c c #5D1616", +"`d c #415050", +"`e c #010404", +"`f c #3C9090", +"`g c #251A1A", +"`h c #095454", +"`i c #190101", +"`j c #70D0D0", +"`k c #000606", +"`l c #60C0C0", +"`m c #165D5D", +"`n c #636A6A", +"`o c #072A2A", +"`p c #6C7676", +"`q c #000C0C", +"`r c #102222", +"`s c #4D5454", +"`t c #163535", +"`u c #043737", +"`v c #4F6363", +"`w c #044444", +"`x c #76C1C1", +"`y c #001212", +"`z c #0C4545", +"a` c #767F7F", +"aa c #642525", +"ab c #360505", +"ac c #000B0B", +"ad c #385C5C", +"ae c #6D8686", +"af c #000404", +"ag c #001111", +"ah c #030A0A", +"ai c #5AABAB", +"aj c #001E1E", +"ak c #6E3B3B", +"al c #71B1B1", +"am c #274E4E", +"an c #0D1A1A", +"ao c #2B3E3E", +"ap c #053333", +"aq c #121515", +"ar c #270C0C", +"as c #418888", +"at c #374343", +"au c #013C3C", +"av c #040707", +"aw c #031D1D", +"ax c #192C2C", +"ay c #000303", +"az c #070000", +"b` c #164040", +"ba c #537272", +"bb c #120E0E", +"bc c #001010", +"bd c #062323", +"be c #282A2A", +"bf c #0C1515", +"bg c #515C5C", +"bh c #1B5555", +"bi c #002A2A", +"bj c #2B3030", +"bk c #4F3939", +"bl c #000909", +"bm c #003737", +"bn c #010000", +"bo c #001616", +"bp c #042727", +"bq c #030F0F", +"br c #074E4E", +"bs c #0C4949", +"bt c #011A1A", +"bu c #55A1A1", +"bv c #000F0F", +"bw c #042020", +"bx c #419A9A", +"by c #064949", +"bz c #1D4F4F", +"c` c #2D8686", +"ca c #000101", +"cb c #286A6A", +"cc c #044040", +"cd c #001B1B", +"ce c #0C4141", +"cf c #031414", +"cg c #011212", +"ch c #172121", +"ci c #002828", +"cj c #2B5C5C", +"ck c #000707", +"cl c #343A3A", +"cm c #182525", +"cn c #364949", +"co c #AA7979", +"cp c #506969", +"cq c #002121", +"cr c #1C7171", +"cs c #213E3E", +/* pixels */ +"``````````cqcqagbiab````````", +"``````ajawbd`h`ranbdcfbc````", +"`````bbmaochcbc`cjaaarcf`b``", +"`````e`zcr`fbxbaas`fbhbfcc``", +"``bnby`mbjak`lae`jbuam`abebt", +"``ar`wcmataialcoa`bgatchbw`k", +"``bt`u`tclcp`pal`x`vclaxavck", +"``blahbbcb`dba`n`sbkcbaqbqci", +"``afcgbdb`beadcnatcjbzbrck`q", +"`````occ`o`c`gcsaxarbfaubl``", +"````caciazapcebbbsabci`yaw``", +"``````btafcdbobpbvbl``ag````", +"``````````acbv`yay`i````````", +"````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood4.xpm b/hacks/images/bubbles/blood4.xpm new file mode 100644 index 00000000..d4f3ced9 --- /dev/null +++ b/hacks/images/bubbles/blood4.xpm @@ -0,0 +1,171 @@ +/* XPM */ +static char *blood4[] = { +/* width height ncolors chars_per_pixel */ +"20 20 144 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #013232", +"`j c #095454", +"`k c #70D0D0", +"`l c #000606", +"`m c #0E2E2E", +"`n c #001313", +"`o c #115555", +"`p c #213030", +"`q c #60C0C0", +"`r c #002020", +"`s c #445C5C", +"`t c #6C7676", +"`u c #000C0C", +"`v c #549393", +"`w c #102222", +"`x c #4D5454", +"`y c #002626", +"`z c #163535", +"a` c #043737", +"aa c #4F6363", +"ab c #000505", +"ac c #65A0A0", +"ad c #052E2E", +"ae c #044444", +"af c #7ED6D6", +"ag c #001212", +"ah c #196969", +"ai c #385656", +"aj c #0C4545", +"ak c #767F7F", +"al c #642525", +"am c #002C2C", +"an c #0E2626", +"ao c #030404", +"ap c #001818", +"aq c #0A0E0E", +"ar c #385C5C", +"as c #002525", +"at c #6D8686", +"au c #000404", +"av c #354F4F", +"aw c #739999", +"ax c #001111", +"ay c #5A7D7D", +"az c #347272", +"b` c #030A0A", +"ba c #010808", +"bb c #001E1E", +"bc c #6E3B3B", +"bd c #71B1B1", +"be c #183C3C", +"bf c #274E4E", +"bg c #000A0A", +"bh c #287373", +"bi c #0D1A1A", +"bj c #053333", +"bk c #270C0C", +"bl c #001717", +"bm c #253838", +"bn c #418888", +"bo c #374343", +"bp c #013C3C", +"bq c #040707", +"br c #031D1D", +"bs c #192C2C", +"bt c #000303", +"bu c #070000", +"bv c #164040", +"bw c #537272", +"bx c #5B8787", +"by c #120E0E", +"bz c #032A2A", +"c` c #520B0B", +"ca c #0C3636", +"cb c #001D1D", +"cc c #0C1515", +"cd c #297D7D", +"ce c #002A2A", +"cf c #AF5C5C", +"cg c #000909", +"ch c #003737", +"ci c #010000", +"cj c #001616", +"ck c #042727", +"cl c #0C3C3C", +"cm c #030F0F", +"cn c #002323", +"co c #074E4E", +"cp c #0C4949", +"cq c #295555", +"cr c #5E7272", +"cs c #011A1A", +"ct c #000202", +"cu c #55A1A1", +"cv c #000F0F", +"cw c #176464", +"cx c #042020", +"cy c #0F0000", +"cz c #001C1C", +"d` c #8A5B5B", +"da c #419A9A", +"db c #420707", +"dc c #064949", +"dd c #0C5C5C", +"de c #001515", +"df c #071212", +"dg c #1D4F4F", +"dh c #154747", +"di c #2D8686", +"dj c #000101", +"dk c #3C1B1B", +"dl c #286A6A", +"dm c #044040", +"dn c #000E0E", +"do c #264747", +"dp c #396A6A", +"dq c #001B1B", +"dr c gray14", +"ds c #0C4141", +"dt c #031414", +"du c #172121", +"dv c #002828", +"dw c #060D0D", +"dx c #063B3B", +"dy c #2B5C5C", +"dz c #000707", +"e` c #343A3A", +"ea c #182525", +"eb c #364949", +"ec c #001414", +"ed c #AA7979", +"ee c #506969", +"ef c #002121", +"eg c #1C7171", +"eh c #213E3E", +/* pixels */ +"``````````````dzdjcv`rcgadce````````````", +"``````````axabbp`daecka`bubpcice````````", +"````````de`u`ick`jds`mdscabjbqde`e``````", +"``````addbdkca`adgdgcddrahdkc`dt`ian````", +"`````dcgdtbkegcdazbnd`bodididkajbzcjbg``", +"````djcxajavbhbcdad`bweecfdadoeackcyas``", +"``de`ydc`obhbcbc`qbdat`k`qbndybsdsdrcnbu", +"``dqchdbdhehar`v`qedafakacbxebehcldcdvcb", +"``apchad`zbmav`v`cawafbd`teear`h`wcx`b`r", +"``dz`lckca`hboaaayakbdedat`xav`p`wb`blbt", +"```n`ydwcceheb`seecratd`cubndl`hbibrchbu", +"``cy`dcmdfbvbfav`g`x`xbwdabccddu`maoefbl", +"```u`y`ubrcpbedrcqdpaie`ebbfcw`mdrec`b`u", +"`````r`ibjaeca`oaldlbfbmdhcqbicoa`cgec``", +"````abcz`dbpadbydd`f`zane`c`dwdxcg`raq``", +"``````djbtam`ibrb`addcbkbjdmcxcs``cz````", +"````````axdq`ldecbbaas`l`rbgblabdj``````", +"````````````buaxdzaubbbbctcgbudn````````", +"``````````````btagbycg`ebtab````````````", +"````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood5.xpm b/hacks/images/bubbles/blood5.xpm new file mode 100644 index 00000000..76f2471d --- /dev/null +++ b/hacks/images/bubbles/blood5.xpm @@ -0,0 +1,201 @@ +/* XPM */ +static char *blood5[] = { +/* width height ncolors chars_per_pixel */ +"24 24 170 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #013232", +"`j c #3C9090", +"`k c #251A1A", +"`l c #095454", +"`m c #190101", +"`n c #000606", +"`o c #003434", +"`p c #0E2E2E", +"`q c #001313", +"`r c #115555", +"`s c #213030", +"`t c #60C0C0", +"`u c #0F0404", +"`v c #002020", +"`w c #165D5D", +"`x c #636A6A", +"`y c #072A2A", +"`z c #445C5C", +"a` c #6C7676", +"aa c #000C0C", +"ab c #001919", +"ac c #102222", +"ad c #4D5454", +"ae c #002626", +"af c #163535", +"ag c #4F6363", +"ah c #000505", +"ai c #65A0A0", +"aj c #052E2E", +"ak c #041616", +"al c #044444", +"am c #76C1C1", +"an c #7ED6D6", +"ao c #196969", +"ap c #385656", +"aq c #0C4545", +"ar c #767F7F", +"as c #642525", +"at c #360505", +"au c #5FB4B4", +"av c #002C2C", +"aw c #8C9B9B", +"ax c #000B0B", +"ay c #030404", +"az c #001818", +"b` c #280404", +"ba c #0A0E0E", +"bb c #385C5C", +"bc c #002525", +"bd c #407E7E", +"be c #354F4F", +"bf c #739999", +"bg c #001111", +"bh c #5A7D7D", +"bi c #347272", +"bj c #030A0A", +"bk c #5AABAB", +"bl c #010808", +"bm c #001E1E", +"bn c #6E3B3B", +"bo c #71B1B1", +"bp c #274E4E", +"bq c #266464", +"br c #000A0A", +"bs c #2B3E3E", +"bt c #053333", +"bu c #121515", +"bv c #270C0C", +"bw c #001717", +"bx c #253838", +"by c #418888", +"bz c #374343", +"c` c #013C3C", +"ca c #040707", +"cb c #031D1D", +"cc c #192C2C", +"cd c #000303", +"ce c #070000", +"cf c #164040", +"cg c #537272", +"ch c #5B8787", +"ci c #120E0E", +"cj c #032A2A", +"ck c #520B0B", +"cl c #001010", +"cm c #062323", +"cn c #435555", +"co c #0C3636", +"cp c #8EAFAF", +"cq c #282A2A", +"cr c #001D1D", +"cs c #0C1515", +"ct c #515C5C", +"cu c #1B5555", +"cv c #297D7D", +"cw c #002A2A", +"cx c #2B3030", +"cy c #4F3939", +"cz c #AF5C5C", +"d` c #000909", +"da c #003737", +"db c #010000", +"dc c #001616", +"dd c #042727", +"de c #0C3C3C", +"df c #030F0F", +"dg c #010D0D", +"dh c #002323", +"di c #074E4E", +"dj c #0C4949", +"dk c #295555", +"dl c #5E7272", +"dm c #011A1A", +"dn c #000202", +"do c #000F0F", +"dp c #176464", +"dq c #042020", +"dr c #0F0000", +"ds c #001C1C", +"dt c #8A5B5B", +"du c #419A9A", +"dv c #000808", +"dw c #205C5C", +"dx c #420707", +"dy c #064949", +"dz c #041919", +"e` c #0C5C5C", +"ea c #001515", +"eb c #071212", +"ec c #1D4F4F", +"ed c #171B1B", +"ee c #154747", +"ef c #2D8686", +"eg c #031B1B", +"eh c #000101", +"ei c #3C1B1B", +"ej c #286A6A", +"ek c #044040", +"el c #000E0E", +"em c #264747", +"en c #0F4E4E", +"eo c #0D1E1E", +"ep c #001B1B", +"eq c gray14", +"er c #031414", +"es c #172121", +"et c #060D0D", +"eu c #063B3B", +"ev c #2B5C5C", +"ew c #000707", +"ex c #343A3A", +"ey c #396363", +"ez c #182525", +"f` c #364949", +"fa c #001414", +"fb c #467373", +"fc c #AA7979", +"fd c #506969", +"fe c #002121", +"ff c #1C7171", +"fg c #213E3E", +/* pixels */ +"``````````````````cdew`v`bdoelci````````````````", +"``````````````eafac`ekcbdffec`eqdbab````````````", +"``````````ewaxbw`hbt`l`lcse`btajbjaec`dc````````", +"````````brdadhcb`ycoenbudpencfe`ajcabgewcd``````", +"``````ea`iat`ue`edafdwbpeffgejffaocicbegelfe````", +"``````dv`bakbvffadbqbi`jdtbebicvbn`kaqdqalaj````", +"````cmbmbjdyf`ffbybd`jczcgadbkbnefec`aeob`fe`d``", +"````cwdab`e`cycvduarczai`xauboczbbcqezcocqc`av``", +"```mcedrck`waocvarbodtambfbf`tczcneyem`p`l`dehci", +"```qdaeicobubxapbybkamawcpboarbhctbzeqesdeaj`eep", +"``ax`qdxbaaf`hapfbai`cbfananbfdlfbap`hezbadddmaz", +"``brfeatebaf`hex`zdl`xa`bofcboagcnbz`s`aebdqdcaa", +"``dvfadaakacfgbs`gcgdl`x`cdtauchbydk`sbuetda`oaz", +"``cidmcbegeocudwbe`gfdcgctchdtbncyasezeoakdmdrdm", +"``brfebcakebenafbxexbb`z`g`gapbicvaobudydqblav`u", +"````bw`meraldjafccbxevbieyf`cxdkcu`pdeeicjah`d``", +"````ahcw`oc`ek`yeeeieidwfgeq`s`w`fbab`ekdoewah``", +"``````dv`batc`ajdyaqck`raf`paqexdydzeuaacl`m````", +"``````dnewbg`o`pekebbtdyeidicqcacjcj`vewbm``````", +"````````braaahd`axblayaydzdzddcj`nelcdahdb``````", +"``````````bjcrbwdnfadcd`aedgdoaaaaaxep``````````", +"````````````````dsbw``cdeads``axdrbg````````````", +"``````````````````aadodrbgd`eldn````````````````", +"````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood6.xpm b/hacks/images/bubbles/blood6.xpm new file mode 100644 index 00000000..50a6c220 --- /dev/null +++ b/hacks/images/bubbles/blood6.xpm @@ -0,0 +1,220 @@ +/* XPM */ +static char *blood6[] = { +/* width height ncolors chars_per_pixel */ +"30 30 183 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #010404", +"`j c #013232", +"`k c #3C9090", +"`l c #251A1A", +"`m c #095454", +"`n c #190101", +"`o c #70D0D0", +"`p c #000606", +"`q c #003434", +"`r c #0E2E2E", +"`s c #001313", +"`t c #115555", +"`u c #213030", +"`v c #60C0C0", +"`w c #0F0404", +"`x c #002020", +"`y c #165D5D", +"`z c #636A6A", +"a` c #072A2A", +"aa c #445C5C", +"ab c #6C7676", +"ac c #000C0C", +"ad c #549393", +"ae c #001919", +"af c #102222", +"ag c #4D5454", +"ah c #002626", +"ai c #163535", +"aj c #043737", +"ak c #4F6363", +"al c #000505", +"am c #65A0A0", +"an c #052E2E", +"ao c #041616", +"ap c #044444", +"aq c #76C1C1", +"ar c #7ED6D6", +"as c #001212", +"at c #196969", +"au c #385656", +"av c #0C4545", +"aw c #767F7F", +"ax c #642525", +"ay c #360505", +"az c gray28", +"b` c #000B0B", +"ba c #030404", +"bb c #001818", +"bc c #944040", +"bd c #280404", +"be c #0A0E0E", +"bf c #385C5C", +"bg c #002525", +"bh c #6D8686", +"bi c #407E7E", +"bj c #000404", +"bk c #354F4F", +"bl c #739999", +"bm c #001111", +"bn c #5A7D7D", +"bo c #347272", +"bp c #030A0A", +"bq c #5AABAB", +"br c #001E1E", +"bs c #6E3B3B", +"bt c #71B1B1", +"bu c #183C3C", +"bv c #274E4E", +"bw c #266464", +"bx c #000A0A", +"by c #287373", +"bz c #0D1A1A", +"c` c #2B3E3E", +"ca c #053333", +"cb c #121515", +"cc c #270C0C", +"cd c #001717", +"ce c #253838", +"cf c #418888", +"cg c #374343", +"ch c #013C3C", +"ci c #040707", +"cj c #031D1D", +"ck c #192C2C", +"cl c #000303", +"cm c #070000", +"cn c #164040", +"co c #537272", +"cp c #5B8787", +"cq c #120E0E", +"cr c #032A2A", +"cs c #520B0B", +"ct c #001010", +"cu c #062323", +"cv c #435555", +"cw c #0C3636", +"cx c #8EAFAF", +"cy c #282A2A", +"cz c #001D1D", +"d` c #0C1515", +"da c #515C5C", +"db c #1B5555", +"dc c #297D7D", +"dd c #002A2A", +"de c #2B3030", +"df c #4F3939", +"dg c #AF5C5C", +"dh c #000909", +"di c #003737", +"dj c #010000", +"dk c #001616", +"dl c #042727", +"dm c #0C3C3C", +"dn c #030F0F", +"do c #010D0D", +"dp c #002323", +"dq c #074E4E", +"dr c #0C4949", +"ds c #295555", +"dt c #5E7272", +"du c #011A1A", +"dv c #000202", +"dw c #55A1A1", +"dx c #000F0F", +"dy c #176464", +"dz c #042020", +"e` c #0F0000", +"ea c #001C1C", +"eb c #8A5B5B", +"ec c #419A9A", +"ed c #000808", +"ee c #205C5C", +"ef c #420707", +"eg c #064949", +"eh c #041919", +"ei c #0C5C5C", +"ej c #001515", +"ek c #071212", +"el c #1D4F4F", +"em c #171B1B", +"en c #154747", +"eo c #2D8686", +"ep c #031B1B", +"eq c #000101", +"er c #3C1B1B", +"es c #286A6A", +"et c #044040", +"eu c #000E0E", +"ev c #264747", +"ew c #0F4E4E", +"ex c #0D1E1E", +"ey c #396A6A", +"ez c #001B1B", +"f` c gray14", +"fa c #0C4141", +"fb c #031414", +"fc c #172121", +"fd c #002828", +"fe c #060D0D", +"ff c #063B3B", +"fg c #2B5C5C", +"fh c #645C5C", +"fi c #000707", +"fj c #343A3A", +"fk c #396363", +"fl c #182525", +"fm c #364949", +"fn c #001414", +"fo c #467373", +"fp c #AA7979", +"fq c #506969", +"fr c #002121", +"fs c #1C7171", +"ft c #213E3E", +/* pixels */ +"````````````````````````dx`eahddahdvdx``````````````````````", +"``````````````````dp``dufrdxej`ieqbg`n`dddbr````````````````", +"````````````````dxalddfa`ddqetdldzbdcmchchdj`b``````````````", +"````````````b``efn`japanegeifabeeidmekcibafr`xfded``````````", +"``````````bxdi`qdocua`cwdr`afldy`yemaveianehbpfnalcl````````", +"````````ct`nefbdcacwcbfcelbweedcdsftatbwdycscabp`jfrcm``````", +"````````ctdicjanel`fdybwesbobodfbkfgesby`fdyeia`caddcc``````", +"``````dkezdnaofabk`yerdceycfazcfaaeyfh`keofsatd`crapalcd````", +"````fneq`ifbavbvbfbyeoececblbqcodaaddgbceoevcncbdlbdetbg`e``", +"````cqejdibdeiataxeoecbcbq`v`c`zam`vdgbhbfde`hemfacy`l`scb``", +"`````ddiefde`fdbbodtbcdgcx`oambhbl`v`vdgazfkevfldrer`wdddk``", +"``bmaydibd`menftcebfcfbq`vfpararbtawamdwakfmevfcdmdmapfdbxdx", +"``fi`bayegbzaf`hdebkbibqambtarfp`obl`zfhakfkdebucbdmdlch``cq", +"``dxacbrapbeenfcevaufoad`cbhblarfpaqbh`zfoauceceembecjdpbxdk", +"``fnez`papekcwfcc`cgaacobnababbtfp`obhakcvbkce`uafekdncd``fr", +"``bbeabx`jd`afckevcg`gakfhdtbhbtebbqcpbnbibfcefcexekandifdfi", +"``cddv`bbaekd`cneldsau`gcocodtdt`cfhebbhbceoftemd`cidz`bbg`s", +"``dh`p`ddodzekaienbvfmfm`gagagagfqbiecebbsdccncb`rcjbpfrfrdx", +"````asembbdnfedmenck`udebffkaaazazcgbfesbwax`rdmegdl`i`bac``", +"````b`ezccfbcaegdraick`hbweseyfkc`evc`dsdbcnbzerf`crdvdddj``", +"`````p`x`j`bcaegcwcwcnataxazbvbvf``uen`ycbbzcabdajfnedfndo``", +"``````dvdue`caefana`av`tbv`lenbuckfcbvc``mbeffcwaeedeaeu````", +"``````````ej`jbdajanaya`dmewfj`tavfaercqffaodldpeufnfn``````", +"````````bjeqcl`xfl`janehbpcua`egcsefcacidldz`xeu``brcl``````", +"``````````bxacbjdvacb``pbabpciehepcjdlah`pdkeq``b`dj````````", +"`````````````e`ncd`ebxbbdubm`s`bctdhbbdxcd`pej`seq``````````", +"````````````````bjcmczctfieqdxbrahbbdvdv`scmcd``````````````", +"``````````````````aldvace`ejb`bmalbjedcdbm`p````````````````", +"````````````````````````dxbjdhcte`cicm``````````````````````", +"````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood7.xpm b/hacks/images/bubbles/blood7.xpm new file mode 100644 index 00000000..81a71ca0 --- /dev/null +++ b/hacks/images/bubbles/blood7.xpm @@ -0,0 +1,228 @@ +/* XPM */ +static char *blood7[] = { +/* width height ncolors chars_per_pixel */ +"36 36 185 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #013232", +"`j c #3C9090", +"`k c #251A1A", +"`l c #095454", +"`m c #190101", +"`n c #70D0D0", +"`o c #000606", +"`p c #003434", +"`q c #0E2E2E", +"`r c #001313", +"`s c #115555", +"`t c #213030", +"`u c #60C0C0", +"`v c #0F0404", +"`w c #002020", +"`x c #165D5D", +"`y c #636A6A", +"`z c #072A2A", +"a` c #445C5C", +"aa c #6C7676", +"ab c #000C0C", +"ac c #549393", +"ad c #001919", +"ae c #102222", +"af c #4D5454", +"ag c #002626", +"ah c #163535", +"ai c #043737", +"aj c #4F6363", +"ak c #000505", +"al c #65A0A0", +"am c #052E2E", +"an c #041616", +"ao c #044444", +"ap c #76C1C1", +"aq c #7ED6D6", +"ar c #001212", +"as c #196969", +"at c #385656", +"au c #0C4545", +"av c #767F7F", +"aw c #642525", +"ax c #360505", +"ay c gray28", +"az c #5FB4B4", +"b` c #002C2C", +"ba c #0E2626", +"bb c #000B0B", +"bc c #030404", +"bd c #001818", +"be c #944040", +"bf c #280404", +"bg c #0A0E0E", +"bh c #385C5C", +"bi c #002525", +"bj c #6D8686", +"bk c #407E7E", +"bl c #000404", +"bm c #354F4F", +"bn c #739999", +"bo c #001111", +"bp c #5A7D7D", +"bq c #347272", +"br c #030A0A", +"bs c #5AABAB", +"bt c #010808", +"bu c #001E1E", +"bv c #6E3B3B", +"bw c #71B1B1", +"bx c #183C3C", +"by c #274E4E", +"bz c #266464", +"c` c #000A0A", +"ca c #287373", +"cb c #0D1A1A", +"cc c #2B3E3E", +"cd c #053333", +"ce c #121515", +"cf c #270C0C", +"cg c #001717", +"ch c #253838", +"ci c #418888", +"cj c #374343", +"ck c #013C3C", +"cl c #040707", +"cm c #031D1D", +"cn c #192C2C", +"co c #000303", +"cp c #164040", +"cq c #537272", +"cr c #120E0E", +"cs c #032A2A", +"ct c #520B0B", +"cu c #001010", +"cv c #062323", +"cw c #435555", +"cx c #0C3636", +"cy c #8EAFAF", +"cz c #282A2A", +"d` c #001D1D", +"da c #0C1515", +"db c #515C5C", +"dc c #1B5555", +"dd c #297D7D", +"de c #002A2A", +"df c #2B3030", +"dg c #4F3939", +"dh c #AF5C5C", +"di c #000909", +"dj c #003737", +"dk c #010000", +"dl c #001616", +"dm c #042727", +"dn c #0C3C3C", +"do c #030F0F", +"dp c #010D0D", +"dq c #002323", +"dr c #074E4E", +"ds c #0C4949", +"dt c #295555", +"du c #5E7272", +"dv c #011A1A", +"dw c #000202", +"dx c #55A1A1", +"dy c #000F0F", +"dz c #176464", +"e` c #042020", +"ea c #0F0000", +"eb c #001C1C", +"ec c #8A5B5B", +"ed c #419A9A", +"ee c #000808", +"ef c #205C5C", +"eg c #420707", +"eh c #064949", +"ei c #041919", +"ej c #0C5C5C", +"ek c #001515", +"el c #071212", +"em c #1D4F4F", +"en c #171B1B", +"eo c #154747", +"ep c #2D8686", +"eq c #031B1B", +"er c #000101", +"es c #3C1B1B", +"et c #286A6A", +"eu c #044040", +"ev c #000E0E", +"ew c #264747", +"ex c #0F4E4E", +"ey c #0D1E1E", +"ez c #396A6A", +"f` c #001B1B", +"fa c gray14", +"fb c #0C4141", +"fc c #031414", +"fd c #172121", +"fe c #002828", +"ff c #060D0D", +"fg c #063B3B", +"fh c #2B5C5C", +"fi c #645C5C", +"fj c #000707", +"fk c #343A3A", +"fl c #396363", +"fm c #182525", +"fn c #364949", +"fo c #001414", +"fp c #467373", +"fq c #AA7979", +"fr c #506969", +"fs c #022323", +"ft c #002121", +"fu c #1C7171", +"fv c #213E3E", +/* pixels */ +"````````````````````````````````c``efoardw``````````````````````````````", +"````````````````````````cobb`oftf`cuarevdldk`mdeag``````````````````````", +"````````````````````cueefodjaheub`fcdofcagckeuaxdk`kdv``````````````````", +"``````````````````ekcoaddj`tao`l`leudme`eoczdr`ife`pdkbf````````````````", +"``````````````c`dvfjdl`pehcveuejdsdncbccdsbgcveqbrdvc`bibuee````````````", +"````````````c``qdjdqbrdm`zdnauexfdfmdzdz`acpdsejame`dpbo`r`oco``````````", +"``````````cuaxaxegdrcvbacrahahemembzezef`hefdz`f`ffkaocle`f`fte`````````", +"``````````de`icke`ctewbyeofvbzcafhfhbefhdfetbzbvdg`sesamcl`pf`ax````````", +"````````ebdi`bfceicf`ffuafcaetbqbkedecbqfnbqepddbv`f`fauanaiaodwab``````", +"``````ebfjadbrfffb`sfhfudbepezci`cdxcifra`edbe`jbkfudz`qbgcd`h`b`par````", +"``````ftarebcmehcfbmfucaepbveddxfqacdudbbpecbjaaepby`tfdeyamczesad`m````", +"````eedecuaobfewdzdgbvepedaydxdhal`c`yal`ubwdhdxbhfk`hfmeydnczegdeb``m``", +"````ce`p`kfafv`f`sfuawbebeaf`udhbwbnbjbn`u`ufqbsayezewchfmexesbfcxcoe```", +"`````weaax`mctejdcemdtbqacdx`ufqcy`nbwbnbjalalbsa`bhdtewfdexeh`heucoft``", +"````agdjcxfacxaeenchccatcidxazapaqfqcy`nbjavbjcqdbbhfkfafdbadnai`i`ebd``", +"``fjcgdq`maoel`aenchfkcjfpbsalbnbnapaqaqbnbn`yajajflcj`tahcb`qdm`bbifoek", +"``addw`o`baodaexfd`hfh`gfpac`cbjbnbnaqavapbwduajfrbhfkchbxeybgei`idldwcg", +"```mboftageuelcxcn`hccbma`frdu`yaaavbwcyapbwduajcwatdf`tcneyelclb`dldw`r", +"``eadl`rftcselaeenfvccfnayajfr`yaa`cbwfq`ualbpcqfpflewfveneydae``pdedqbd", +"``fffo`oeabcelbgeneofhfnatcwajdubp`ybjbsfidhdx`jciddewfmendaffcmckaxdefj", +"````ekdvckbreqcbaedcbzbybmcja`frcqfrdbbpdxecaabvdgaweffmcebaananbueabu``", +"`````wag`pdpcmelcxcpeofvccfnfkay`gafafajajfp`jciawafefen`qcdcmbt`raedv``", +"````d`c``dfobrbr`qdseocn`hczbmbhezbhayfnfkbmfhfhefescpbadrehfsakekdq`m``", +"````c`cgagdjfccsehdsdsahcnfadtfhbqezfldffndfccemdc`scedn`mahcserar`ddw``", +"```````obi`bde`iaoehcxcxcpemasawcafhfhczew`hdc`xes`acbauegamadakfjar````", +"``````fjeb`d`k`maxaoamfbexctdzdz`feocpcnenbx`xesemba`z`maiftdiee`efj````", +"````````blak`bfddkckcvameh`lexctcecpahahbaaucrczeheldmfgft`ocu`mad``````", +"``````````akfjfo`peack`kegaieyds`ldfegexauescr`vcdeidmdef`abd`ad````````", +"``````````bl``dwdydqb``bfsdodoeie`dmaoaxbxamfgfafsdl`weverfj`mbl````````", +"````````````c`c`abakerabbb`o`obcclbreieiandmagft`odvakcoeec`dk``````````", +"```````````````e`mcgbb`obbdvf``wbbcgcsdl`odldvbbdycudiadfobl````````````", +"``````````````````dybud`ev`ofjbber`rdvdqarfjblakblar`m`m````````````````", +"````````````````````cobbebdv`r``coblekf`cu``difoeaarc```````````````````", +"````````````````````````ererboeabuevc`didiblerarbl``````````````````````", +"````````````````````````````````c```blabdk``````````````````````````````", +"````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood8.xpm b/hacks/images/bubbles/blood8.xpm new file mode 100644 index 00000000..050b6e28 --- /dev/null +++ b/hacks/images/bubbles/blood8.xpm @@ -0,0 +1,241 @@ +/* XPM */ +static char *blood8[] = { +/* width height ncolors chars_per_pixel */ +"44 44 190 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #010404", +"`j c #013232", +"`k c #3C9090", +"`l c #251A1A", +"`m c #095454", +"`n c #190101", +"`o c #70D0D0", +"`p c #000606", +"`q c #003434", +"`r c #0E2E2E", +"`s c #001313", +"`t c #115555", +"`u c #213030", +"`v c #60C0C0", +"`w c #0F0404", +"`x c #002020", +"`y c #165D5D", +"`z c #636A6A", +"a` c #072A2A", +"aa c #445C5C", +"ab c #6C7676", +"ac c #000C0C", +"ad c #549393", +"ae c #001919", +"af c #102222", +"ag c #4D5454", +"ah c #002626", +"ai c #163535", +"aj c #043737", +"ak c #4F6363", +"al c #000505", +"am c #65A0A0", +"an c #052E2E", +"ao c #041616", +"ap c #044444", +"aq c #76C1C1", +"ar c #7ED6D6", +"as c #001212", +"at c #196969", +"au c #385656", +"av c #0C4545", +"aw c #767F7F", +"ax c #642525", +"ay c #360505", +"az c gray28", +"b` c #5FB4B4", +"ba c #002C2C", +"bb c #0E2626", +"bc c #8C9B9B", +"bd c #000B0B", +"be c #030404", +"bf c #001818", +"bg c #944040", +"bh c #280404", +"bi c #0A0E0E", +"bj c #385C5C", +"bk c #002525", +"bl c #6D8686", +"bm c #407E7E", +"bn c #000404", +"bo c #354F4F", +"bp c #739999", +"bq c #001111", +"br c #5A7D7D", +"bs c #347272", +"bt c #030A0A", +"bu c #5AABAB", +"bv c #010808", +"bw c #001E1E", +"bx c #6E3B3B", +"by c #71B1B1", +"bz c #183C3C", +"c` c #274E4E", +"ca c #266464", +"cb c #000A0A", +"cc c #287373", +"cd c #0D1A1A", +"ce c #2B3E3E", +"cf c #053333", +"cg c #121515", +"ch c #270C0C", +"ci c #001717", +"cj c #253838", +"ck c #418888", +"cl c #374343", +"cm c #013C3C", +"cn c #040707", +"co c #031D1D", +"cp c #192C2C", +"cq c #000303", +"cr c #070000", +"cs c #164040", +"ct c #537272", +"cu c #5B8787", +"cv c #120E0E", +"cw c #032A2A", +"cx c #520B0B", +"cy c #001010", +"cz c #062323", +"d` c #435555", +"da c #0C3636", +"db c #8EAFAF", +"dc c #282A2A", +"dd c #001D1D", +"de c #0C1515", +"df c #515C5C", +"dg c #1B5555", +"dh c #297D7D", +"di c #002A2A", +"dj c #2B3030", +"dk c #4F3939", +"dl c #AF5C5C", +"dm c #000909", +"dn c #003737", +"do c #010000", +"dp c #001616", +"dq c #042727", +"dr c #0C3C3C", +"ds c #030F0F", +"dt c #010D0D", +"du c #002323", +"dv c #074E4E", +"dw c #0C4949", +"dx c #295555", +"dy c #5E7272", +"dz c #011A1A", +"e` c #000202", +"ea c #55A1A1", +"eb c #000F0F", +"ec c #176464", +"ed c #042020", +"ee c #0F0000", +"ef c #001C1C", +"eg c #8A5B5B", +"eh c #419A9A", +"ei c #000808", +"ej c #205C5C", +"ek c #420707", +"el c #064949", +"em c #041919", +"en c #0C5C5C", +"eo c #001515", +"ep c #071212", +"eq c #1D4F4F", +"er c #171B1B", +"es c #154747", +"et c #2D8686", +"eu c #031B1B", +"ev c #000101", +"ew c #3C1B1B", +"ex c #286A6A", +"ey c #044040", +"ez c #000E0E", +"f` c #264747", +"fa c #0F4E4E", +"fb c #0D1E1E", +"fc c #396A6A", +"fd c #001B1B", +"fe c gray14", +"ff c #0C4141", +"fg c #031414", +"fh c #011212", +"fi c #172121", +"fj c #002828", +"fk c #060D0D", +"fl c #063B3B", +"fm c #2B5C5C", +"fn c #645C5C", +"fo c #000707", +"fp c #343A3A", +"fq c #396363", +"fr c #182525", +"fs c #364949", +"ft c #001414", +"fu c #467373", +"fv c #AA7979", +"fw c #506969", +"fx c #022323", +"fy c #002121", +"fz c #1C7171", +"g` c #213E3E", +/* pixels */ +"````````````````````````````````````````````ac``````````````````````````````````````````", +"`````````````````````````````````peie`bnbddidicicqae`xbwcg``````````````````````````````", +"````````````````````````````cqcqddfydieoezebfoezbqahee`n`n`rbw``````````````````````````", +"`````````````````````````pcbac`jap`nekapcweuaofhanapffekekdocr`dfd``````````````````````", +"````````````````````ev`sal`pdieleleyel`m`mfla`emelbhdjelajfydn`jdo`ncd``````````````````", +"``````````````````eveoezeobaelajdqfldv`mdw`rde`mcx`rfkemepdscncocbdidueo````````````````", +"````````````````fo`bdndd`idqcfa`drdr`tfa`acgesatesfbdafadvfledfkbvacftbnev``````````````", +"``````````````fj`dcmcmcmdsfkbibbdaaffrcpaidgccecaics`t`tdxfpffa`cnfg`baebqac````````````", +"````````````ch`dcp`ddvcxcfdwfferercsejexc`caetex`uf`atfzaz`fenchdvemdsahcy`bcg``````````", +"``````````dzef`xeycoedewench`yesdgcaexccfmbsbxfcdjdxcacafcew`ydkenajdsdqcmezchef````````", +"``````````dzalfybwaodqch`ffz`fbscccabsbmckbgegbmclbjetetdhbxax`l`favczdqai`bacft````````", +"````````crbdbwdtbtcodrenaxejaadcdhfqfu`kbgehckfwd`fucufp`ketaaatatdabiedapcmbwaf`s``````", +"````````fteoevfgemelfpclfzfzdh`z`k`k`kbudladbrctdfadazehbr`kccc`eq`adeczaj`ncpei`d``````", +"``````eoftfoahajekekcv`ldhdhdhehbxadeadlea`c`zbrcub`fnbxabbmbocj`uercg`rapcxeydiahdu````", +"```````dahdiewayes`mecdkaxbxckegazbudl`vam`cab`c`oaqfvdlbufqfsfp`hfrfidrdvcnek`qacbk````", +"````dd`ndnayewcjcvcl`tfzbxbg`zbgegb`eg`obybpblawby`v`vdlblaafqfqf`g`fidr`mdj`n`lacdp`n``", +"````fy`day`d`wayewecdgdgdxfcckehbu`vfvab`oaqbybpaw`cambubufu`gfqc`f`frdr`mdvfefeebbdfy``", +"````ci`ddn`lbhdvdr`acpcjceaufcadeab``odbfvfvdb`obpawbl`ccuakaafpce`ufr`adafleybadzebdd``", +"````dp`j`j`heldqdeaferg`djbod`adbuambybyaqarawarbyblab`zdfdffcbjdj`uaicgfbfled`jbaevbw``", +"`````scibwdrelembbaier`uf`auazbradam`cbpbpbyarfvaqbpbl`zdyctfubjce`hbzfrdeemczcwduevbw``", +"````cq``bddnelepavbzfi`udxboazbrad`cblblbpbpaqbcaraqam`zfwfwaaclfpg`bzfr`acnco`jftalci``", +"``eefofddp`jeyao`raifi`hf`fp`gakctdyababawblbyaraw`oam`zakagaafsdj`ucp`afbepbt`beoe`al`p", +"````ezbw`efjajfkbbfberg`cecl`gazdfak`zababbpbydbdlbycudyfwakfcauceg`erafdeepeddn`bfdac``", +"````cbbqevchdtepcdfbfrg`c`fsfpd`akct`zdy`zab`cb`eg`vbuadckckckfmcjcpcgcgbifkfxdndnafbk``", +"````fd`p`scmcnepfkcv`rdgejfmfpau`gakbrctcu`zdycueafndlegbgbgfudhf`cpcgdedefkao`j`bah`d``", +"````eeacahdn`iembibbbbesejdxdjboclaaakakfwdfdffwcueablabbgbxaxdkdgficgbba`cobfftbafyeo``", +"````fdever`bdscnedepdrcscsg`dcf`clfp`gazd`agagaaakaafuck`kbgaxfzeqer`adadqaobt`s`jeodp``", +"````ezebbk`deobeemaodafafaai`hdjdjfsbjfqfcaaazazclclaufqfmfmfzatbzafavelflfhalaceedmfk``", +"``````ezefa``qdscncfffdwesbzfifefef`dxfqbsfcfqfpclfpfpc`dxeqboescgdacx`u`ledalaschef````", +"````````fdcwer`xbkfldw`mffdaaiaiaiejexccexexexcjc`cj`uf`dgat`yafcdffayfe`baefocqfy`s````", +"````````cbbk`bdn`jflapapda`rdr`tfsaxewaxcaf`g``u`h`hbz`yeccgfadebbewbhcmfjeidmbn`e``````", +"``````````dzfjereebhekapcfa`av`tf``tdk`lecbzcscpfrcpeqc``fenfffkcfekcmfyebcqacasfo``````", +"``````````e`e`ahdiay`ncmfxa`ajdcfadwfp`fdgcsaiai`a`r`tchdjesanfgcwflcwcbacaeeedd````````", +"````````````bnfobq`jee`ndnajewewanfbavdwekcvewdwffdwcxaycnapdsemah`bbw`sasdueo`e````````", +"``````````````ev`ecbbw`jchdn`hanczcnczanfldaescxbzayflelcnflbeahfybwacaldp`ncb``````````", +"``````````````cb``e`bdcbcibffddtbebebeepepaoancffldqeuajeyfyebbwftei`pbnbwee````````````", +"````````````````ezcy`sace`cb`p`pbqdpdsbebteudqbedteudqbkfde`aebqal``bn``bd``````````````", +"``````````````````fh`naecybdcb`eaeciddfhdtdzdiddfocbaeci`edmae`pcyfdft`p````````````````", +"````````````````````btdpbwefcidmalfocy`pbdftefbkbfeialbnale`bnbf`nepdm``````````````````", +"````````````````````````cqebcvfycibqeibn```ebwbkbkaccqalebeoeebq````````````````````````", +"``````````````````````````````bnbdcvdeftebbdasbdevbncqcydzasbq``````````````````````````", +"````````````````````````````````ei`pbqft`nbqbdac`eacdmcqev``````````````````````````````", +"````````````````````````````````````````````e```````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blood9.xpm b/hacks/images/bubbles/blood9.xpm new file mode 100644 index 00000000..e6efa9e2 --- /dev/null +++ b/hacks/images/bubbles/blood9.xpm @@ -0,0 +1,247 @@ +/* XPM */ +static char *blood9[] = { +/* width height ncolors chars_per_pixel */ +"50 50 190 2", +/* colors */ +"`` c None", +"`a c #102A2A", +"`b c #002E2E", +"`c c #689494", +"`d c #250000", +"`e c #000D0D", +"`f c #5D1616", +"`g c #415050", +"`h c #212A2A", +"`i c #010404", +"`j c #013232", +"`k c #3C9090", +"`l c #251A1A", +"`m c #095454", +"`n c #190101", +"`o c #70D0D0", +"`p c #000606", +"`q c #003434", +"`r c #0E2E2E", +"`s c #001313", +"`t c #115555", +"`u c #213030", +"`v c #60C0C0", +"`w c #0F0404", +"`x c #002020", +"`y c #165D5D", +"`z c #636A6A", +"a` c #072A2A", +"aa c #445C5C", +"ab c #6C7676", +"ac c #000C0C", +"ad c #549393", +"ae c #001919", +"af c #102222", +"ag c #4D5454", +"ah c #002626", +"ai c #163535", +"aj c #043737", +"ak c #4F6363", +"al c #000505", +"am c #65A0A0", +"an c #052E2E", +"ao c #041616", +"ap c #044444", +"aq c #76C1C1", +"ar c #7ED6D6", +"as c #001212", +"at c #196969", +"au c #385656", +"av c #0C4545", +"aw c #767F7F", +"ax c #642525", +"ay c #360505", +"az c gray28", +"b` c #5FB4B4", +"ba c #002C2C", +"bb c #0E2626", +"bc c #8C9B9B", +"bd c #000B0B", +"be c #030404", +"bf c #001818", +"bg c #944040", +"bh c #280404", +"bi c #0A0E0E", +"bj c #385C5C", +"bk c #002525", +"bl c #6D8686", +"bm c #407E7E", +"bn c #000404", +"bo c #354F4F", +"bp c #739999", +"bq c #001111", +"br c #5A7D7D", +"bs c #347272", +"bt c #030A0A", +"bu c #5AABAB", +"bv c #010808", +"bw c #001E1E", +"bx c #6E3B3B", +"by c #71B1B1", +"bz c #183C3C", +"c` c #274E4E", +"ca c #266464", +"cb c #000A0A", +"cc c #287373", +"cd c #0D1A1A", +"ce c #2B3E3E", +"cf c #053333", +"cg c #121515", +"ch c #270C0C", +"ci c #001717", +"cj c #253838", +"ck c #418888", +"cl c #374343", +"cm c #013C3C", +"cn c #040707", +"co c #031D1D", +"cp c #192C2C", +"cq c #000303", +"cr c #070000", +"cs c #164040", +"ct c #537272", +"cu c #5B8787", +"cv c #120E0E", +"cw c #032A2A", +"cx c #520B0B", +"cy c #001010", +"cz c #062323", +"d` c #435555", +"da c #0C3636", +"db c #8EAFAF", +"dc c #282A2A", +"dd c #001D1D", +"de c #0C1515", +"df c #515C5C", +"dg c #1B5555", +"dh c #297D7D", +"di c #002A2A", +"dj c #2B3030", +"dk c #4F3939", +"dl c #AF5C5C", +"dm c #000909", +"dn c #003737", +"do c #010000", +"dp c #001616", +"dq c #042727", +"dr c #0C3C3C", +"ds c #030F0F", +"dt c #010D0D", +"du c #002323", +"dv c #074E4E", +"dw c #0C4949", +"dx c #295555", +"dy c #5E7272", +"dz c #011A1A", +"e` c #000202", +"ea c #55A1A1", +"eb c #000F0F", +"ec c #176464", +"ed c #042020", +"ee c #0F0000", +"ef c #001C1C", +"eg c #8A5B5B", +"eh c #419A9A", +"ei c #000808", +"ej c #205C5C", +"ek c #420707", +"el c #064949", +"em c #041919", +"en c #0C5C5C", +"eo c #001515", +"ep c #071212", +"eq c #1D4F4F", +"er c #171B1B", +"es c #154747", +"et c #2D8686", +"eu c #031B1B", +"ev c #000101", +"ew c #3C1B1B", +"ex c #286A6A", +"ey c #044040", +"ez c #000E0E", +"f` c #264747", +"fa c #0F4E4E", +"fb c #0D1E1E", +"fc c #396A6A", +"fd c #001B1B", +"fe c gray14", +"ff c #0C4141", +"fg c #031414", +"fh c #011212", +"fi c #172121", +"fj c #002828", +"fk c #060D0D", +"fl c #063B3B", +"fm c #2B5C5C", +"fn c #645C5C", +"fo c #000707", +"fp c #343A3A", +"fq c #396363", +"fr c #182525", +"fs c #364949", +"ft c #001414", +"fu c #467373", +"fv c #AA7979", +"fw c #506969", +"fx c #022323", +"fy c #002121", +"fz c #1C7171", +"g` c #213E3E", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````bnbnbddpfjdn`bahfdcq`pebfj````````````````````````````````````", +"````````````````````````````````bnfocqftbwdddpeobqbddmfofyaydoaydnahbk``````````````````````````````", +"````````````````````````````fd`seibw`q`qapcmahdzfgfgbtfh`x`qcmflcheecrbwah``````````````````````````", +"````````````````````````dmdmezalfd`bapek`ddvelapajdqdscwdvaycravcm`j`rdoayahdd``````````````````````", +"```````````````````````pftevevdzdn`heyajey`m`m`manczaoel`wapeyeyfxfh`bah`qfibhah````````````````````", +"````````````````````bnfd`xezeo`jdvcfeddadvenavav`rcd`tfpdabicdczcoepbedzez`sahdzbq``````````````````", +"``````````````````cbdi`qdifhdsancfa`drdafa`tbzafcgesej`tfbdaff`mdvfledfgbtbtcycifo``````````````````", +"````````````````du`naydncmfxcnaobibbdr`aerfrcpcpeqdhatesfres`t`tdkdgdra`btfhbwdicyezei``````````````", +"``````````````fbcr`rekeeayapdqda`rcg`afreqejejdxcadhccg``uejatfzaxclc`cx`mcodtfg`jev`bbk````````````", +"````````````bw`jdzchcmdqeyg`ceekfaaibzdgejcccadxbsfnbsceceexejfzaxew`teccxelaocn`bdnevbh`x``````````", +"```````````s`xfofjdnfhfgdvewayewdkatexexccbsbsbm`kfpckfsbofqccexdhewdkaz`fenflbtajap`xfdbqcb````````", +"``````````fyacdpdzdsfgdqen`fatecagaxdhfmfcck`kbleg`kfud`d`bs`kfnetdhbs`gateca`fkcweldnebay`e````````", +"````````bqdmaeftbtbecofffaecfzatakaxetbmfcckbubxehbrctakfw`kegdk`ketetatecfacdbidqapap`jdmercq``````", +"`````````nevbfeoeueuavcxec`ffzccdh`k`z`keheadlb`cuctctdfbrbldlcuad`kccf`g`cscgfbdqflayekfybk`n``````", +"``````alfj`pftfjflbhayekcxewccdhet`kbgehadbpb`am`cfnbrcububpdlbxadbmboce`ucpcgafdaelewapdibncrdz````", +"``````dzbbddey`dayesenecatewewbmckabbxamb`dlb`am`cab`c`vdbbyfvdleafqclcedc`hfibbff`m`w`dcmaedu`d````", +"``````bhay`qay`hcscvf``t`ybxaxbxegbgagfv`vfvbybybpblawby`v`v`vdlbuaabjfcf`cjcpfrdw`mewek`dahfoah````", +"````efczeecm`n`wekcx`f`tdgexexbmeheabu`vaqegdbaqaqbpbpawambyb``vb`fu`gfcfmdx`ufrff`mdveweedievdddz``", +"````bfer`ddnapbhfa`mesbzg`cjcebjfuckeab``vdbfvarararaqbpawblamamadfw`gfsboc``herdrdwapeldnfje`aeef``", +"````cy`nfi`dai`uflfbcder`uceceauaaadeabubyaq`oarfvbcarbyblabblbrfwdfaabjfpdc`ufiafdaflanbadnbd`sdz``", +"`````pbw`beyekeyczbi`afr`ucjfpcld`cubuamambpbyaqardbaraqbp`c`z`zdfdffufqcldc`ucpcdfbcfeddqdnbwbdbw``", +"````al`e`sah`napep`acsfifecjauauazbradam`cblbpbpbyarawarbybpab`zfwctfubjfpdj`haifbcdepcocwah`saleo``", +"````e`ei`pfh`leybiffeser`hc`fmfs`gbmadcublabblblbpaqardbaqaq`c`zfwfwd`clfpcecjbzaf`afkemanbwcy``eo``", +"`````edzdd`pekflep`rdacpfecjcecl`gakfwdybr`zababbpbyarfv`obyblfnakagaabodjcj`ucpaffbepbefjcidpbnas``", +"````cbdzaee`eyanfkbbafercpcjcjfs`g`gdfdffn`zabblbpby`ofv`vambrfwakaafcauf`cj`ufiafepfkaodn`j`xdz`p``", +"````cbaseo`sayfkfkcdcdcgbzc`f`fsfpd`akctdfdy`z`zblambyegb`b`adcubmbmbmfqf``ucpcgcdbifkfxdndn`b`dcy``", +"````aecbe``b`jcnaobicvereseqcadxfpbjd`dfctbrbrbr`zbr`cb`fnegbueaehehbmdhc``ufierdebicnaocm`qcrdudd``", +"````dzei`s`qdibtaocnfbfbfadgcadxdjbocld`fwfwctctdfakdycub`agegbxbxbxbxaxcabzercgfbedfgfgddfyaybwde``", +"````asbdbf`ddu`icocoep`rbzcsdgc`djfsfs`g`gagagagagagdfctfuckehegegbgdjdhecaicgcd`redcobtezfybhfyae``", +"````foaeddeedidsbeedbi`ravesbzcjfececefpaud`aad`d``gd`aad`aabsbmdhfnbxaxdg`afbdreyanfg`pezbkahasfk``", +"``````dd`p`j`qft`iemepa`dresesaifedcdccebjbjfcfcbjfsclclclfsbofmfmejcaboescgdadvcsflfgal``erfdae````", +"``````alftdddo`jdscndqapavfaesbzfife`hcjfmdxbsbsfcfqclclcldjcedxdxeqat`tbbbb`mekaicpfxdmaccwfyfd````", +"``````cb`pfyerayddfxajdcdwdwdraiaiai`uf`caccexexexexcef`c`dccjf`dgatec`rde`rcsbhap`jfddmcqfy`n`p````", +"````````bn`xcz`b`j`jcfflelfldadadafa`yataxewccejc`c`cj`hcjfees`yeccx`ycddeff`wayajahdmcbcqftbd``````", +"````````foacdddo`j`d`nfeapajandaav`tch`yejdx`fejg`g``ufrerbz`y`ychf`facdczelbhajfxfheialcbbnac``````", +"`````````````edzererdnbeaycfa`a`dadwf`av`y`fcxeqaiaiaifiercsc`chf`djdacnanfldafjcyaccbbwfyac````````", +"``````````evbn``ciduchcrayajdqanapcxdrdadw`tcedjfaavavdrdadwdjchewesczemfxcwcwbffoebbwcodo``````````", +"``````````````bne``sci`jay`ncpdrbhapajema`avdway`maydwdwavcxekaycneydscofjahfydz`ebfbkefbd``````````", +"``````````````evevbdcq`sbkdn`q`jajdqcobtbta`a`a`cfelchewcheycfewekajbeedduddasei``eocrbd````````````", +"````````````````cb``e`bndmdmeoftaedtbebecncnaodsaodqanajanedfxajajcoezfydpalev`pacbwee``````````````", +"```````````````````e`ecycyeievacal`iebfhfgbvbedscodqbedtfhfxahahbfevbfft``e`e`evev`e````````````````", +"````````````````````ft`nefbfdmbndmcbfdfyddbwezcyfyfjdzezdm`sefaecb`paeebalebas`scq``````````````````", +"``````````````````````do`wbwfdftft``eiacezeobnezeodufyftdmfocybd`pcbbndmciembicb````````````````````", +"````````````````````````dme``scrcvaecyasfocb``bdbfbwdubkaeebe`cqalebfdcrcycrcb``````````````````````", +"``````````````````````````````cqacdpbwcibqe`cqalfoasbqaseibndmacci`ncyebdm``````````````````````````", +"````````````````````````````````cqe```ez`n`nciftac`ebqfofoe`evcb`wasal``````````````````````````````", +"```````````````````````````````````````ecq`ebqeofgeo`sbdbdbqcbbn````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue.pov b/hacks/images/bubbles/blue.pov new file mode 100644 index 00000000..86d1ff8d --- /dev/null +++ b/hacks/images/bubbles/blue.pov @@ -0,0 +1,22 @@ +#include "colors.inc" +#include "shapes.inc" +#include "textures.inc" + +/* The following make the field of view as wide as it is high + * Thus, you should have the -W and -H command line options + * equal to each other. */ +camera { + location <5.8, 0, 0> + up <0, 1, 0> + right <1, 0, 0> + look_at <0, 0, 0> +} + +sphere { + <0,0,0>, 2.5 + texture { Blue_Agate + scale <0.7, 0.7, 0.7> } + finish { phong 1 } +} + +light_source {<6, 1, 0> color White} diff --git a/hacks/images/bubbles/blue1.xpm b/hacks/images/bubbles/blue1.xpm new file mode 100644 index 00000000..49ff0128 --- /dev/null +++ b/hacks/images/bubbles/blue1.xpm @@ -0,0 +1,63 @@ +/* XPM */ +static char *blue1[] = { +/* width height ncolors chars_per_pixel */ +"10 10 46 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #2E2E4E", +"`c c #1D1D30", +"`d c #1B1B2E", +"`e c #0C0C12", +"`f c #0A0A10", +"`g c #17172A", +"`h c #25253E", +"`i c #12121E", +"`j c #20202F", +"`k c #141423", +"`l c #2F2F4E", +"`m c #1A1A2C", +"`n c #333355", +"`o c #1D1D2B", +"`p c #282843", +"`q c #303051", +"`r c #111122", +"`s c #161620", +"`t c #0A0A14", +"`u c #25253F", +"`v c #2B2B48", +"`w c #2F2F4F", +"`x c #101020", +"`y c #18182B", +"`z c #353558", +"a` c #15151E", +"aa c #191925", +"ab c #13131F", +"ac c #0D0D19", +"ad c #151524", +"ae c #343456", +"af c #1F1F34", +"ag c #0C0C14", +"ah c #0A0A12", +"ai c #494967", +"aj c #23233B", +"ak c #0C0C17", +"al c #292944", +"am c #121223", +"an c #BCBCD7", +"ao c #1A1A2E", +"ap c #0B0B15", +"aq c #262640", +"ar c #171724", +/* pixels */ +"```````s`uaj`u`t````", +"````ac`a`w`l`waqaa``", +"```m`p`x`nae`n`waj`t", +"``a``o`w`dan`z`q`yaf", +"``ap`g`l`naiam`lal`k", +"``ak`h`v`bao`b`v`h`s", +"``ab`iaral`r`j`uafab", +"````ad`c`sab`s`cag``", +"```````eadahad`f````", +"````````````````````" +}; diff --git a/hacks/images/bubbles/blue10.xpm b/hacks/images/bubbles/blue10.xpm new file mode 100644 index 00000000..9d6b2789 --- /dev/null +++ b/hacks/images/bubbles/blue10.xpm @@ -0,0 +1,240 @@ +/* XPM */ +static char *blue10[] = { +/* width height ncolors chars_per_pixel */ +"60 60 173 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #1B1B2B", +"`c c #282845", +"`d c #191929", +"`e c #323252", +"`f c #303050", +"`g c #111121", +"`h c #2E2E4E", +"`i c #0F0F1F", +"`j c #1D1D30", +"`k c #1B1B2E", +"`l c #0C0C12", +"`m c #0A0A10", +"`n c #17172A", +"`o c #212137", +"`p c #767691", +"`q c #1F1F35", +"`r c #2F2F48", +"`s c #101019", +"`t c #0E0E17", +"`u c #272740", +"`v c #181824", +"`w c #25253E", +"`x c #12121E", +"`y c #10101C", +"`z c #20202F", +"a` c #0E0E1A", +"aa c #2B2B47", +"ab c #0C0C18", +"ac c #292945", +"ad c #161625", +"ae c #141423", +"af c #242436", +"ag c #313150", +"ah c #121221", +"ai c #2F2F4E", +"aj c #2D2D4C", +"ak c #2B2B4A", +"al c #1A1A2C", +"am c #5C5C7A", +"an c #161628", +"ao c #333355", +"ap c #07070C", +"aq c #313153", +"ar c #05050A", +"as c #0D0D15", +"at c #07070F", +"au c #24243C", +"av c #202038", +"aw c #0D0D18", +"ax c #1D1D2B", +"ay c #0B0B16", +"az c #282843", +"b` c #262641", +"ba c #232334", +"bb c #11111F", +"bc c #0F0F1D", +"bd c #2C2C4A", +"be c #3C3C5D", +"bf c #2A2A48", +"bg c #1B1B2C", +"bh c #19192A", +"bi c #151526", +"bj c #131324", +"bk c #303051", +"bl c #111122", +"bm c #1F1F33", +"bn c #19192D", +"bo c #08080F", +"bp c #161620", +"bq c #23233A", +"br c #212138", +"bs c #0E0E18", +"bt c #0A0A14", +"bu c #272741", +"bv c #25253F", +"bw c #23233D", +"bx c #12121F", +"by c #10101D", +"bz c #202030", +"c` c #0E0E1B", +"ca c #1E1E2E", +"cb c #2B2B48", +"cc c #0C0C19", +"cd c #292946", +"ce c #181828", +"cf c #28283B", +"cg c #262639", +"ch c #2F2F4F", +"ci c #101020", +"cj c #1C1C2F", +"ck c #2A2A40", +"cl c #18182B", +"cm c #353558", +"cn c #09090F", +"co c #333356", +"cp c #07070D", +"cq c #15151E", +"cr c #202036", +"cs c #1C1C32", +"ct c #090912", +"cu c #191925", +"cv c #26263F", +"cw c #24243D", +"cx c #22223B", +"cy c #13131F", +"cz c #11111D", +"d` c #0F0F1B", +"da c #0D0D19", +"db c #2A2A46", +"dc c #262642", +"dd c #171726", +"de c #151524", +"df c #131322", +"dg c #111120", +"dh c #2E2E4D", +"di c #0F0F1E", +"dj c #1D1D2F", +"dk c #343456", +"dl c #08080D", +"dm c #151527", +"dn c #06060B", +"do c #1F1F34", +"dp c #1B1B30", +"dq c #0C0C14", +"dr c #0A0A12", +"ds c #494967", +"dt c #23233B", +"du c white", +"dv c #14141F", +"dw c #212139", +"dx c #1E1E2C", +"dy c #2B2B46", +"dz c #0C0C17", +"e` c #292944", +"ea c #0A0A15", +"eb c #262637", +"ec c #141422", +"ed c #2D2D4B", +"ee c #0E0E1C", +"ef c #1A1A2B", +"eg c #373758", +"eh c #181829", +"ei c #161627", +"ej c #333354", +"ek c #141425", +"el c #313152", +"em c #121223", +"en c #222236", +"eo c #030307", +"ep c #BCBCD7", +"eq c #1E1E32", +"er c #1C1C30", +"es c #1A1A2E", +"et c #0B0B12", +"eu c #18182C", +"ev c #28283F", +"ew c #090910", +"ex c #222239", +"ey c #202037", +"ez c #11111B", +"f` c #1E1E35", +"fa c #0F0F19", +"fb c #0D0D17", +"fc c #0B0B15", +"fd c #1B1B28", +"fe c #090913", +"ff c #262640", +"fg c #171724", +"fh c #151522", +"fi c #212131", +"fj c #2C2C49", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````dn`tdvahbhdebhbhecehawbs`x``````````````````````````````````````````````", +"```````````````````````````````````````````yaweffcerbpbpeqbmbmbbaneiahay`kcedqfh````````````````````````````````````````", +"````````````````````````````````````cpddeffcbbbsbpbpbrexexal`kabdgdfabaway`v`jcjbt`tcz``````````````````````````````````", +"````````````````````````````````dnddaler`kbpfdexbqaucw`nccdac``wcccucwfdcueqcrcreq`kbsddar``````````````````````````````", +"``````````````````````````````dqefcjbpdzexcuau`wbvekdt`gciekdtbiaxbubuffbvbcandoexfgbtdvbiez````````````````````````````", +"``````````````````````````drdzbgeqcldfbcbxdjdxbuazazcibcax`dci`qffb`biazazbuff`wcwbqc`bpeqbgcecz````````````````````````", +"````````````````````````fcehfedzcrabbyalexbuaze`dbdfdidicbaxdfbuavdffidbdbe`azbuffc``qfhcreq`xbhec``````````````````````", +"``````````````````````cz`yalahfgbqahdabjazacdbaacbfjbdauede`edciblcbenfjcbaadbac`zexdxcwbqbpanaybhec````````````````````", +"````````````````````boezayclbidtexeedididbaacbbdededajdhdhdhdhdhdtesajededbdcbfiae`ndxff`wdtaldadrbhas``````````````````", +"```````````````````tbherc``ndtdteeeeby`zcbfjedajdhdy`abnbvbzebebciavcwebdhajbierahah`qdxcu`wdtal`kdzbhcp````````````````", +"````````````````bxeh`yawdadtcuclazac`acbbdeddh`hch`n`ncschdcaicsdmdmcif`ch`hdhfjdidiffbyahdx`wczcubmbsczbx``````````````", +"``````````````asddbxbtcsda`wcsekac`acbbdajdhaich`favcicif`cgaq`jcb`navdm`fchaiekesbjeeesbmazffbcc``oeqbgctcn````````````", +"``````````````ctez`j`dexfgcvbccw`acbbdbzdhch`fbkelfidpbleycfejcfdc`ndpbnelbkfiesbdbnfiexdt`ubucv`kexcr`jefde````````````", +"````````````cyehdz`ybrbycsbubqeecbbdajdhch`fbkelaq`eafazakafaobnbheyeucscbelbacsb`badffidf`zdxbu`wdabrcufcctcy``````````", +"```````````matdv`jcrehczbbazaccsfjeddhai`fbabz`eejejblchbkeuekcjcoaoaoaiej`eclemfifienafbiaaacazekccexcrdfctaddl````````", +"``````````cydzfcehbrclclcae`dxbueddh`i`qbdbdbjaiaobnesembj`jdkdkdkdkedaoaoejbkcsbjchaidhedcbdbe`exfdaubrawbtfccy````````", +"````````asezalayaydaahanaz`udganbvcici`gf`dmajbnao`jazekavdkdkdkcgbjbn`naoemancdbj`fchdhedbdaabcdtffcwexcrehbtad`m``````", +"````````bxbofebbbierdw`kazdbcaemcidtdc`nelbvblaocobfeualcfcmcmazbmcmemebclbidmaibjbkchaidhbd`bbrahbu`wdt`ocjfece`l``````", +"````````fhbhbtdzbybcclahe``afj`icsazblfiafdhancodkeuazcmcmcmcmcmcfejcfdkdkbj`n`naqel`faidhedaxcie`bucvfdexdodfbhfh``````", +"``````bobxehayabda`jdaexaxaabdeudpbvf`bv`a`ccfcockbjf`ckbebebebecfalcmdkdkcocdbj`eel`fchdhedahbcdxc`fhcwexcrayalbobo````", +"```````xddbcay`yfhbidgc`eecifiajfidcdmcidmfiaocoalekf`eq`eagdsdsdsbeegcmdkcoclcw`eelbkch`hajdwee`nc`by`wbqcr`va`ddbo````", +"``````dfehfeanfheidgekaz`zbldmaj`hcaajeubn`haodkbj`kexcfegamam`pamdsbeegcmdkaocxbjelbkch`hajbv`qclfd`wbcdt`oeqbhdedf````", +"````etcybhaycqfhbhcsfdazaxcadiaj`hchchdm`gajdmdk`kagbeds`p`pepep`pamdsbecmdkao`neuelbkch`hajblahclca`kbndtbrdocqdrecet``", +"````bsfcbhd`dobrbrczbmazcacb`qca`hchbkeldmf`andkdkej`ramepduduepep`pambecmdkaoelblciebch`hajandtdibuekcccubrdoerctdebs``", +"`````sfheifbdzfddfexdxazdbcbeuazfich`felbhblbidkanbmeg`pepdududuep`pambeegdkao`cavavblekdhaj`zclerbcdiciecbrcudvezat`s``", +"`````yad`d`jaybrczcsby`zdbca`bdp`gef`felelavcgcobnbzam`pepdududuep`pambeegcoclchcddmdpcw`zeddidweedpc`aney`vbsdzez`sbs``", +"````ezadcq`jdobrdtdfcvby`kahcwemajcwbabkelcsf`aocseq`ram`pepepepep`pdsbebmcbesbnbkci`nazfiedfjaafieec`dfahbr`vfcbhezfb``", +"````ezadbherdo`odtbqffbb`nahcicicdbwbz`felbvavejcb`kdsds`p`p`pep`pamdsen`nancldpcici`cbafiedcb`aacexdmczdt`obbaebbec`y``", +"````ez`tbhdzfc`obqcwffah`nciekerehfiai`fcsanek`eaoekef`rdsbedsamamdsbe`nem`eaqelbabaaidhedcaddaxe`axc`cubq`oaecjdzewdn``", +"`````yct`xfcbtcrexaucvbuekeeesf`crdh`hbibv`ffiaq`eekbh`jcg`e`rdsbeegcmekblbaelbk`fch`hdhedfjaadbazbuda`vexcrabadct`sfa``", +"`````sfh`sahaydzexdt`wffazdteebcbaeddh`gcibdbkelcxbjevdkaiejeqegcmdkejcgcsekbk`fchaidhedbdcb`aaccabbcwcuexcr`jbsehfhet``", +"````cneccedrbyczbrbqcwffbu`nazemddbdajebcwci`fbk`qbnafaicbdweiejej`eelelahbjfichaidhajbdfjcadbazax`v`na`brdoahcqceasas``", +"````arboddctekdgbpexau`wbucrerffbifjedajdfcieb`fahf`ek`f`h`gaaelelelelbk`fey`qaidhajedfjcbdbacazbu`wdadj`obmez`x`sctfb``", +"````eodqaddffeay`jexdt`wfffdeeexdicbbdedajcs`haibz`q`gemb`bjbkbkchdb`f`fchaicx`iajedbdcb`aac`zbuffcyei`ncreqa`dzdzasdq``", +"````arcnfhdrdzalbp`oexau`w`qdm`qax`acbfjedcsafdh`hdp`hcieubdes`fchchchai`hdhdhdififjcb`aace`axfd`wdgbiabay`jbpfccpezap``", +"``````dqecctawaydzcrexdtbcccahfde`db`acbahdieiajdhdhdh`heiemf`aiai`hdhdhdhajeddmciee`adbe`azbucvcwbhaybbancjef`ydr`m````", +"``````arbxadehaydzcj`ofhcreiee`zaze`ac`aercidibdedajajdhdhdmcbdhdhdhajajexbgcsdwciahace`azbucv`wdtcrayawfccqbhctbsas````", +"``````arezfhddaefcaycr`obbekbndfbuazfdacaccsdpciazfi`uededey`ifiededbdbdfjdfdicxaxeebububuax`wauex`oayaycjalddboezcp````", +"````````fadqadbofcbteqcrdf`ndf`wcvbuazbididibjf`ahcafjfjfjfidbeifjfjfjcbcbaa`ddbacazdpdaexbxaucsbrcrbhdebg`dadetfa``````", +"````````ctasfhdqd`fc`vdoekay`vau`wcvbuc`eebc`z`zdb`a`acbcb`beeahcbcb`a`adb`zace`azbu`wdtccdaabbccrcqa`deefddfhfbap``````", +"````````eofacyadawctbgeq`xeifdbqaucyfgeedabuazaze`acacdbfiddblbleedbacac`zb``zbudfffbvczdg`neqc`docja`ezceadcydnap``````", +"``````````dqdqecctctczcjeqeafgbrexexc`ccciffbubuazazazdddf`qesercsazazazfdcx`gbbaubccwdt`vcualaleqcjfcezeiecezdq````````", +"``````````eobs`xctdrctbgeraeeacrbrexabbicz`wcvffffbubudf`zaneecebqbububudxfddx`wcwaudtexbrcrah`jerbgctecfhcpbsar````````", +"````````````bofaezdeecbhdvfeaw`vcr`ocjaya`cucw`w`wcvcvccerdfei`w`jffcvcv`w`wcwaudtexex`ocrdoeafcbgcqdzdrasareo``````````", +"``````````````dq`ycpbs`sbhanbs`kef`qcrayd`exdtdtaucwcwer`ndfccbc`w`wcwcwaudtdtexex`ocr`qahekczdqbh`ybocpdnar````````````", +"``````````````apasezcydeddfhcta`eaeqdoawaebbfgcuexbqababf`ek`kaudtdtdtbqexexexdafgcrdofcdfeialdzddcycp`tapap````````````", +"````````````````bo`tbobodeezfedfa`cj`jeqayeiaybnbpbrbydzeifhcydjexexexbrbp`ocrdzdoeq`jdd`yfcfafcdqcyezdldl``````````````", +"``````````````````cn`tezcyatctddbhal`kcj`jbsayal`qddbba``y`o`o`ocrcrcrcr`qdoaybt`jcj`kalfebofbcpctez`teo````````````````", +"````````````````````ewfbdqdqcpfhddehefalcqdrehefeq`ya``vdododododobmeqeqeqcqfabpcqalef`sdebxbxbocpfbew``````````````````", +"``````````````````````dndq`s`xdffhaddd`tctecczbpcjdzdzdv`jdveh`j`j`j`jbpalfcbgalcyeh`satdrfcbsdnascn````````````````````", +"````````````````````````ardlfafbcpfbbtbo`yctbhbhasa``sbg`k`k`k`k`kbgbgalefbhbhceetdfbodfdr`metdrcp``````````````````````", +"``````````````````````````dndrewfadnboecfhadeidddrdzfcbhbhbhezbhbhbh`dehceddeiboctctdndqdndneoap````````````````````````", +"``````````````````````````````boewdq`lez`xcyecfhdeadfcbsecctdrdd`sdqadaddefheccybo`y`mareoar````````````````````````````", +"````````````````````````````````apaparfbfa`ycz`xcyetcpcpcpatdqec`sececcycy`xdnasfadrdleoar``````````````````````````````", +"````````````````````````````````````eoarbocnfbfafaasdrarfcbobsczczczez`yfafafbdqdreoar``````````````````````````````````", +"``````````````````````````````````````````apbodretcncndqarar`mbsasfbasdqcndreoap````````````````````````````````````````", +"````````````````````````````````````````````````apdneoeoeoarbocncnboapdnap``````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue11.xpm b/hacks/images/bubbles/blue11.xpm new file mode 100644 index 00000000..c39e4f1c --- /dev/null +++ b/hacks/images/bubbles/blue11.xpm @@ -0,0 +1,254 @@ +/* XPM */ +static char *blue11[] = { +/* width height ncolors chars_per_pixel */ +"72 72 175 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #1B1B2B", +"`c c #282845", +"`d c #191929", +"`e c #323252", +"`f c #303050", +"`g c #111121", +"`h c #2E2E4E", +"`i c #0F0F1F", +"`j c #1D1D30", +"`k c #1B1B2E", +"`l c #0C0C12", +"`m c #0A0A10", +"`n c #17172A", +"`o c #212137", +"`p c #767691", +"`q c #1F1F35", +"`r c #2F2F48", +"`s c #101019", +"`t c #0E0E17", +"`u c #272740", +"`v c #181824", +"`w c #25253E", +"`x c #21213A", +"`y c #12121E", +"`z c #10101C", +"a` c #20202F", +"aa c #0E0E1A", +"ab c #2B2B47", +"ac c #0C0C18", +"ad c #292945", +"ae c #161625", +"af c #141423", +"ag c #242436", +"ah c #313150", +"ai c #121221", +"aj c #2F2F4E", +"ak c #2D2D4C", +"al c #2B2B4A", +"am c #1A1A2C", +"an c #5C5C7A", +"ao c #161628", +"ap c #333355", +"aq c #07070C", +"ar c #313153", +"as c #05050A", +"at c #0D0D15", +"au c #07070F", +"av c #24243C", +"aw c #202038", +"ax c #0D0D18", +"ay c #1D1D2B", +"az c #0B0B16", +"b` c #282843", +"ba c #262641", +"bb c #232334", +"bc c #11111F", +"bd c #0F0F1D", +"be c #2C2C4A", +"bf c #3C3C5D", +"bg c #2A2A48", +"bh c #1B1B2C", +"bi c #19192A", +"bj c #151526", +"bk c #131324", +"bl c #303051", +"bm c #111122", +"bn c #1F1F33", +"bo c #19192D", +"bp c #08080F", +"bq c #161620", +"br c #23233A", +"bs c #212138", +"bt c #0E0E18", +"bu c #0A0A14", +"bv c #272741", +"bw c #25253F", +"bx c #23233D", +"by c #12121F", +"bz c #10101D", +"c` c #202030", +"ca c #0E0E1B", +"cb c #1E1E2E", +"cc c #2B2B48", +"cd c #0C0C19", +"ce c #292946", +"cf c #181828", +"cg c #28283B", +"ch c #262639", +"ci c #2F2F4F", +"cj c #101020", +"ck c #1C1C2F", +"cl c #2A2A40", +"cm c #18182B", +"cn c #353558", +"co c #09090F", +"cp c #333356", +"cq c #07070D", +"cr c #15151E", +"cs c #202036", +"ct c #1C1C32", +"cu c #090912", +"cv c #191925", +"cw c #26263F", +"cx c #24243D", +"cy c #22223B", +"cz c #13131F", +"d` c #11111D", +"da c #0F0F1B", +"db c #0D0D19", +"dc c #2A2A46", +"dd c #262642", +"de c #171726", +"df c #151524", +"dg c #131322", +"dh c #111120", +"di c #2E2E4D", +"dj c #0F0F1E", +"dk c #1D1D2F", +"dl c #343456", +"dm c #08080D", +"dn c #151527", +"do c #06060B", +"dp c #1F1F34", +"dq c #1B1B30", +"dr c #0C0C14", +"ds c #0A0A12", +"dt c #494967", +"du c #23233B", +"dv c white", +"dw c #14141F", +"dx c #212139", +"dy c #1E1E2C", +"dz c #2B2B46", +"e` c #0C0C17", +"ea c #292944", +"eb c #0A0A15", +"ec c #262637", +"ed c #141422", +"ee c #2D2D4B", +"ef c #0E0E1C", +"eg c #1A1A2B", +"eh c #373758", +"ei c #181829", +"ej c #161627", +"ek c #333354", +"el c #141425", +"em c #313152", +"en c #121223", +"eo c #222236", +"ep c #030307", +"eq c #BCBCD7", +"er c #1E1E32", +"es c #1C1C30", +"et c #1A1A2E", +"eu c #0B0B12", +"ev c #18182C", +"ew c #28283F", +"ex c #090910", +"ey c #222239", +"ez c #202037", +"f` c #11111B", +"fa c #1E1E35", +"fb c #0F0F19", +"fc c #0D0D17", +"fd c #0B0B15", +"fe c #1B1B28", +"ff c #090913", +"fg c #262640", +"fh c #171724", +"fi c #151522", +"fj c #212131", +"fk c #2E2E4B", +"fl c #2C2C49", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````bpcudf`tdeded`aedfdrau````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````cqd`e`fdbh`kckck`yesesckckbzbiegaobped````````````````````````````````````````````````````", +"`````````````````````````````````````````````````ydeeidack`jficv`vdecscsdbazaccmaadgaf`jckdacuf`ed``````````````````````````````````````````````", +"````````````````````````````````````````````ae`dbhfdcmaoczcs`oeyeyeyfee`bzamazaaesacbiazczbnerckdgdfae``````````````````````````````````````````", +"````````````````````````````````````````ds`ybh`j`k`vbq`yeyduavavbddbcadbca`wdhaabravfedudpej`ocseraabubiau``````````````````````````````````````", +"````````````````````````````````````btcfbh`jfbaa`oeycvav`w`wamezaidgdbbjbselfebvbvfgcw`w`wcmbzet`o`vaaffbhde`t``````````````````````````````````", +"``````````````````````````````````dregckerdbaaeyfiaccxcwbvbvfeb`cabcbz`qduaielamdfcab`bvbvfeeyfhduey`yejerckcfej````````````````````````````````", +"``````````````````````````````bpdgbh`jdpfedbelctd`aedyb`b`eaaf`qbdbj`aaybnctelcxbvayadeab`b`bvfg`wfeetaadwdp`jbccfcz````````````````````````````", +"````````````````````````````fccuaxazda`o`odbcabja`b`b`addc`afj`adjbjfl`devbw`ndg`aafab`adcadb`b`bvcxcaey`o`o`qaobheied``````````````````````````", +"``````````````````````````ed`zfb`vesbhdudxelcmaib`addc`accflbebeeeeeeebbeeeeao`idjbebeflcc`adccbdecsdxbwcxdu`vaie`e``dfi````````````````````````", +"````````````````````````bpcufibier`qduaiaielaiefdc`accflbeeeeeakdidididididibjao`nakeeeebeflcca`af`kbdbvfi`wductazebaa`dat``````````````````````", +"``````````````````````auei`kbcfb`jdudbdbcacjcjdeccflbeeeakdia`faevenaoeab`brajcxbeawdidiakfldjaodhefdjfedhfe`w`oesdb`z`keids````````````````````", +"````````````````````czcfbhaxcsaidufecacxdgad`accfleeakdidiajam`ncjaodncjboevelcydqet`xajdidibhevbk`i`qbddecmfg`wfe`kbq`de``zcz``````````````````", +"``````````````````atdeamca`jazcacx`vbzb`ad`accbeeeakdiajci`fajcybxccctcmagbhawet`gbkbw`fciajdib`bkdjcjdjefb`bvcw`bdbbsdp`jamcud`````````````````", +"```````````````````tbibi`jacd`cxdycabcad`accbeeedidiajci`fcievcjbmbmee`e`e`ebgaw`gfaccbl`fci`wawfab`bkboevaib`bv`wboaa`obnesbi`s````````````````", +"````````````````cqeiff`vcsey`v`waidhbwayccbeeedi`hci`f`fememeablbmbmembrekbbetdqaoctevbiem`faocjdqfaelevezbv`bbnbv`wcseycsbq`kdaed``````````````", +"```````````````zcuegbuaxbsbzaofgeoa`efavfleedidici`fblemem`e`ech`hbmenchap`jagbednbmctccememccbabaagbjaw`dela`cbbvfgfe`jbsdpbuamat`m````````````", +"``````````````atbiffercsctavcsbvb`cbetflbeakdiaj`fbbdnem`eekek`n`nfab`cmelcmcpapapapcgek`eemciajeldkageaa`cbabadb`bvaieleycsbqbdd`fi````````````", +"````````````dsedame`debs`qaidbb`adfjbwbeeediajb`fa`hejc`ekekagevfaceaoecdldldlcpcpapapekek`edd`nbjciajdieecbccdcadbzduesdubs`qaae`de`y``````````", +"````````````fibtffebcmesdbezfeb`adelet`dbhcteldnbmencebmekapdncyenevctagdldldleldn`jamapcgbbevcidn`fci`hdieeflabadeyedfeaveyfh`kaicufi``````````", +"``````````drdeamfdejazaidb`nb`eaaybwbabmen`ncy`cecalenceapcpdndndqetfacncncnecdnecbockcgagb`bketfadzciajdieebecccjduayfg`wdubsbqdeeide`t````````", +"``````````eddefdcabdazducsbdb`ad`wejcjendqb`babbembgawelapcpbe`ecscncncncncnclcncgbmfkclbkcybmbaaobl`fcidiakbebbfacjb`bv`waveycs`je`cfed````````", +"`````````mcqbiffamazaicmcmeyb`dcccfl`icjdxfacjecagemdqapcpdlevccagcncncncncncncgcnecdldlch`haofjarem`fciajdieecbawcbb`bvcwaveycsckaibifbfd``````", +"`````````y`sdsazazer`jetdb`kerdcccbedubmdcbv`nfaenbkelapcpamelbwelehcgbfbfbfbfaocgcndldlcp`jaoee`eembl`fa`dieedgelbdeaefdycxbr`obqfdamde`y``````", +"````````dgcfdabudgacdkcsdbcjej`nb`beakbhevel`nbkaodncgcpdlenevbkb``rclahdtdtbfbf`rcncndldlcpaodnagembl`fcidiakdgbodqdgetefavdubs`qacbycfdg``````", +"``````btfdeiaafd`zaxd`cm`wet`nctbddjakdicmdi`n`genawapcpdlenelcmeyahahdtdtanandtbfbfcndldlcpdnbmcgembl`fcidiakezbdfgdgfebzfiaveycsbqe`f`fi`m````", +"```````zcqbiffbjerdbduca`qb`adaidcceakdicicjbxdubmarcmcpdlcmbvewdzandt`panananandtbfehcndlcpewdnbmemem`fcidiakcjaiefdhayer`qaveycserbqcuae`l````", +"```````ybpbidadw`jeydgdbfeb``wefbb`nakdiciagccejenctcecpdlcsehehehan`peqeqeq`p`pandtbfcndlcpagbxboecbl`fcidiakdgcfdueyayeserbyeycsercrcud``y````", +"``````by`tcuda`v`oey`naybnb`ad`wea`icbdici`fblemdnaoenekdlclekcl`p`peqdvdveqeqeq`pdtbfehdlcpcgbwbmcydk`fcidiakdjbaef`netelcacaey`obnesazbpby````", +"````asczdeaebubq`vdwef`qfeb`ad`acccyevejci`fblemaoen`hapdlcmerdtan`pdvdvdvdvdveq`panbfehdlapewevet`xb`fjagdiakegbkefdxaidgbkbjey`obhes`tbtczeu``", +"````atfbdee``jeb`ofeejfaay`dad`acc`qbkbkeaciblemfjbwbgapdzdleranan`pdvdvdvdvdveq`panbfehdlapcmcycybmbvcyetdiak`bduezdncmdhdbesey`oafbie``tfbat``", +"`````td`de`t`jcr`oeydkdbcffeayayfjdcdj`xet`g`fememendnapdib`csehdt`peqdvdvdveqeq`pdtbfehdlbkblakawfa`gbadgdieebedgefbdbodh`wdhax`oebdsatf`d``t``", +"````btbydeamesbncseyavayfgdebvaicj`n`nctaddx`fblem`nbmekec`famcgan`peqeqeqeqeq`pandtbfckenbmbmdncicjcjctawc`eeflccdccw`g`g`ndbdacsaxckcudefbds``", +"````btbpdeamckercseydufefgcb`n`gefcjdjadetcyci`fagad`gb`apce`kbf`rdtan`p`p`p`pandtbf`j`abkekenejelcj`cabdiakbeflabdceabodhbddueycsbidgegbpcqas``", +"`````md``scre`bccseydu`wfgaiduefcjdgesdgew`hci`fctbmcj`eekagelbibbbfdtbfdtanandtbfbf`netcm`eemembbeceo`hdieecb`db`adb`bccaaydueyazebckcucudsdm``", +"````eucqf`f`fffddbbsbrcxcwbvendhdncmbvfjakdiaj`gcicx`nem`eekaocmbn`e`rch`rbfdtbfehcnenboctemembl`fciajdiakeeflbrdcadb`bvcacabrbsfbdfaxcraeexeu``", +"````asdr`sfbaie`bd`oeyav`wfga`cacjcjaicbb`didicccjbwaiemembmenbbdlbhfkajcgbfehcndlapbbbwdnembl`fciajdidieebeccabdceab`fe`ncvey`ocvbubtbi`se`dr``", +"````dscqae`dbudsebaaeydu`wfgbvcfeyezefdgbeakdieecjbmamblbbdnevbbfkc`cybxaodldlapek`eemb`enc``fcici`hdiakbeflccdcadb`dhdectbyey`odpdbe``daecqco``", +"````epd`dfcfdgebdbebeyducxbwbvb`aebobk`gbeeeakagfgelb``fblelbgdnemenfa`xej`e`e`eemem`ffjccdg`waj`hdiakeebecc`udceab`dyay`kaceycserafamcf`tdreu``", +"````dof`eddefdejaiam`oeyav`wfgbva`dudccjccbeeeakejbk`ici`fddenbwfaevcjdgememememewblbl`f`fbxfa`hdiakeebeccabdcadb`bvfgcvdjfe`o`qerd`at`scqcqas``", +"``````fbbpdedgdebibz`veyducxbwbvbwcaeyefccflbeeeakbeaoajcibh`qcjelcjbxeiblblblec`f`f`fcicicb`gecakeebeflccdcaddya`bvbwboejesbhdp`je`e`dscqfb````", +"``````btcuaecufdfcelcsbseyav`wfgdjfgbv`d`accflbeeebjeedi`hajajawbmbmfacjen`f`fciciciciaj`hdidneleebeflcc`aadeaayayfgavdhbjbjeleresbjfdau`tbt````", +"``````atf`ficufdaabu`ycseyducxdyejfeafeadc`accccfjetfaakdidiecagcbfaevbkctfjciajaj`hdididiakelbkflcbcc`adceab`bvfg`wcvdbdbazd`buckf`dgd``yat````", +"``````ds`leddeedfdbuazcs`ofedacd`qbnfeb`eadc`accb`djbveeeeakdididiavdq`ib`didididididiakeeeebj`gdjfafjdceab`bvfgcw`wdueyazdhelaobhbiaefd`zds````", +"````````asczdff``tckdf`vcscvazacducdfebvb`eaaddcceetcyezbjeeeeeeakakc`aoakdiakakakeeeeee`dccctdxaocjdheab`bvbvcw`wavbrbhdbe`ckbiamcfdr`zfb``````", +"````````dod``yde`ybjbcbt`q`ocve`dhcxaibvbvb`cbayducydxdqbmctbbfjbeeeeecxdjeleeeebebebeflccceaicya`a`cj`qfjfeay`wavduey`oebbudgbhbidefdd`do``````", +"````````bp`sdraecfdafcejercsaiazesca`wcwfgbva`dudjefefcyctaicbccflflbefjdcbobeflflccccccabfjdyadadb`bo`nbo`wbyaocm`v`ocsbid`ckegcfaeeu`sep``````", +"``````````fc`zeddedacuffbqdpczcaerduav`wcwfgbhcjdqdgbzay`day`aabccccccdgefdxccccccab`a`adcfjadeab`b`dyeddbdbbzbzdbczcsbqelffam`ddeedf`fc````````", +"``````````ep`satdfcubdcuaferdpaz`odpduav`wbwdgdbaib`b`eaadaddcdcdcdcaydhefdxdjdcdcdcdcay`gelbhb`bvbvfgcvbs`kbd`jaibddpbubhaxbidedfczdseu````````", +"````````````fcdoedafejcudg`jercmesbseyducdcmctcabdbvbvb`b`b`eaeaadayfjbocjbdfaafadeaeaa`cmbdbvcfbjai`wedczda`jbze`fier`jaidrcfaeedd`co``````````", +"````````````as`lbycqdabpbick`jdweb`v`oeyfhdhbidbdbcwfgbvbvbvb`b`bcbkbzeybjefbddyb`b`b`ay`kbjbcbdbifiavdubrey`obtesdw`jcfe`dscufibyfbds``````````", +"``````````````ateuczdfbpcuamck`jbi`ycs`oey`zacdgcz`w`wcwfgfgbvbvcbaiaiaocadhfeaybvbvbv`obhdy`d`wcxavdueyey`ocsctbce`ckcfbudacufdfdco````````````", +"``````````````asbtd`bpededbiamcmbubj`vcscsbsdbcaaacvcx`w`w`wcwcwdyeyeldgejcmfefgfgcwcw`w`w`wcxavdubreybscscsdpbze`crambue`bybydoaqas````````````", +"````````````````eufb`y`sfdf`bifdaxbhacerdpcsfiazcabrduduavcxcx`wbycs`qdgbzbjed`w`w`wcxcxavdudubreybs`ocsdpbtaidbe`ambidfaubyeufdaq``````````````", +"``````````````````drfbdscqaedebideffaabuerdpfdbzaicafecfbrdudufhfhdpacbscsavavavavavdudubreyey`zbqcscsdpbubzbudwamcrdedsfd`ycqep````````````````", +"``````````````````dmat`zdobyaedefdcudgfbcr`jeraxeldb`kdbczeyeyazbjbd`vfielca`vbrbreyeybnbs`o`oebcvdperbqffacdgfcdr`saeed`s`zaqep````````````````", +"````````````````````coatdo`yeddfczbpde`d`kck`jer`v`zaibdescs`bamdbercvfi`veyeybsbs`ocvcscscsebazerer`jckdgfddrf`aue`dr`y`zatep``````````````````", +"``````````````````````exat`s`ydsbtcufibiegbh`kck`jaxbzaieldpbheiacbjcscscscscscscscs`qdpdpfh`jbt`jck`kbhegcuejfcdse`bp`satbp````````````````````", +"````````````````````````exdr`ldoaucqfidecfbiegbhcrcfao`y`jer`zebazdpdpdpdpdpdpdpbnerereregf`debqcrbhegbibzdfbybtcqcq`tatex``````````````````````", +"``````````````````````````coaqatf`byeddfaedeeibidgcubyfdckckfdbuff`j`jf`eicf`j`j`j`j`jaacadrbhf`e`bieibpaieucuexdododmco````````````````````````", +"````````````````````````````epeubtcq`yczbp`sbpbpdsfdaeegambheiff`sckckckckckckck`k`kf`buamegbi`dcfdedfdse`bpdofccqcodm``````````````````````````", +"``````````````````````````````aqeuatdocqfbds`tdfaededecfeiaacucregamamamamamamamegegbibieicfdedsbtdsbpbpcqbt`lasasaq````````````````````````````", +"``````````````````````````````````coepcqbpcq`yczedfidfaedeaecubpdeeieif`cucueieicfcfdededeaeatbpbybpdobpfdasdoep````````````````````````````````", +"````````````````````````````````````epaqasdofbf``ybyczedfifidfcucubpcubpeufificu`saedf`sfiedczdrcudo`mascq`maq``````````````````````````````````", +"````````````````````````````````````````epasdr`tfb`zf``ybyczeubpdscqaubtdred`tedededczczbyds`meufb`tasbpep``````````````````````````````````````", +"````````````````````````````````````````````asepaqdocofbfb`zfbbtdobpcq`zbt`y`y`yd`d`f``zfbfb`tateuepaq``````````````````````````````````````````", +"````````````````````````````````````````````````dodoepeudrat`tdodseudoas`mfbfbfbfbbt`tatdreudsdoaq``````````````````````````````````````````````", +"``````````````````````````````````````````````````````aqasepepasepcoasepexdrdreueuds`mepdoaq````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````epepepepepdoaqaqasepaq````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue2.xpm b/hacks/images/bubbles/blue2.xpm new file mode 100644 index 00000000..94152167 --- /dev/null +++ b/hacks/images/bubbles/blue2.xpm @@ -0,0 +1,89 @@ +/* XPM */ +static char *blue2[] = { +/* width height ncolors chars_per_pixel */ +"12 12 70 2", +/* colors */ +"`` c None", +"`a c #323252", +"`b c #303050", +"`c c #0F0F1F", +"`d c #1B1B2E", +"`e c #17172A", +"`f c #1F1F35", +"`g c #181824", +"`h c #25253E", +"`i c #10101C", +"`j c #20202F", +"`k c #0E0E1A", +"`l c #292945", +"`m c #141423", +"`n c #242436", +"`o c #2D2D4C", +"`p c #333355", +"`q c #313153", +"`r c #0D0D15", +"`s c #24243C", +"`t c #262641", +"`u c #232334", +"`v c #3C3C5D", +"`w c #19192A", +"`x c #303051", +"`y c #111122", +"`z c #1F1F33", +"a` c #08080F", +"aa c #212138", +"ab c #12121F", +"ac c #0E0E1B", +"ad c #1E1E2E", +"ae c #2B2B48", +"af c #2F2F4F", +"ag c #1C1C2F", +"ah c #18182B", +"ai c #353558", +"aj c #15151E", +"ak c #1C1C32", +"al c #26263F", +"am c #13131F", +"an c #0F0F1B", +"ao c #2A2A46", +"ap c #131322", +"aq c #2E2E4D", +"ar c #0F0F1E", +"as c #343456", +"at c #151527", +"au c #1F1F34", +"av c #0C0C14", +"aw c #494967", +"ax c #23233B", +"ay c white", +"az c #0C0C17", +"b` c #141422", +"ba c #2D2D4B", +"bb c #0E0E1C", +"bc c #161627", +"bd c #333354", +"be c #141425", +"bf c #1E1E32", +"bg c #1C1C30", +"bh c #0B0B12", +"bi c #18182C", +"bj c #090910", +"bk c #222239", +"bl c #0F0F19", +"bm c #1B1B28", +"bn c #262640", +"bo c #151522", +/* pixels */ +"`````````d`sacbmbf``````", +"````a`axaobaaqba`max`r``", +"````aabbaf`a`pak`t`jaa``", +"```wah`c`nbiaias`qbaal`w", +"``an`zadatbday`v`y`obebg", +"``azbnbgakbeaw`e`uadacag", +"``apaxbk`o`f`x`b`o`lbcaz", +"``avbf`haradaoae`lab`wbh", +"````b``g`kalbcalaxauaz``", +"````bjboaj`iaubfajabbj``", +"````````blbhavambl``````", +"````````````````````````" +}; diff --git a/hacks/images/bubbles/blue3.xpm b/hacks/images/bubbles/blue3.xpm new file mode 100644 index 00000000..b38a8d44 --- /dev/null +++ b/hacks/images/bubbles/blue3.xpm @@ -0,0 +1,103 @@ +/* XPM */ +static char *blue3[] = { +/* width height ncolors chars_per_pixel */ +"14 14 82 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #282845", +"`c c #111121", +"`d c #2E2E4E", +"`e c #1B1B2E", +"`f c #0A0A10", +"`g c #17172A", +"`h c #101019", +"`i c #181824", +"`j c #21213A", +"`k c #10101C", +"`l c #20202F", +"`m c #0C0C18", +"`n c #161628", +"`o c #07070F", +"`p c #24243C", +"`q c #0B0B16", +"`r c #282843", +"`s c #11111F", +"`t c #0F0F1D", +"`u c #1B1B2C", +"`v c #19192A", +"`w c #151526", +"`x c #303051", +"`y c #111122", +"`z c #19192D", +"a` c #23233A", +"aa c #212138", +"ab c #0E0E18", +"ac c #0A0A14", +"ad c #272741", +"ae c #23233D", +"af c #202030", +"ag c #1E1E2E", +"ah c #2B2B48", +"ai c #181828", +"aj c #28283B", +"ak c #2F2F4F", +"al c #2D2D4D", +"am c #1C1C2F", +"an c #18182B", +"ao c #353558", +"ap c #15151E", +"aq c #191925", +"ar c #24243D", +"as c #13131F", +"at c #11111D", +"au c #0D0D19", +"av c #262642", +"aw c #151524", +"ax c #2E2E4D", +"ay c #343456", +"az c #06060B", +"b` c #0C0C14", +"ba c #494967", +"bb c #23233B", +"bc c white", +"bd c #0C0C17", +"be c #292944", +"bf c #0A0A15", +"bg c #2D2D4B", +"bh c #0E0E1C", +"bi c #1A1A2B", +"bj c #373758", +"bk c #181829", +"bl c #161627", +"bm c #141425", +"bn c #313152", +"bo c #121223", +"bp c #1E1E32", +"bq c #1C1C30", +"br c #18182C", +"bs c #222239", +"bt c #11111B", +"bu c #1E1E35", +"bv c #0F0F19", +"bw c #0D0D17", +"bx c #0B0B15", +"by c #1B1B28", +"bz c #262640", +"c` c #2C2C49", +/* pixels */ +"``````````awbsau`mbp````````", +"``````bdbhbe`wbu`lbe`p`w````", +"`````var`aaxbmbn`caxbr`tb```", +"````aqbeblbr`baybnboax`lat``", +"``ai`pbq`g`ubmbaao`yak`g`pai", +"```s`tahakalbabcbaajafbr`tbw", +"``ap`p`cagav`vbabjbnax`l`i`n", +"``aiaaadc``d`jbn`x`cc`adai`h", +"``as`e`n`r`zagbzbgae`r`pacbx", +"````as`qanad`r`n`rag`pbf`h``", +"````bvbkbpbqaubba`byabbtbv``", +"``````azaw`sauabambi`o`f````", +"``````````abbw`katab````````", +"````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue4.xpm b/hacks/images/bubbles/blue4.xpm new file mode 100644 index 00000000..bb0843d0 --- /dev/null +++ b/hacks/images/bubbles/blue4.xpm @@ -0,0 +1,157 @@ +/* XPM */ +static char *blue4[] = { +/* width height ncolors chars_per_pixel */ +"20 20 130 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #282845", +"`c c #323252", +"`d c #303050", +"`e c #111121", +"`f c #2E2E4E", +"`g c #0F0F1F", +"`h c #1D1D30", +"`i c #1B1B2E", +"`j c #0C0C12", +"`k c #0A0A10", +"`l c #17172A", +"`m c #212137", +"`n c #767691", +"`o c #1F1F35", +"`p c #2F2F48", +"`q c #101019", +"`r c #0E0E17", +"`s c #181824", +"`t c #25253E", +"`u c #12121E", +"`v c #10101C", +"`w c #20202F", +"`x c #0E0E1A", +"`y c #0C0C18", +"`z c #292945", +"a` c #161625", +"aa c #141423", +"ab c #121221", +"ac c #2F2F4E", +"ad c #2D2D4C", +"ae c #1A1A2C", +"af c #5C5C7A", +"ag c #161628", +"ah c #333355", +"ai c #07070C", +"aj c #313153", +"ak c #05050A", +"al c #0D0D15", +"am c #24243C", +"an c #202038", +"ao c #1D1D2B", +"ap c #0B0B16", +"aq c #282843", +"ar c #11111F", +"as c #2C2C4A", +"at c #3C3C5D", +"au c #1B1B2C", +"av c #19192A", +"aw c #131324", +"ax c #303051", +"ay c #111122", +"az c #1F1F33", +"b` c #19192D", +"ba c #08080F", +"bb c #161620", +"bc c #23233A", +"bd c #0E0E18", +"be c #0A0A14", +"bf c #272741", +"bg c #25253F", +"bh c #10101D", +"bi c #1E1E2E", +"bj c #2B2B48", +"bk c #0C0C19", +"bl c #292946", +"bm c #2F2F4F", +"bn c #101020", +"bo c #1C1C2F", +"bp c #2A2A40", +"bq c #18182B", +"br c #353558", +"bs c #09090F", +"bt c #07070D", +"bu c #15151E", +"bv c #1C1C32", +"bw c #090912", +"bx c #191925", +"by c #24243D", +"bz c #22223B", +"c` c #13131F", +"ca c #11111D", +"cb c #0D0D19", +"cc c #2A2A46", +"cd c #171726", +"ce c #151524", +"cf c #131322", +"cg c #0F0F1E", +"ch c #343456", +"ci c #08080D", +"cj c #151527", +"ck c #1F1F34", +"cl c #1B1B30", +"cm c #0C0C14", +"cn c #0A0A12", +"co c #494967", +"cp c #23233B", +"cq c white", +"cr c #14141F", +"cs c #1E1E2C", +"ct c #0C0C17", +"cu c #292944", +"cv c #141422", +"cw c #2D2D4B", +"cx c #0E0E1C", +"cy c #373758", +"cz c #181829", +"d` c #161627", +"da c #141425", +"db c #313152", +"dc c #121223", +"dd c #030307", +"de c #BCBCD7", +"df c #1C1C30", +"dg c #1A1A2E", +"dh c #0B0B12", +"di c #18182C", +"dj c #090910", +"dk c #222239", +"dl c #202037", +"dm c #11111B", +"dn c #1E1E35", +"do c #0D0D17", +"dp c #0B0B15", +"dq c #1B1B28", +"dr c #262640", +"ds c #171724", +"dt c #151522", +"du c #2C2C49", +/* pixels */ +"```````````````vdpbbazd``idt````````````", +"``````````cmbbbxbg`ecpbfbgckbedm````````", +"`````````vdscb`zbjamcwbjbj`zcsbbav``````", +"``````czcbbq`acwbmbvaccjbmdudrcsbxca````", +"````c``vbvcxad`dajaqahdlbjbvcf`w`tbxc```", +"````aecbaqagbncjahdachawahblbmascpdkbe``", +"``baap`haodidn`bbpbpataechaw`dcwcsbyapba", +"``c`bubvaoadbmad`icodeafbr`laxadbqb`ckcv", +"``a`apbvcccl`danb``ncq`ncybmclcwcxagbd`q", +"```rdpby`ldfacagah`pcocodcdbacbicubxaadj", +"``cvbhbcbfdcadbn`oacd``cabbmadbiao`xabal", +"``bsct`m`t`objbv`fbndgbm`fcgbjcu`t`ybbdm", +"``akcdaparcfdqbvaqcw`gcwdubzbfaodkapcdbt", +"````c`bw`ubcdsbfcuccaycc`wbfbg`lckdmc```", +"````bacecr`sbobx`tbkd`dr`tamdkckaucndd``", +"```````rcecf`hd`bbctc`dkbbct`hdpcmci````", +"````````cmcfcdcvbocrcz`haeae`qdpal``````", +"``````````ba`jc`cebdcncmcec``kak````````", +"``````````````aidhcm`kdobsai````````````", +"````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue5.xpm b/hacks/images/bubbles/blue5.xpm new file mode 100644 index 00000000..e337885f --- /dev/null +++ b/hacks/images/bubbles/blue5.xpm @@ -0,0 +1,170 @@ +/* XPM */ +static char *blue5[] = { +/* width height ncolors chars_per_pixel */ +"24 24 139 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #323252", +"`c c #303050", +"`d c #111121", +"`e c #2E2E4E", +"`f c #0F0F1F", +"`g c #1D1D30", +"`h c #1B1B2E", +"`i c #0C0C12", +"`j c #0A0A10", +"`k c #17172A", +"`l c #212137", +"`m c #767691", +"`n c #1F1F35", +"`o c #101019", +"`p c #181824", +"`q c #25253E", +"`r c #12121E", +"`s c #10101C", +"`t c #20202F", +"`u c #0E0E1A", +"`v c #292945", +"`w c #161625", +"`x c #141423", +"`y c #242436", +"`z c #313150", +"a` c #121221", +"aa c #2F2F4E", +"ab c #2D2D4C", +"ac c #1A1A2C", +"ad c #161628", +"ae c #333355", +"af c #07070C", +"ag c #313153", +"ah c #05050A", +"ai c #0D0D15", +"aj c #24243C", +"ak c #202038", +"al c #0D0D18", +"am c #1D1D2B", +"an c #0B0B16", +"ao c #282843", +"ap c #262641", +"aq c #232334", +"ar c #0F0F1D", +"as c #2C2C4A", +"at c #3C3C5D", +"au c #19192A", +"av c #151526", +"aw c #131324", +"ax c #303051", +"ay c #111122", +"az c #1F1F33", +"b` c #08080F", +"ba c #161620", +"bb c #23233A", +"bc c #212138", +"bd c #0E0E18", +"be c #0A0A14", +"bf c #272741", +"bg c #25253F", +"bh c #12121F", +"bi c #10101D", +"bj c #202030", +"bk c #0E0E1B", +"bl c #1E1E2E", +"bm c #2B2B48", +"bn c #0C0C19", +"bo c #181828", +"bp c #28283B", +"bq c #2F2F4F", +"br c #101020", +"bs c #1C1C2F", +"bt c #18182B", +"bu c #353558", +"bv c #09090F", +"bw c #333356", +"bx c #07070D", +"by c #15151E", +"bz c #202036", +"c` c #1C1C32", +"ca c #090912", +"cb c #191925", +"cc c #26263F", +"cd c #24243D", +"ce c #22223B", +"cf c #13131F", +"cg c #11111D", +"ch c #0F0F1B", +"ci c #0D0D19", +"cj c #2A2A46", +"ck c #171726", +"cl c #131322", +"cm c #111120", +"cn c #2E2E4D", +"co c #0F0F1E", +"cp c #343456", +"cq c #08080D", +"cr c #151527", +"cs c #06060B", +"ct c #1F1F34", +"cu c #0C0C14", +"cv c #0A0A12", +"cw c #494967", +"cx c #23233B", +"cy c white", +"cz c #0C0C17", +"d` c #292944", +"da c #0A0A15", +"db c #262637", +"dc c #141422", +"dd c #2D2D4B", +"de c #0E0E1C", +"df c #1A1A2B", +"dg c #161627", +"dh c #333354", +"di c #141425", +"dj c #313152", +"dk c #121223", +"dl c #030307", +"dm c #BCBCD7", +"dn c #1E1E32", +"do c #1C1C30", +"dp c #1A1A2E", +"dq c #0B0B12", +"dr c #18182C", +"ds c #090910", +"dt c #222239", +"du c #11111B", +"dv c #1E1E35", +"dw c #0F0F19", +"dx c #0D0D17", +"dy c #0B0B15", +"dz c #1B1B28", +"e` c #262640", +"ea c #151522", +"eb c #212131", +"ec c #2C2C49", +/* pixels */ +"``````````````````bxdybsdobsdfdc````````````````", +"```````````````r`h`rajcibk`udzdgdnau````````````", +"``````````b``gcicgao`xavazcd`vao`q`u`gcf````````", +"````````b`aucxdicjecddcncnadddec`xbfcxdaai``````", +"``````aibkbkbi`addaaaabm`ydpbgaaawcobfci`gcg````", +"``````dfbce`deddbqdj`bayaeasc`djapak`te`bcac````", +"````eadaciaodpc`ayaycrdrcpdiacaqcr`eecdtaj`hea``", +"````auanbtcj`fdv`yaedrbububpcp`eagbqddblccbzau``", +"``bd`ual`qc`abcndkbwdi`zcwcwbubwbp`cabe`bidtcz`j", +"``bhchdtaz`qbl`ccrdhdh`mcydmatbway`cabdedidtdobh", +"``cg`gdtboamco`ddjaebz`mcydmatawakapdddecmalcvcg", +"``cgczdte`dedo`ec``bdiatcwcw`k`baq`ebl`vbkdtbscv", +"``bxbe`u`qbodeabbraxdrbjadaedjbjbqabbmaoc``lczbx", +"``dwclbicxbfdtecabaa`nbraxdb`cblabec`vbfdgctczdw", +"``cvckbe`lbndzcjaoddcnajaocncnddcocjbf`qanad`wcv", +"````cuchdnan`qbfcocebleccjecbmeb`v`kbh`paudfdq``", +"````dx`xclbtdtbtaraod`ambr`xd`aravdc`geaa``wbv``", +"``````cgdcbt`pbc`u`qccdtdge`cc`qcxbcctbyczcs````", +"``````cqcsckcl`gdicidtardibbdt`lcbbacl`o`odl````", +"````````dscseaauby`r`sctctctdndubyaubhbxds``````", +"``````````afcscv`wbocaacacacaubobdb``iaf````````", +"``````````````ahdw`rdqbxcudccfcvdwb`````````````", +"``````````````````afdlbvdsdq`jaf````````````````", +"````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue6.xpm b/hacks/images/bubbles/blue6.xpm new file mode 100644 index 00000000..f70bb6c9 --- /dev/null +++ b/hacks/images/bubbles/blue6.xpm @@ -0,0 +1,195 @@ +/* XPM */ +static char *blue6[] = { +/* width height ncolors chars_per_pixel */ +"30 30 158 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #191929", +"`c c #323252", +"`d c #303050", +"`e c #111121", +"`f c #2E2E4E", +"`g c #1D1D30", +"`h c #1B1B2E", +"`i c #0C0C12", +"`j c #0A0A10", +"`k c #17172A", +"`l c #212137", +"`m c #767691", +"`n c #1F1F35", +"`o c #2F2F48", +"`p c #101019", +"`q c #181824", +"`r c #25253E", +"`s c #12121E", +"`t c #10101C", +"`u c #20202F", +"`v c #0E0E1A", +"`w c #2B2B47", +"`x c #0C0C18", +"`y c #292945", +"`z c #161625", +"a` c #141423", +"aa c #242436", +"ab c #121221", +"ac c #2F2F4E", +"ad c #2D2D4C", +"ae c #1A1A2C", +"af c #5C5C7A", +"ag c #161628", +"ah c #333355", +"ai c #07070C", +"aj c #313153", +"ak c #05050A", +"al c #0D0D15", +"am c #07070F", +"an c #24243C", +"ao c #202038", +"ap c #0D0D18", +"aq c #1D1D2B", +"ar c #0B0B16", +"as c #282843", +"at c #232334", +"au c #11111F", +"av c #0F0F1D", +"aw c #2C2C4A", +"ax c #3C3C5D", +"ay c #1B1B2C", +"az c #19192A", +"b` c #151526", +"ba c #131324", +"bb c #303051", +"bc c #111122", +"bd c #1F1F33", +"be c #19192D", +"bf c #08080F", +"bg c #161620", +"bh c #23233A", +"bi c #212138", +"bj c #0E0E18", +"bk c #0A0A14", +"bl c #272741", +"bm c #25253F", +"bn c #12121F", +"bo c #10101D", +"bp c #202030", +"bq c #0E0E1B", +"br c #1E1E2E", +"bs c #2B2B48", +"bt c #0C0C19", +"bu c #181828", +"bv c #28283B", +"bw c #262639", +"bx c #2F2F4F", +"by c #101020", +"bz c #18182B", +"c` c #353558", +"ca c #09090F", +"cb c #333356", +"cc c #07070D", +"cd c #15151E", +"ce c #202036", +"cf c #1C1C32", +"cg c #090912", +"ch c #191925", +"ci c #26263F", +"cj c #24243D", +"ck c #22223B", +"cl c #13131F", +"cm c #11111D", +"cn c #0F0F1B", +"co c #0D0D19", +"cp c #2A2A46", +"cq c #262642", +"cr c #171726", +"cs c #151524", +"ct c #131322", +"cu c #111120", +"cv c #2E2E4D", +"cw c #0F0F1E", +"cx c #343456", +"cy c #08080D", +"cz c #151527", +"d` c #06060B", +"da c #1F1F34", +"db c #1B1B30", +"dc c #0C0C14", +"dd c #0A0A12", +"de c #494967", +"df c #23233B", +"dg c white", +"dh c #14141F", +"di c #212139", +"dj c #1E1E2C", +"dk c #0C0C17", +"dl c #292944", +"dm c #0A0A15", +"dn c #262637", +"do c #141422", +"dp c #2D2D4B", +"dq c #0E0E1C", +"dr c #1A1A2B", +"ds c #373758", +"dt c #181829", +"du c #161627", +"dv c #333354", +"dw c #141425", +"dx c #313152", +"dy c #121223", +"dz c #222236", +"e` c #030307", +"ea c #BCBCD7", +"eb c #1E1E32", +"ec c #1C1C30", +"ed c #1A1A2E", +"ee c #0B0B12", +"ef c #18182C", +"eg c #28283F", +"eh c #090910", +"ei c #222239", +"ej c #202037", +"ek c #11111B", +"el c #1E1E35", +"em c #0F0F19", +"en c #0D0D17", +"eo c #0B0B15", +"ep c #1B1B28", +"eq c #090913", +"er c #262640", +"es c #171724", +"et c #151522", +"eu c #212131", +"ev c #2C2C49", +/* pixels */ +"````````````````````````d`dhazazdoap`s``````````````````````", +"``````````````````ccdraubgbiei`hcu`xar`gbkcm````````````````", +"````````````````drbgeianbmdfbydfaqblbmageibkb```````````````", +"````````````eoeqceboeiascpcwbsctaoeucpaser`nce`sdo``````````", +"``````````bfarb`eicwcpbsdpadcvcvdfaddpbsa`dj`raeddal````````", +"````````bn`tcochas`aawcvbx`kbxacczbybxcvcwerab`rchbjbn``````", +"````````ek`besav`aawcv`ddxdbejdvcqdbdxeuaweudfbl`hcedr``````", +"``````am`gdtau`yevcv`dbpdvbcbbdwcbahdvbzeudzb``ydweict`z````", +"````alaearabascubmbyeladahasaocxbwbeahagbabxdp`wdfcjcebk`j``", +"````etbkbobzdlevcfbcaaagcxasc`c`bvbvcx`kaj`dcvaqdlcieictet``", +"````craretcudqeueuczczahaeel`cdededscxbz`cbb`fdi`kbobh`qcr``", +"``eeazcdazepaqcw`fbx`ecz`hax`mea`mdec`ahefbb`fbcbz`hdfdaddee", +"```pdudkctdjcpefeu`dazb`agdseadgeaafdsahaobccv`ueccwdochek`p", +"``ekcddadfci`hcjadatdxelcf`o`meaeadebdedbb`keueveubqab`qazen", +"``ekazeobher`kdwdtaccfdwahdrdedeafaxdyajatacdpcrdlbqbha`dkd`", +"```p`parei`rasdqatcvbybbckegacebc`dvcfbbbxcvaw`abrcjei`gdtee", +"``akcrdwbganblecb`dpctdnabdw`f`wdxdx`d`ncvdpbs`yblco`lek`pen", +"``aketdkbgei`rczaqbsdpaa`f`fefedbxbx`fcveubs`yaq`rb`arbgccai", +"````bndtdk`lcedqas`yeccwdpadcvbscvadeicfby`yascidfareoazbj``", +"````em`zeoebctctciascwbaabevevcpevevbs`b`ydbeianbiazay`zem``", +"````e`clapay`sepanescoasdl`yeubcdq`y`u`uctbmcuebda`vbuclai``", +"``````bjcgcgecdmbi`xcmcierbl`udqbhbldjdjcjdfbiabeccgetbj````", +"`````````tbjazbjdrcecndfancj`kbt`rcjandfeiceabcmazbfd```````", +"````````bfbfcseq`v`gararbgboducleieibgceda`g`temdcekcy``````", +"``````````ehdccccrdrcddteb`vdadadaebebemcddrcsbncceh````````", +"````````````akemccbk`tazal`p`h`h`haydrazeebfddeecc``````````", +"````````````````eh`i`sdocseododd`p`zcsdobf`je```````````````", +"``````````````````e`bfenemddeobjcmekemenddak````````````````", +"````````````````````````aie`e`bfcaaiai``````````````````````", +"````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue7.xpm b/hacks/images/bubbles/blue7.xpm new file mode 100644 index 00000000..6f4ee485 --- /dev/null +++ b/hacks/images/bubbles/blue7.xpm @@ -0,0 +1,212 @@ +/* XPM */ +static char *blue7[] = { +/* width height ncolors chars_per_pixel */ +"36 36 169 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #1B1B2B", +"`c c #191929", +"`d c #323252", +"`e c #303050", +"`f c #111121", +"`g c #2E2E4E", +"`h c #0F0F1F", +"`i c #1D1D30", +"`j c #1B1B2E", +"`k c #0C0C12", +"`l c #0A0A10", +"`m c #17172A", +"`n c #212137", +"`o c #767691", +"`p c #1F1F35", +"`q c #2F2F48", +"`r c #101019", +"`s c #0E0E17", +"`t c #272740", +"`u c #181824", +"`v c #25253E", +"`w c #21213A", +"`x c #12121E", +"`y c #10101C", +"`z c #20202F", +"a` c #0E0E1A", +"aa c #2B2B47", +"ab c #0C0C18", +"ac c #292945", +"ad c #161625", +"ae c #141423", +"af c #242436", +"ag c #121221", +"ah c #2F2F4E", +"ai c #2D2D4C", +"aj c #1A1A2C", +"ak c #5C5C7A", +"al c #161628", +"am c #333355", +"an c #07070C", +"ao c #313153", +"ap c #05050A", +"aq c #0D0D15", +"ar c #07070F", +"as c #24243C", +"at c #202038", +"au c #0D0D18", +"av c #1D1D2B", +"aw c #0B0B16", +"ax c #282843", +"ay c #262641", +"az c #232334", +"b` c #11111F", +"ba c #0F0F1D", +"bb c #2C2C4A", +"bc c #3C3C5D", +"bd c #2A2A48", +"be c #1B1B2C", +"bf c #19192A", +"bg c #151526", +"bh c #131324", +"bi c #303051", +"bj c #111122", +"bk c #1F1F33", +"bl c #19192D", +"bm c #08080F", +"bn c #161620", +"bo c #23233A", +"bp c #212138", +"bq c #0E0E18", +"br c #0A0A14", +"bs c #272741", +"bt c #25253F", +"bu c #23233D", +"bv c #12121F", +"bw c #10101D", +"bx c #202030", +"by c #0E0E1B", +"bz c #1E1E2E", +"c` c #2B2B48", +"ca c #292946", +"cb c #181828", +"cc c #28283B", +"cd c #262639", +"ce c #2F2F4F", +"cf c #101020", +"cg c #1C1C2F", +"ch c #2A2A40", +"ci c #18182B", +"cj c #353558", +"ck c #09090F", +"cl c #333356", +"cm c #07070D", +"cn c #15151E", +"co c #202036", +"cp c #1C1C32", +"cq c #090912", +"cr c #191925", +"cs c #26263F", +"ct c #24243D", +"cu c #22223B", +"cv c #13131F", +"cw c #11111D", +"cx c #0F0F1B", +"cy c #0D0D19", +"cz c #2A2A46", +"d` c #262642", +"da c #171726", +"db c #151524", +"dc c #131322", +"dd c #111120", +"de c #2E2E4D", +"df c #0F0F1E", +"dg c #1D1D2F", +"dh c #343456", +"di c #08080D", +"dj c #151527", +"dk c #06060B", +"dl c #1F1F34", +"dm c #1B1B30", +"dn c #0C0C14", +"do c #0A0A12", +"dp c #494967", +"dq c #23233B", +"dr c white", +"ds c #212139", +"dt c #1E1E2C", +"du c #2B2B46", +"dv c #0C0C17", +"dw c #292944", +"dx c #0A0A15", +"dy c #262637", +"dz c #141422", +"e` c #2D2D4B", +"ea c #0E0E1C", +"eb c #1A1A2B", +"ec c #373758", +"ed c #181829", +"ee c #161627", +"ef c #333354", +"eg c #141425", +"eh c #313152", +"ei c #121223", +"ej c #222236", +"ek c #030307", +"el c #BCBCD7", +"em c #1E1E32", +"en c #1C1C30", +"eo c #1A1A2E", +"ep c #0B0B12", +"eq c #18182C", +"er c #28283F", +"es c #090910", +"et c #222239", +"eu c #11111B", +"ev c #1E1E35", +"ew c #0F0F19", +"ex c #0D0D17", +"ey c #0B0B15", +"ez c #1B1B28", +"f` c #090913", +"fa c #262640", +"fb c #171724", +"fc c #151522", +"fd c #212131", +"fe c #2E2E4B", +"ff c #2C2C49", +/* pixels */ +"````````````````````````````````cq`sdaaddn``````````````````````````````", +"`````````````````````````xedcgfc`ucocyaba`aecgcqdz``````````````````````", +"````````````````````dobe`jbnetasbabybyddboezdl`nembrar``````````````````", +"``````````````````ebema`fcctbsezbybwdqegdbaxbsetdq`xemcb````````````````", +"``````````````exaucx`nby`zaxczfddfffeq`m`aaaczaxbsby`n`pbedz````````````", +"````````````bmfcemdqagagczc`bbe`dededebg`me`bbc`aebafcdqawa`aq``````````", +"``````````cvbecodqbydc`affaideajcfdjblegdm`wdebebh`pdafaezbndvcv````````", +"``````````bf`icwdtb``abbdeah`eeqbje``dbd`fc``e`vevbheqax`va`bkbf````````", +"````````cqbrbpalejeaffdecebieh`d`geiamafdjcpehc`aybg`c`zbsezbpbraq``````", +"``````doajda`pcyacbte`aheveeefafevaldhdhclamefd`bgahe`c`acdqdq`pdv`x````", +"``````daeyawcyaxavayeicudyeiamdjdmevcjdydycgafbhevcedebbcfav`vbpdada````", +"`````lbfajagciaxc``hdscfafdmcleqafcjcjcjcjdhcdalao`eahe`ataxcsetcgbfey``", +"````dccxdcdgcyeeaxaieq`malccdheqaxchdpbc`qcjdhalafbiceaibldceadq`pbvdc``", +"````cmf`emdq`pacczaicebubjcidhbsdudpakakdpecdherbjehceaiagddemascobnad``", +"`````scx`n`mbkacdwbzcebidjeidhef`oeldrel`obcdhccbjdgceaiay`megby`nenbm``", +"``aqda`i`neeavacc`bhdwbifdbdduemakdrdrdr`obcdhcicubseoaidqdjdden`nbf`saq", +"``bqdaencoasfabscf`mac`eehbjdyajakelelelakbceibjcecfate`c`cs`fcycocgdado", +"```l`rdvcodqfadqcfenercecpcfefegazdpdpakbc`mciehazejdebzaxaxbydqawcgcqdi", +"``ap`ragbaet`v`zcfagaxdecfageheidhfeccecdhazdjbicedee`c`czax`metcrbq`rdn", +"``ekdbdccyetctbsadbhbbaifaaxbibdehevee`deh`ec``v`gaibb`tdwdt`jetemaj`sep", +"````bmdcbf`udqbtbtetc`bbaialce`pegbubibi`e`ece`faibbc`ac`zbteebe`idvcm``", +"````eucqa``xetcteeaeczc`fdevdedybzeqcpceahdedeegffc`czaxfacrcycwcgdc`x``", +"````apdb`sdbcoawdqezaxaccacubge`aibxaiaiaie``ccpalddaxbs`vbocycgajdnew``", +"````bmdncbexemagen`vfa`zdfeacpbzffbbczbbffc`aadtacblblbvci`nbfcgcbepek``", +"```````rdbbaaedl`ndq`vdcagaxacczczaveadfczcz`fbebsfabpbaagdlbebfdbdo````", +"``````apbvcxbf`idx`nfbbfcyfabsaxb`bwbgbaaxax`jb`bfasbo`nen`idvcqbvdo````", +"````````bqbmdzajbr`ucocya`ct`vcsdtegeeezfacs`vctdqetcodldvajdvbvan``````", +"``````````ewcmdadaa`emeyagezbodqfbabcoasasdqboetbncobrbrajdaeycm````````", +"``````````ckdkdzcvda`j`i`uagen`bcycr`uetbpcrcodxem`idcdnardn`yek````````", +"````````````es`karfccbebcnal`i`yawdldldlbkemebdacnebbwbvcm`ses``````````", +"``````````````ekbq`xbmbmdoadajed`rcgcgcg`jeuajbfcbdbdvdkcmdi````````````", +"``````````````````ekbm`xdzdbdacqdaedcqedcbdadaaqbvdkeydk````````````````", +"````````````````````ekdneweubvepdoardn`sdzcvbv`lewapek``````````````````", +"````````````````````````dkekdn`sdodk`lewew`sdndoan``````````````````````", +"````````````````````````````````ekekdkanek``````````````````````````````", +"````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue8.xpm b/hacks/images/bubbles/blue8.xpm new file mode 100644 index 00000000..d4babc4b --- /dev/null +++ b/hacks/images/bubbles/blue8.xpm @@ -0,0 +1,219 @@ +/* XPM */ +static char *blue8[] = { +/* width height ncolors chars_per_pixel */ +"44 44 168 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #1B1B2B", +"`c c #282845", +"`d c #191929", +"`e c #323252", +"`f c #303050", +"`g c #111121", +"`h c #2E2E4E", +"`i c #1D1D30", +"`j c #1B1B2E", +"`k c #0A0A10", +"`l c #17172A", +"`m c #212137", +"`n c #767691", +"`o c #1F1F35", +"`p c #2F2F48", +"`q c #101019", +"`r c #0E0E17", +"`s c #272740", +"`t c #181824", +"`u c #25253E", +"`v c #21213A", +"`w c #12121E", +"`x c #10101C", +"`y c #20202F", +"`z c #2B2B47", +"a` c #0C0C18", +"aa c #292945", +"ab c #161625", +"ac c #141423", +"ad c #242436", +"ae c #121221", +"af c #2F2F4E", +"ag c #2D2D4C", +"ah c #2B2B4A", +"ai c #1A1A2C", +"aj c #5C5C7A", +"ak c #161628", +"al c #333355", +"am c #07070C", +"an c #05050A", +"ao c #0D0D15", +"ap c #07070F", +"aq c #24243C", +"ar c #202038", +"as c #0D0D18", +"at c #1D1D2B", +"au c #0B0B16", +"av c #282843", +"aw c #262641", +"ax c #232334", +"ay c #11111F", +"az c #0F0F1D", +"b` c #2C2C4A", +"ba c #3C3C5D", +"bb c #2A2A48", +"bc c #1B1B2C", +"bd c #19192A", +"be c #151526", +"bf c #131324", +"bg c #303051", +"bh c #111122", +"bi c #19192D", +"bj c #08080F", +"bk c #161620", +"bl c #23233A", +"bm c #212138", +"bn c #0E0E18", +"bo c #0A0A14", +"bp c #272741", +"bq c #25253F", +"br c #23233D", +"bs c #12121F", +"bt c #10101D", +"bu c #202030", +"bv c #0E0E1B", +"bw c #1E1E2E", +"bx c #2B2B48", +"by c #0C0C19", +"bz c #292946", +"c` c #181828", +"ca c #28283B", +"cb c #262639", +"cc c #2F2F4F", +"cd c #101020", +"ce c #2D2D4D", +"cf c #1C1C2F", +"cg c #2A2A40", +"ch c #18182B", +"ci c #353558", +"cj c #09090F", +"ck c #333356", +"cl c #07070D", +"cm c #15151E", +"cn c #202036", +"co c #1C1C32", +"cp c #090912", +"cq c #191925", +"cr c #26263F", +"cs c #24243D", +"ct c #22223B", +"cu c #13131F", +"cv c #11111D", +"cw c #0F0F1B", +"cx c #0D0D19", +"cy c #2A2A46", +"cz c #262642", +"d` c #171726", +"da c #151524", +"db c #131322", +"dc c #111120", +"dd c #2E2E4D", +"de c #0F0F1E", +"df c #1D1D2F", +"dg c #343456", +"dh c #08080D", +"di c #151527", +"dj c #06060B", +"dk c #1F1F34", +"dl c #1B1B30", +"dm c #0C0C14", +"dn c #0A0A12", +"do c #494967", +"dp c #23233B", +"dq c white", +"dr c #14141F", +"ds c #212139", +"dt c #1E1E2C", +"du c #2B2B46", +"dv c #0C0C17", +"dw c #292944", +"dx c #0A0A15", +"dy c #262637", +"dz c #141422", +"e` c #2D2D4B", +"ea c #0E0E1C", +"eb c #1A1A2B", +"ec c #373758", +"ed c #181829", +"ee c #161627", +"ef c #333354", +"eg c #141425", +"eh c #313152", +"ei c #121223", +"ej c #222236", +"ek c #BCBCD7", +"el c #1E1E32", +"em c #1C1C30", +"en c #1A1A2E", +"eo c #0B0B12", +"ep c #18182C", +"eq c #28283F", +"er c #090910", +"es c #222239", +"et c #202037", +"eu c #11111B", +"ev c #1E1E35", +"ew c #0F0F19", +"ex c #0D0D17", +"ey c #0B0B15", +"ez c #1B1B28", +"f` c #090913", +"fa c #262640", +"fb c #171724", +"fc c #151522", +"fd c #212131", +"fe c #2C2C49", +/* pixels */ +"````````````````````````````````````````````ao``````````````````````````````````````````", +"````````````````````````````````dmbs`wcffb`i`i`i`ieyaicxfc``````````````````````````````", +"````````````````````````````c`euegcwcnbmesa`a`aza`cxcffb`ibo`x``````````````````````````", +"````````````````````````c`cfau`mezdp`uenakaeeadpcr`u`ucxa``mbtcvc```````````````````````", +"````````````````````cvaiel`lezazd`bpavdbbvdbdseaeiayavbpbvcsesa`eleufc``````````````````", +"``````````````````eebeasaubycobpavaa`adic`cyeade`dbw`aaaavbpdbcvesdkdvd`````````````````", +"````````````````bjdvcxeschaqavaa`zbxb`e`agagddbwbfbdb`bx`zaaemdt`uesauf`d```````````````", +"``````````````d`cf`xcfazcx`j`ybxb`agddag`lchej`g`cbxddag`gdieaeaaz`ubeakcmbj````````````", +"````````````dabcdxee`udedw`afee`ddafccaf`ccecobg`lcdejafddaecddedtbp`uchdk`w`q``````````", +"``````````bnebdrcqbccxea`afee`ddcc`fbfbibhep`eaaawczbu`feqeiawbxegavfachbmelebcl````````", +"``````````c`bdcncvezateafee`ddccbgeh`ecbetcaaldfbqegawehdibxad`vae`yavcr`lcnbocv````````", +"````````dzaibkcwcvezaacse`ddccendf`eefbhdddlfeckckalef`ebfardddd`ybxaacseaes`taudz``````", +"`````````xbobv`o`uavdtdcde`g`gawbgalck`vepfddgdg`leldwaketei`fafagfecyeacrdpbkf``r``````", +"``````cuebazbvcdaedw`ybhegbqbudibfalcaahducicicaciegcbakei`lbgccddb`bmavbpcsbmbn`wcu````", +"``````bjf`dx`jchcsaabxbfbrbhbh`cbfckctdgciecececadcidgckdiejeh`ffde`bmaad``uescq`jao````", +"`````kd`dx`ofbenazcddbagbwcdcdawcbdgbrdi`i`pdodobaeccidgb`axeh`fafagbibpevdbdpcna`d`ex``", +"`````w`dbofbeeakavc`cdagafctet`leqdg`cblecajajajajbacidgdwbbeh`fafagawaaatetdpcneudv`w``", +"`````rbdcf`baidtavegdbebafeqcbbhavdg`i`pajekekek`ndobadgad`lai`fafagdpegazcoaz`m`ibodb``", +"````dnbdelelcdeaavcybuevaf`feh`vcodgesba`ndqdqdqekajbadgalbhctbdaxagee`gaebvcv`mel`qdz``", +"`````xcmau`mdfbt`yfdbwegbc`fehejbxdgefdo`ndqdqdq`najbadg`lepev`adye``lctem`jaz`mcfeudn``", +"````fcebel`mdpezatcsdbenbqbzbgbe`lalakcgdo`nekek`ndoadakepbhcdcocde`bxcybv`oez`mbddbbn``", +"``djcpbdeycndpesazeaeaemfdaf`fepaeefbpbdecajdoajdobaefaxehbgdyafagbw`yaaatdsdpcwdbdmcwdj", +"````cwcmbd`jes`ubpdpcoegcyddenepdfehbxaxcgcgcabaecdgarbdeh`fccdde`fecyavezbiescney`rdz``", +"````bnedf`auesaqfaavchazb`agcddidybgcdcacb`aegalef`eaxenfeccddagb`bxaaav`tevesdkbvedcl``", +"````bjd`daau`mdp`ubpatawcrb`age`ch`fcdbhbibeehehehbg`fcfavddagb`bxcyavbp`ua``melcp`qdj``", +"`````xabbdbodfescsfaeaarfdbxb`cyakafak`leieiax`f`fccccaf`lbwb`bx`aaadtfa`j`icv`iasas`x``", +"`````kdzbndvdv`mdpbsbiabaa`abxbxbpddddaxbccddsafaf`hdddd`ycoeg`aaaavfa`ubydbbecfcpbjbn``", +"````djcud`cpdbcnfcayaqezavaa`aazaaaxe`agagcdb`ddagage`ee`oakeaaaavbp`uaqfbcnbtd`eyewdn``", +"```````xda`qeyelcnbv`iatbpavdteacocsdeesb`bueiavb`b`febxcdfdelbvbeezezescnazeybd`q`x````", +"``````dmcud`eydvdkbeeaaq`ufadecdac`y`a`zbx`seaaqbx`z`acyaaavbpatbvbvaz`m`tdvaid`cuan````", +"````````clfccvbt`iaycwescvdebv`yavavdwaaaa`yde`l`yaadwemavabel`uaeakeldk`iaec`fc`x``````", +"````````dm`wap`x`j`icx`mescxbvaqfabpbpavaecodbabavavbpbmaebvcsdpes`mdv`i`j`x`r`wdm``````", +"``````````ewcv`xbdakdx`tcnbmbycwcs`ubqcrbicxeeayfacrbq`ucsdpblbmcndk`i`jdncvcvbn````````", +"``````````er`xex`qbddvbtbk`ocxazesdpaq`ta`by`jcscsaqaqbcescq`m`obecxbcbdcpbsaner````````", +"````````````eobjcveebscwey`ibkeleldceselauezcxcqesesez`mcncuel`idvaydveudz`xan``````````", +"``````````````dm`xaocpabebbccffbasbd`oegazcncncncncn`odkd`drcfbcazdzeybs`xdm````````````", +"````````````````dhbjdm`qd`edebbkd`emdrazelelelelelel`ibocfbofcedee`xdmaneo``````````````", +"``````````````````anbndjerbnbseydnebf`ai`jcfcfcf`jbcaiebbdc``qdmbndv`rdh````````````````", +"````````````````````dhdjdnaodbfcabd`cpc``dbd`rbd`dedc`d`aodzbjdjdmcldh``````````````````", +"````````````````````````anaoewcvbsdbdzeoclap`q`rdafcdzdbcldmewcjer``````````````````````", +"````````````````````````````djdj`reweoexcldjbn`wcveu`xew`rdmdh``````````````````````````", +"````````````````````````````````amcjdndjeoanandmdmdmdnamam``````````````````````````````", +"````````````````````````````````````````````am``````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/blue9.xpm b/hacks/images/bubbles/blue9.xpm new file mode 100644 index 00000000..2026b9b5 --- /dev/null +++ b/hacks/images/bubbles/blue9.xpm @@ -0,0 +1,227 @@ +/* XPM */ +static char *blue9[] = { +/* width height ncolors chars_per_pixel */ +"50 50 170 2", +/* colors */ +"`` c None", +"`a c #2A2A47", +"`b c #1B1B2B", +"`c c #282845", +"`d c #191929", +"`e c #323252", +"`f c #303050", +"`g c #111121", +"`h c #2E2E4E", +"`i c #0F0F1F", +"`j c #1D1D30", +"`k c #1B1B2E", +"`l c #0C0C12", +"`m c #0A0A10", +"`n c #17172A", +"`o c #212137", +"`p c #767691", +"`q c #1F1F35", +"`r c #2F2F48", +"`s c #101019", +"`t c #0E0E17", +"`u c #272740", +"`v c #181824", +"`w c #25253E", +"`x c #21213A", +"`y c #12121E", +"`z c #10101C", +"a` c #20202F", +"aa c #0E0E1A", +"ab c #2B2B47", +"ac c #0C0C18", +"ad c #292945", +"ae c #161625", +"af c #141423", +"ag c #242436", +"ah c #313150", +"ai c #121221", +"aj c #2F2F4E", +"ak c #2D2D4C", +"al c #1A1A2C", +"am c #5C5C7A", +"an c #161628", +"ao c #333355", +"ap c #07070C", +"aq c #313153", +"ar c #05050A", +"as c #0D0D15", +"at c #24243C", +"au c #202038", +"av c #0D0D18", +"aw c #1D1D2B", +"ax c #0B0B16", +"ay c #282843", +"az c #262641", +"b` c #232334", +"ba c #11111F", +"bb c #0F0F1D", +"bc c #2C2C4A", +"bd c #3C3C5D", +"be c #1B1B2C", +"bf c #19192A", +"bg c #151526", +"bh c #131324", +"bi c #303051", +"bj c #111122", +"bk c #1F1F33", +"bl c #19192D", +"bm c #08080F", +"bn c #161620", +"bo c #23233A", +"bp c #212138", +"bq c #0E0E18", +"br c #0A0A14", +"bs c #272741", +"bt c #25253F", +"bu c #23233D", +"bv c #12121F", +"bw c #10101D", +"bx c #202030", +"by c #0E0E1B", +"bz c #1E1E2E", +"c` c #2B2B48", +"ca c #0C0C19", +"cb c #292946", +"cc c #181828", +"cd c #28283B", +"ce c #262639", +"cf c #2F2F4F", +"cg c #101020", +"ch c #1C1C2F", +"ci c #2A2A40", +"cj c #18182B", +"ck c #353558", +"cl c #09090F", +"cm c #333356", +"cn c #07070D", +"co c #15151E", +"cp c #202036", +"cq c #1C1C32", +"cr c #090912", +"cs c #191925", +"ct c #26263F", +"cu c #24243D", +"cv c #22223B", +"cw c #13131F", +"cx c #11111D", +"cy c #0F0F1B", +"cz c #0D0D19", +"d` c #2A2A46", +"da c #262642", +"db c #171726", +"dc c #151524", +"dd c #131322", +"de c #111120", +"df c #2E2E4D", +"dg c #0F0F1E", +"dh c #1D1D2F", +"di c #343456", +"dj c #08080D", +"dk c #151527", +"dl c #06060B", +"dm c #1F1F34", +"dn c #1B1B30", +"do c #0C0C14", +"dp c #0A0A12", +"dq c #494967", +"dr c #23233B", +"ds c white", +"dt c #14141F", +"du c #1E1E2C", +"dv c #2B2B46", +"dw c #0C0C17", +"dx c #292944", +"dy c #0A0A15", +"dz c #262637", +"e` c #141422", +"ea c #2D2D4B", +"eb c #0E0E1C", +"ec c #1A1A2B", +"ed c #373758", +"ee c #181829", +"ef c #161627", +"eg c #333354", +"eh c #141425", +"ei c #313152", +"ej c #121223", +"ek c #222236", +"el c #030307", +"em c #BCBCD7", +"en c #1E1E32", +"eo c #1C1C30", +"ep c #1A1A2E", +"eq c #0B0B12", +"er c #18182C", +"es c #28283F", +"et c #090910", +"eu c #222239", +"ev c #202037", +"ew c #11111B", +"ex c #1E1E35", +"ey c #0F0F19", +"ez c #0D0D17", +"f` c #0B0B15", +"fa c #1B1B28", +"fb c #090913", +"fc c #262640", +"fd c #171724", +"fe c #151522", +"ff c #212131", +"fg c #2C2C49", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````cnddbvalfeewchch`kbbbfcre`````````````````````````````````````", +"````````````````````````````````e`eeaibvendmcp`o`oaxczeoaxbyax`jcydwe```````````````````````````````", +"````````````````````````````e`ewchf`bnaaeudrataicacabyatatfebvaacpen`yewdp``````````````````````````", +"````````````````````````aseechbncpeucs`wbtatefbbcqdrcpfabsfcbtehbaeucpbrchbqew``````````````````````", +"``````````````````````f`al`jdydeacbabwbsaydccucgffa`eheu`wdxaybsfc`watch`y`janfe````````````````````", +"````````````````````cybrbr`oblcz`nbsdxad`aecdkccfgerfgdebzc``aaddxbsdkawfa`odwaaef``````````````````", +"``````````````````bm`k`kbadrddcpayad`ac`bceaeaakdfdfdf`ieheabcc``aadbtbw`wdrdwbybgdb````````````````", +"````````````````ef`kefbgatbyczdrddc`bceadfdzdkanekc`ffexblb`dfeadgdkcgcgbacsateoen`kf```````````````", +"``````````````dcbecjczdrebehad`afgeaakdfcfbudn`cazajepercgeacfdfbxehbbfcawductdrcsenbecr````````````", +"````````````bmbfbfaibb`wefdx`afgeadfajcf`fcgcgbjbxaqbhbtcuan`fcfdxdnbtaibldxbsbkcpcp`jbfet``````````", +"``````````dpccdd`qeu`vbzbbefc`abdfaj`fbiei`ebcejenegdhepeh`g`nbibhbtdkddbsehcgbsfaeu`qchbmdl````````", +"``````````eqcobncpendgaybba`bcdfaj`fb`ei`eb`ehbhau`ndzaoaoch`eeiayerb`a`b`bzd`ayeb`qbpezecfe````````", +"````````ewcrfbchdddefadxaibcakffbeaddkdzegejdk`xehdididicmaoeg`eaydacf`hakbc`adxdgczeucyf`cceq``````", +"````````fealdwacdeefay`d`adk`gcgercqeh`naodkehexdidididkbjanaobjbjex`fcfdfeac`aidrctat`oaxbrfe``````", +"``````eydcbralacehebdx`absercvbcdzdhaycdcmer`jckckckagckeocdb`ayehdkei`f`hakfg`qdhbscueudmfbdbas````", +"``````cwbfbraxen`n`nadc`bc`gd`bjbgcfaycmdiejehckedededcdfgdidiblblffei`feadfboejaddu`wbocpbfbfcw````", +"``````cwbfbrbqboddcgbtayeaefdfbj`n`ncdcmbldkep`r`rdqdqbdceckdicmejdzeibicfdf`bdgebefdbdr`o`jdtfe````", +"`````tcxavdbdwblcpbzaeepaidfdzbudkejagcmbhdkdm`rdqamamambdeddicm`jeieibicfdfcgaiebfadgatbpencraeeq``", +"````ewdbaxcofedebwayawffejdfcfcfepbjdncm`kah`r`p`pem`p`pambdckcmdz`nb`bicfdfef`bcjbzatcseudmeycrew``", +"`````yccbvdmeuehbaaybz`u`nescfbiei`n`ndidvbxdq`pdsdsememamdqeddidxbj`fbxcfdfecazbhbyczaceudmchcr`y``", +"````aseechdycsczbwcpd`c`bhcucf`feidkcucmdicedq`pdsdsdsem`pdqedcmandkcgcgcbdfeaazehbtczbbchavaiewbm``", +"````cneechdmeudhbwawddbzbtcjdn`feiaqbjao`wenam`pdsdsdsemamdqck`nbt`adnbjaidfbcddbscjbgdecscwbw`ydp``", +"````doeechdmbpatbodueobjep`gayddbi`nbjegdaatdqdq`p`pem`pdq`rbucqexcgdkcvddakbcabadbyanatdmbqafcrcn``", +"````cnccbff``odreke``n`g`n`nekaj`fcqbj`eaocqffbddqdqamdqbdb`ej`eeibiagajdfeabzatdxbyeodr`oafbvcrcr``", +"````cn`scrdw`obo`wbsebeb`nbgakdfcqbj`nei`edkceekajcibdbdckagbjb`ei`fcfdfakbcc`d`aybsbgbo`oaxf`dbbm``", +"`````ydbcrbrdmeucufcay`kexayeadf`xcgbhbiadaycdcjfgcjdiaoeg`eaybh`fcf`hdfeafg`aaddudd`jeucpeffedbdl``", +"````ewaecrddaxbpdr`wbsbzepddfgeadfcbev`fcf`xag`abcbf`eeieieibicgbo`hdfeafgc`a`aybs`weubpdmavecaveq``", +"````eyfeczf`dycsbocufcbw`gbbc`bceaefdkajb`anbj`gehbibiag`f`fcfajbhdfeabcc`d`ctayfcanaccpenbacocney``", +"````ase`avdwddcpeuat`wcz`kba`ac`bcd`cqdf`hbcc`cgc`ep`fcfcfaj`hdfbsejbcc``aadayfa`webdmal`jbnbm`yas``", +"````dp`yae`zdydw`ochddcjfaayad`ac`cjbleaakdfdf`hbjepaj`hdfdfakea`dbbbs`aadaybsctcudeeeefbrecbm`ydp``", +"```````zfe`ycrbgcpfd`qbpaibsayadd`bbcueubxeaakakcgbcakakakeabcdecqepdkawaybsct`wdrbpchcjeweeet`z````", +"``````ascwdbdpdpencpbl`ncjfcbsaybgeberbsd`bzbcbcb`ehb`bcbcfgc`bgaiawdxbycueb`vcxeucpczcxecdbcneq````", +"``````elewfeaaf`aadmcjaidr`wctbscgcgebafek`ac`c`ctbbffc`c``a`aawadayayfaddca`ndw`o`ybbbeccfeewdj````", +"`````````tcwaeddax`j`yaleudre`fdebaiayaydxadd`d`dubjcqffd`ada`aybka`fcbtbwcpbbacdmdtcrbfaecwdp``````", +"````````cnbmetcraach`jdy`oeuacbbczccfcbsbsaya`deayblazaeayaydbcqddexcwat`jeu`ybk`jbfcrdoe``zet``````", +"``````````as`yfef`bfcobfcocpbpaibgcs`wbtfcfcbsbwbyczbabsbsfcfcbt`wcudreubpcpbqdcchezaebmcxar````````", +"``````````elbq`t`zeyecaxbbbkcp`oaxbodratcu`w`weubhbwalbt`w`wcuatdrboeu`ocpbkdwbwecdwbmdoarap````````", +"`````````````meyeze`ccbrcrbren`dbwbfbvcsbodrbaaieu`katatdrdrboeueucscpdmbrbff`ecccdobm`ldl``````````", +"``````````````eqeqbmdc`screy`d`jenacac`qbnfdczbg`vcweueueubpbncpacbnen`jeecr`ycrdocw`sel````````````", +"````````````````eqeybm`ze`coecbech`jbwandmbnaxbkcpcpcpcpcp`qdmen`kchchbeec`zf`dodleyeq``````````````", +"``````````````````dlas`y`zaedb`decbnbfbe`jbrbfenenenenenen`j`jdpchf``y`ddpdobvbm`meq````````````````", +"````````````````````elbqarcwdpcxcrdbccalbebefbchch`dchchch`kfbalbfeedbbqcrcneyarap``````````````````", +"``````````````````````djdocncncne`aedbdbccdwbfbfecececbfbfbfeedbdbcxezcncnclarbm````````````````````", +"````````````````````````eldlas`lcxcwe`fedcaedpe`bmdpdbeqefaedcfee`dpbq`mcnelap``````````````````````", +"````````````````````````````elelasey`zcx`ycnbmbm`zcre`e`cwcw`ycx`zeyasdjap``````````````````````````", +"````````````````````````````````dlararas`tcndparareq`z`zey`m`taseqclap``````````````````````````````", +"``````````````````````````````````````apdlelaparelareqeqdpetelap````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass.pov b/hacks/images/bubbles/glass.pov new file mode 100644 index 00000000..c1897714 --- /dev/null +++ b/hacks/images/bubbles/glass.pov @@ -0,0 +1,27 @@ +#include "colors.inc" +#include "shapes.inc" +#include "textures.inc" + +/* The following make the field of view as wide as it is high + * Thus, you should have the -W and -H command line options + * equal to each other. */ +camera { + location <5.8, 0, 0> + up <0, 1, 0> + right <1, 0, 0> + look_at <0, 0, 0> +} + +sphere { + <0,0,0>, 2.5 + texture { Glass + scale <0.7, 0.7, 0.7> + rotate y*clock + normal {bumps 0.4 scale 0.1} + finish { Shiny } +# finish { phong 0.4 } + } +} + +light_source {<6, 7, 0> color White} +light_source {<6.1, 1, 0> color Blue} diff --git a/hacks/images/bubbles/glass1.xpm b/hacks/images/bubbles/glass1.xpm new file mode 100644 index 00000000..7d25395c --- /dev/null +++ b/hacks/images/bubbles/glass1.xpm @@ -0,0 +1,78 @@ +/* XPM */ +static char *glass1[] = { +/* width height ncolors chars_per_pixel */ +"10 10 61 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #29293F", +"`c c #2C2C63", +"`d c #353579", +"`e c #242447", +"`f c #222245", +"`g c #25253E", +"`h c #1C1C3F", +"`i c #2B2B47", +"`j c #252544", +"`k c #222251", +"`l c #323264", +"`m c #212146", +"`n c #37374B", +"`o c #22223D", +"`p c #252536", +"`q c #232337", +"`r c #34346C", +"`s c #303068", +"`t c #26264A", +"`u c #5D5D97", +"`v c #363674", +"`w c #2C2C6A", +"`x c #2E2E5B", +"`y c #242451", +"`z c #343464", +"a` c #3C3C6F", +"aa c #353572", +"ab c #38386B", +"ac c #242454", +"ad c #181831", +"ae c #28285B", +"af c #37377A", +"ag c #20203F", +"ah c #26265C", +"ai c #4C4C60", +"aj c #383874", +"ak c #333379", +"al c #444458", +"am c #272756", +"an c #32326E", +"ao c #30306C", +"ap c #40407F", +"aq c #292944", +"ar c #212150", +"as c #323271", +"at c #2D2D76", +"au c #21213F", +"av c #25255A", +"aw c #35356D", +"ax c #313169", +"ay c #2C2C6E", +"az c #18182C", +"b` c #232344", +"ba c #292961", +"bb c #202037", +"bc c #1C1C33", +"bd c #242452", +"be c #45456F", +"bf c #242455", +/* pixels */ +"``````aibebebeal````", +"`````n`zaw`ua``l`n``", +"```i`xab`wasaj`r`x`q", +"``auaean`daf`vao`c`t", +"```haxahayatakbaaeb`", +"``adbfav`wapao`sam`m", +"``azagaracaaae`k`fbc", +"````bb`ybd`aar`e`o``", +"```````paq`j`b`g````", +"````````````````````" +}; diff --git a/hacks/images/bubbles/glass10.xpm b/hacks/images/bubbles/glass10.xpm new file mode 100644 index 00000000..503f5f1c --- /dev/null +++ b/hacks/images/bubbles/glass10.xpm @@ -0,0 +1,256 @@ +/* XPM */ +static char *glass10[] = { +/* width height ncolors chars_per_pixel */ +"60 60 189 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #272751", +"`j c #23234D", +"`k c #29293F", +"`l c #2C2C63", +"`m c #2A2A61", +"`n c #33334C", +"`o c #353579", +"`p c #272754", +"`q c #414188", +"`r c #20202C", +"`s c #2E2E3D", +"`t c #1C1C28", +"`u c #2E2E68", +"`v c #242447", +"`w c #2C2C66", +"`x c #222245", +"`y c #181824", +"`z c #25253E", +"a` c #161622", +"aa c #B9B9ED", +"ab c #3E3E67", +"ac c #1C1C3F", +"ad c #6767A3", +"ae c #2B2B47", +"af c #272743", +"ag c #222248", +"ah c #292931", +"ai c #29295C", +"aj c #1D1D39", +"ak c #252544", +"al c #1E1E47", +"am c #2B2B61", +"an c #29295F", +"ao c #1F1F3E", +"ap c #2F2F68", +"aq c #2D2D66", +"ar c #30305F", +"as c #2C2C5B", +"at c #11111C", +"au c #262655", +"av c #31316D", +"aw c #4C4C6D", +"ax c #222251", +"ay c #323264", +"az c #2D2D69", +"b` c #33335B", +"ba c #43436E", +"bb c #2B2B67", +"bc c #212146", +"bd c #37374B", +"be c #22223D", +"bf c #252536", +"bg c #1D1D42", +"bh c #2A2A5C", +"bi c #28285A", +"bj c #2B2B53", +"bk c #333372", +"bl c #2F2F6E", +"bm c #2B2B3F", +"bn c #2C2C36", +"bo c #424266", +"bp c #232337", +"bq c #2F2FB0", +"br c #34346C", +"bs c #525265", +"bt c #32326A", +"bu c #1B1B2F", +"bv c #3B3B55", +"bw c #303068", +"bx c #21214C", +"by c #2C2C64", +"bz c #292957", +"c` c #232351", +"ca c #26264A", +"cb c #2F2F60", +"cc c #202044", +"cd c #5D5D97", +"ce c #2B2B5C", +"cf c #363674", +"cg c #3C3C66", +"ch c #252556", +"ci c #30306E", +"cj c #3E3E54", +"ck c #414178", +"cl c #2C2C6A", +"cm c #2F2F4F", +"cn c #25252E", +"co c #27275B", +"cp c #363663", +"cq c #4C4C68", +"cr c #20204A", +"cs c #2E2E5B", +"ct c #29294C", +"cu c #242451", +"cv c #27274A", +"cw c #343464", +"cx c #4F4F64", +"cy c #252548", +"cz c #16162C", +"d` c #292938", +"da c #333384", +"db c #3C3C6F", +"dc c #353572", +"dd c #1E1E37", +"de c #38386B", +"df c #414156", +"dg c #242454", +"dh c #31316E", +"di c #181831", +"dj c #232349", +"dk c #272739", +"dl c #393979", +"dm c #4C4C85", +"dn c #2F2F83", +"do c #28285B", +"dp c #292952", +"dq c #36366C", +"dr c #48486D", +"ds c #23234C", +"dt c #37377A", +"du c #20203F", +"dv c #1E1E3D", +"dw c #26265C", +"dx c #313174", +"dy c #4C4C60", +"dz c #27273F", +"e` c #3C3C78", +"ea c #48485C", +"eb c white", +"ec c #383874", +"ed c #333379", +"ee c #444458", +"ef c #272756", +"eg c #47477C", +"eh c #32326E", +"ei c #1B1B33", +"ej c #1E1E2C", +"ek c #30306C", +"el c #40407F", +"em c #292944", +"en c #212150", +"eo c #23233E", +"ep c #141422", +"eq c #343473", +"er c #323271", +"es c #2D2D76", +"et c #2E2E6D", +"eu c #40406E", +"ev c #21213F", +"ew c #272731", +"ex c #8080BA", +"ey c #23232D", +"ez c #25255A", +"f` c #1B1B39", +"fa c #35356D", +"fb c #191937", +"fc c #262651", +"fd c #313169", +"fe c #2C2C6E", +"ff c #22224D", +"fg c #18182C", +"fh c #373786", +"fi c #2D2D65", +"fj c #232344", +"fk c #2B2B63", +"fl c #292961", +"fm c #27275F", +"fn c #202037", +"fo c #1C1C33", +"fp c #242452", +"fq c #45456F", +"fr c #484868", +"fs c #535380", +"ft c #1F1F43", +"fu c #2C2C5D", +"fv c #3535DD", +"fw c #353573", +"fx c #262657", +"fy c #393963", +"fz c #242455", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````bsbsbsbsbsbsbsbsbsbsbscxbs``````````````````````````````````````````````", +"``````````````````````````````````````````dycxdydycxawawawbsbsbsawcxcxcqdycxcxbs````````````````````````````````````````", +"````````````````````````````````````dyeacxfrawcqawfrawcqcxawcqawawawawawawfrfrcxcqeabs``````````````````````````````````", +"````````````````````````````````dfeadydyawcqawawfrcqawawdrawcqawawfqawcqcqfrawawfrdyeaeadf``````````````````````````````", +"``````````````````````````````eadyeadyfreedrboawfqfqfqdrfqeufqawbaawbabofqeufqdrcqfreeboeadf````````````````````````````", +"``````````````````````````dydffrbocjfrfrdrfrfrfqfqbabofrfqfsbaeubafqfqcgeubafqdrbaabbobobocjeedf````````````````````````", +"````````````````````````dfeeeadffyboeecgeufrfreufqeueueucgbaeubadrdbbacdbaeucgbabocpboboabboeaeebd``````````````````````", +"``````````````````````bdbdcjbd`cfyeefybaabcgfyeubaabdmfseudbdefsaackdbeudebaeudedebocgbofyfycjcjeecj````````````````````", +"````````````````````cjdfabbvb`cg`cfyfyfycgabcgdeckbrfscddecdcddmdmfsabdeeucwcpdbdbcgcgcp`cbvbvcjbvbdcj``````````````````", +"``````````````````bdbddfbv`ccgfyb`cgcgcpfycwdedbdbcdadcdexexckcd`u`uegdedbdbaycpaydecpcpb`bvfybvbdcj`s`s````````````````", +"````````````````dfbdcjbvbd`c`c`cb`cpcwcgdededqayfabrcdexdbcdcdcddeexebbrdbecdedqcwfdaycpcgarb`b`bd`cbd`sbd``````````````", +"```````````````sbdbd`n`ncmcscsarcscwcpdbbtbwbwbtbrfaebexegexaddbdeeceldqbrbrdqbtbkaybt`fbjcscpb`b``ncmctbdbd````````````", +"``````````````aebd`c`ncmcsb`cwayascsdebraybwbrfdbtazdmdeexaddladexckdedmdme`btay`lcbcscwarasfucpb`cmcmae`nbd````````````", +"`````````````saeeo`nbjcmcsarar`paycsbtcb`fbrbtfkfdciecdmdqebcdaacddmece`elbrazfabr`f`wbwbtarbzcsascsarbjbm`kbn``````````", +"``````````ewd`ae`z`c`zbjcsb`cscscwcwbrbravbtecbrfackaadmckexavciexdme`bkfabtapanbr`ffabtfdbtdpcscsbjbjdpbeae`s`s````````", +"``````````ahcm`kcm`bdparaycsay`fcscsfdbrfibwbtbrfdeqcd`qdmelbkeldmexdmeqdce`faerdcapbtbwfa`waucscscvdpdpafcmae`n````````", +"````````cncmaeakcmct`adpcsarcbcbbwdqdeapamdcehcfclbldlbldmeqeradexade`esecelehehdc`ubrbrbtfucsbhcsas`actbecmbpbpey``````", +"````````ejbpeo`vctcv`abzb`ef`ffxfucbbwapbldcdheqetesdlfwdmescfcddmdmdmbkbleldldhaq`ubrfabtcbcsbtcs`pcccycm`veobe`t``````", +"`````````rae`aajevdjdsasas`jbifiapbrbtav`uapclcfdlad`odndnfvdxededexegeceqe`e`cfbybydcbrfmcwcbfdcbbjdjca`bcv`zdd`t``````", +"``````ej`rbu`vcvcv`vcyfcbzefbz`f`uclapfderfeerclerdldlerdada`hedfhe`aacferdtcfciazapfk`ubramcbfuararbzfc`zaeaofo`t`r````", +"``````bpfodibedsdp`jcs`abwbh`lfadccidcecerclet`gfe`hdxdx`hededdt`hdaelcfereterer`wbk`ubtfdbtef`fefcb`paudpbcdiczdi`y````", +"``````ejddddemfcbjefcscs`faycedcececapciazcieqbldterdxdnbqelcdfhfv`h`oe`ererdnetfkfdekfabwbtfubifxfcar`affdpf``yepfo````", +"`````tej`ycyevcuctftbzefdoaiapaqbrbrehfw`udcfwda`oerekfhfhdxdtdaes`hbqfwcferbkehflfkekcffabwfuco`lbzcsbzftbccaevfneja```", +"````atddddem`xaocscsar`pdwdwfibwapbyapeccfdlcf`hdnfmbl`hfhdtdt`hclfvbq`qfhdxbkcfcl`gfkehfa`ufufpamaycsaydjcc`v`vfoepat``", +"````ejfgbucy`vccceaseffdfldgai`ubbfzfdazazcfblereqdt`hdnbq`hedbqfedndndte`dtdtdletfmdhehfkapapbt`mdgfubzacdp`xf`dicz`y``", +"````budddi`x`vevdpcsbzcwfxai`mapfdflfaavblercibkcffhcl`gfvfvfvdadaedclcfcfdteqecdcfkercfav`lbt`famchfdcsbe`bcaczfjbefg``", +"````a`buepccevcrdpbzbzcbfxbifdfififacfekazereretblfe`hfhbqesesdnfh`h`hbq`hfwecdldcerclavecaqaqfifxbhbzbzcv`xfjfodufnat``", +"````atepbufodualfcdp`lauauchfi`lapek`gcicieretfecl`gfhed`hesfm`gfefvfvfvdxbl`oederetfm`wdlfkfxaybzau`d`j`xduf`fgdufga```", +"`````yepddfjacccbz`benamfd`f`mfdbr`mdwcidtcfclfmfebldadneddnesdadadx`hdaededdaclflfmflfmehbyaiaydofuarasftccfjdidiei`t``", +"````a``yczczfbbcbc`bacficucraqfdanfkflaz`oehbbesbldndxfefefeesfvbqbqdnbbdtedciciazaqfkazaz`ubw`laicbas`pdjcccc`advddat``", +"````fo`yddccf`fcalcefucbcufpbi`fbyav`wazbt`ucldxed`hblescldn`hbqdndncl`gazedazazazfw`wekfzanameffucbbzbxbz`jf`fbevbuep``", +"````at`yfbaccy`a`bdsceaiffbzbichfi`manekaq`uclbkcffheletfvesfh`hesdx`qclci`gfkapap`wekapezanfzaifubxeffcfc`bdubufgepat``", +"````a`czdvf`bcdv`bffbzbicrax`fbiezcofifiekbkfk`geredeserbqdndndtadfhazcfblfecl`u`laiflaq`f`lez`ucbdgff`j`bdpccdddiepep``", +"````atczdidvaocy`v`edsbcaxdwbxfzefchameqecdlbl`gazdh`qfhaaadelesfhdaflblbkblerazapfidwbhchaqdobibzalfp`pccbgdveiczepat``", +"````a`epfoczdi`dccac`jaufzcraxaubxdwez`wfkehekbbclbkelaa`obqeleddldafkdmekfm`wfk`wfibwfidobhaiaxef`j`pdsbcacbcaodiddat``", +"``````eifgczevccfbau`jefdgffbhamaxfxezfd`w`l`odl`udcbk`wdneldtegadaaazetdlfmanan`waqfkehfifpbic``p`dbzagftao`vdifbfg````", +"``````a``yfgdv`b`v`ifcbz`b`ibwbtamfxfxfmfxekdhcfby`lciehec`wdlaverapcdecelaz`lby`lfidofiap`mcefxfp`idsagbcagajeicza`````", +"``````ata`czfbdv`vdjceasac`ibiamfian`maifxanazehave`apekehap`uege`ecazcfbkekdwfkfifiauchefbiencuftbcdvfbfof`fbdi`y`y````", +"`````````yczbudvdvdvfbcubgfcaucrbicraxfzchco`wekfke`aqflav`uaa`udm`u`w`uamfzchfmanameffpdgaidgfpaldvaoevf``zfbfgbu``````", +"````````a``tejeif`ajddajdsccbz`pbi`jfpdoanfzanbtai`f`ufkfkdq`lanebexaidcfme`fafiancodgenenbiai`pcracccf`bpddbufg`t``````", +"`````````t`yfgfgbpacaoakdubgbiauffdsenanfidoamaidgcdcoezbtecdc`mdmanbifidoanan`uapfzaxfpfpbhcecr`xbcbgbxddbufoej`t``````", +"```````````t`yfoddaodidv`i`xaleffpc`chfxamchezaichezfmfzanbwanfpcb`famfkanfxfzezcoanbifxc`ffefacbgccacf`ddddej`t````````", +"```````````tcnfobpdvbgdvbgbxftefbibxaiaudofzaxfichanfxfpfxezananfxchdgefezfzfxcuc`crdsfpcubz`jft`eeofcfbfoejfg`r````````", +"````````````eyfgbudiaoajbgdvbecrfpfpff`bffefbwaichchdgdgbhdgbjbidoaicofxfpaicubxds`afpdgas`e`vduag`z`zajdibuey``````````", +"```````````````t`rbuddeodvft`zalbccr`ec``bc`auenfp`jezchfxaidpc`fxdgfpfiamfcdgfxcvcrfcfpalcr`zbeajf`dvajbfey````````````", +"```````````````rbfbpfofbbgdvaffjfjcc`jfxbxfcc``b`bdsbiau`jc`biaibifxfpfcch`afpc``d`d`vdvfjfj`zdvajfbdvbp`tcn````````````", +"````````````````cnfnfnbpfnaoftftdj`ecuftfpaubidgfp`j`bfcfpfc`afpdgc``jfpencuc``b`j`e`vcrevdkdzewbefnfobfej``````````````", +"``````````````````bffnfnajfodvddccftaf`e`b`jdgcuai`jcv`jc`fcdj`jbxcvcvdsdsbxbxdjcr`xbxdjft`z`zddbefnbf`r````````````````", +"````````````````````d`eyewbeduak`zfjemcads`dfp`jdj`b`bcu`jcudgfpefds`bcacacvctct`dagak`xaoddbeeybpfn`r``````````````````", +"``````````````````````eyfnbpdkdz`z`zbmakfj`bag`v`dctctctctem`d`ecvctaeaeafcu`v`ecc`zakafbp`kbpewbfew````````````````````", +"````````````````````````eyeybfbpdk`zemcvcyafemakcvcvaeaeffdjcvcv`j`vae`vemaf`vagcc`z`z`zeodkbfd`ey``````````````````````", +"``````````````````````````cnbnfobe`kbe`kevemdzfj`k`z`b`edjctaeaeemds`eaf`vevdzdjafemd`dk`zbfd`ey````````````````````````", +"``````````````````````````````bncneybf`kbeaf`kememem`kcvafemakaeaeakemem`kdk`z`kbebm`zd`d`ah````````````````````````````", +"````````````````````````````````ahcnewd`dk`z`zaeaf`kaf`k`vemaedzcvakak`z`kdzd`dkdkbmbfbnah``````````````````````````````", +"````````````````````````````````````cncnbf`z`sd``s`k`z`s`zbm`s`kd`d``s`s`k`kd`ahd`bncn``````````````````````````````````", +"``````````````````````````````````````````bnd``s`s`kbnd`d`bfd``kbnbnd`bnd`ewahbn````````````````````````````````````````", +"````````````````````````````````````````````````ahbnahbnd`ewdkbfewahahewbn``````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass11.xpm b/hacks/images/bubbles/glass11.xpm new file mode 100644 index 00000000..0eb808c1 --- /dev/null +++ b/hacks/images/bubbles/glass11.xpm @@ -0,0 +1,268 @@ +/* XPM */ +static char *glass11[] = { +/* width height ncolors chars_per_pixel */ +"72 72 189 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #272751", +"`j c #23234D", +"`k c #29293F", +"`l c #2C2C63", +"`m c #2A2A61", +"`n c #33334C", +"`o c #353579", +"`p c #272754", +"`q c #414188", +"`r c #20202C", +"`s c #2E2E3D", +"`t c #1C1C28", +"`u c #2E2E68", +"`v c #242447", +"`w c #2C2C66", +"`x c #222245", +"`y c #181824", +"`z c #25253E", +"a` c #161622", +"aa c #B9B9ED", +"ab c #3E3E67", +"ac c #1C1C3F", +"ad c #6767A3", +"ae c #2B2B47", +"af c #272743", +"ag c #222248", +"ah c #292931", +"ai c #29295C", +"aj c #1D1D39", +"ak c #252544", +"al c #1E1E47", +"am c #2B2B61", +"an c #29295F", +"ao c #1F1F3E", +"ap c #2F2F68", +"aq c #2D2D66", +"ar c #30305F", +"as c #2C2C5B", +"at c #11111C", +"au c #262655", +"av c #31316D", +"aw c #4C4C6D", +"ax c #222251", +"ay c #323264", +"az c #2D2D69", +"b` c #33335B", +"ba c #43436E", +"bb c #2B2B67", +"bc c #212146", +"bd c #37374B", +"be c #22223D", +"bf c #252536", +"bg c #1D1D42", +"bh c #2A2A5C", +"bi c #28285A", +"bj c #2B2B53", +"bk c #333372", +"bl c #2F2F6E", +"bm c #2B2B3F", +"bn c #2C2C36", +"bo c #424266", +"bp c #232337", +"bq c #2F2FB0", +"br c #34346C", +"bs c #525265", +"bt c #32326A", +"bu c #1B1B2F", +"bv c #3B3B55", +"bw c #303068", +"bx c #21214C", +"by c #2C2C64", +"bz c #292957", +"c` c #232351", +"ca c #26264A", +"cb c #2F2F60", +"cc c #202044", +"cd c #5D5D97", +"ce c #2B2B5C", +"cf c #363674", +"cg c #3C3C66", +"ch c #252556", +"ci c #30306E", +"cj c #3E3E54", +"ck c #414178", +"cl c #2C2C6A", +"cm c #2F2F4F", +"cn c #25252E", +"co c #27275B", +"cp c #363663", +"cq c #4C4C68", +"cr c #20204A", +"cs c #2E2E5B", +"ct c #29294C", +"cu c #242451", +"cv c #27274A", +"cw c #343464", +"cx c #4F4F64", +"cy c #252548", +"cz c #16162C", +"d` c #292938", +"da c #333384", +"db c #3C3C6F", +"dc c #353572", +"dd c #1E1E37", +"de c #38386B", +"df c #414156", +"dg c #242454", +"dh c #31316E", +"di c #181831", +"dj c #232349", +"dk c #272739", +"dl c #393979", +"dm c #4C4C85", +"dn c #2F2F83", +"do c #28285B", +"dp c #292952", +"dq c #36366C", +"dr c #48486D", +"ds c #23234C", +"dt c #37377A", +"du c #20203F", +"dv c #1E1E3D", +"dw c #26265C", +"dx c #313174", +"dy c #4C4C60", +"dz c #27273F", +"e` c #3C3C78", +"ea c #48485C", +"eb c white", +"ec c #383874", +"ed c #333379", +"ee c #444458", +"ef c #272756", +"eg c #47477C", +"eh c #32326E", +"ei c #1B1B33", +"ej c #1E1E2C", +"ek c #30306C", +"el c #40407F", +"em c #292944", +"en c #212150", +"eo c #23233E", +"ep c #141422", +"eq c #343473", +"er c #323271", +"es c #2D2D76", +"et c #2E2E6D", +"eu c #40406E", +"ev c #21213F", +"ew c #272731", +"ex c #8080BA", +"ey c #23232D", +"ez c #25255A", +"f` c #1B1B39", +"fa c #35356D", +"fb c #191937", +"fc c #262651", +"fd c #313169", +"fe c #2C2C6E", +"ff c #22224D", +"fg c #18182C", +"fh c #373786", +"fi c #2D2D65", +"fj c #232344", +"fk c #2B2B63", +"fl c #292961", +"fm c #27275F", +"fn c #202037", +"fo c #1C1C33", +"fp c #242452", +"fq c #45456F", +"fr c #484868", +"fs c #535380", +"ft c #1F1F43", +"fu c #2C2C5D", +"fv c #3535DD", +"fw c #353573", +"fx c #262657", +"fy c #393963", +"fz c #242455", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````bsbsbsbsbsbsdydybsbsea````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````eabsbsdybsbsbsbsbsbscqcxbsbsbsbsbscxdy````````````````````````````````````````````````````", +"````````````````````````````````````````````````dydybsbsdycqcqdycxbsbsfrcqcxdyfrcqcxcxbseacxcxbsbs``````````````````````````````````````````````", +"````````````````````````````````````````````eaeaeafrcqawawawdrdrawcxawawcqcqawawawawawbscqfrfrdycxcxea``````````````````````````````````````````", +"````````````````````````````````````````frdfcxcqawcqcqawawfrcqdrawfrawawcqawawawfqawcqawcqdrawdrfrdycqdycx``````````````````````````````````````", +"````````````````````````````````````eeeaeaeadycqdffrboboawfqfqfqdrdrfqbabadrdrdrdrbobodrdrbaawdrdyfreaeaboeeee``````````````````````````````````", +"``````````````````````````````````eeeefreeeefrbofrfrbofrfqeudrbadrfqdrfqeubabababababafqdreufqfrbafrfreeeeeacjdf````````````````````````````````", +"``````````````````````````````eecjboeebocjboboababboabdrfsfqfqbabobobafqfqawdrfqawbaeueudrdebafrbocgbobobobodfdfcjbd````````````````````````````", +"````````````````````````````dfeeeedfcjbvab`ccgfyeuabboabbabaabdbadeucgdeabbabadbegfqfqfqbaeueueubobob`bocgcgdfeacjcjcj``````````````````````````", +"``````````````````````````cjbddfcjbv`ccgdffycgfqbofyfyabdbeuabfqexbaeueudefqexadckdbbadedebaabdedeeufyboabcpfycjdfdfeecj````````````````````````", +"````````````````````````cjcjdfdfbvb`cg`cfyfyfyfycgabcgdeeudbbregexdbdbadcddmegexeucgdedbdbayfydbdbabcgfycpb`bv`cbvcjdfbdcj``````````````````````", +"``````````````````````bdbdcjbvbvfy`c`cb`cpcgfyfyfycpdededbdeegexdmaaebexckaadm`ucddbdedbdbcwcpcpfddedeb`fyb`bvfycjcmbdcj`s`s````````````````````", +"````````````````````bd`nbvbvbv`ccg`c`ccscpcwcwcgdebrcwbraydqckdbcdegegcdcdade`btdcadbrdqfabrdebrcpbwaycpfyfyb``car`n`nbdcjbnbd``````````````````", +"```````````````````n`s`n`ncj`nb`b`b`b`b`b`arcpdqfabrbrcwaybtbrexadcddbadaae`dedeexaddbdqdebrdedbdededeayb`b`cpb`b`fy`n`c`ncmbdbd````````````````", +"```````````````````n`sbdaecmcmcscscscpcscscpcwfsbwfiaqfdaybtecadexaafsexe`exckdbbtecdedqfdaycpbrekcbcsaycb`icsaycpb`b``ncm`naebd````````````````", +"`````````````````scj`c`ccmctbjcsb`cparasascsdqayaybwecbwbrbrbbe`dee`ebadegcdexadegdbcdade`ecbrbwfk`ffuarcwarcscscscpcscmcmct`nd`bd``````````````", +"```````````````s`saecv`nbjaecmasarar`parcsayfdcb`fbrbtaq`fbtciecdmdbdeebcdebcdebehece`egfabtaqecbrcbazap`fayarcsas`casbjarcmem`n`sbn````````````", +"``````````````ew`s`zcv`nevcmbjcscsbzcscwaydedqbwavfafdfadcdcckadebcke`aaehdhadebe`dcehdcbtbran`fbr`fbrfibtayaybzbjarcsb`bjbjafbm`sae````````````", +"````````````bnaeae`kcmagdjfuaycsb``ffucscsbtbwdcaqfifdfabwave`exaaadcdcddh`oecadcddmfwapdbe`fdaqbrapbtbtfdecaqbhbzarcs`adpcmaf`zcmcncn``````````", +"````````````dz`n`kctcmct`idparcwaybw`farfubrdqbr`ffdfafaecekerdcfeazeleqavdmexaddmelcibkegbrbtbkfa`uehbwfifiambzfxcscs`abjbjakctcmcm`z``````````", +"``````````ey`saf`zafbjcv`befascsfuar`ffdbrde`faq`wdcdcbkerclesdlcfdmcdblfwcdebaddmdldxercdecbkavbkapbrbtfdbt`fcbbwcbbjbzcactaebectfn`zey````````", +"``````````a`bf`zcacvdpcv`icucscsbi`fefbhar`fbr`uekbrekcierdxdxdlcieleqes`odmelelexdmcfere`eldcetaqfibwfadcapcbcscsbtcsfcccakdp`vcv`zfncn````````", +"`````````tbpaecvao`vcccydsbzcsbzffaifiekbwbtbrap`uekbber`odladdteddndnbqdxeqedeqebeleceqdtelelerbyfkavdcfiancwarbtfdcsbjdjfcbjctaebpddbpbf``````", +"````````bf`rfodpevcv`vfjcybz`idpefbhayapetblapfdciblcleqeteqeldldxdxdadadaesdadtadcdcfereqdldcekapap`wflbwayamcbbhcbasasdp`pbjakcvfjfo`y`y``````", +"````````ewdddidvdj`abzagdpcu`p`lbzambwfdbbclehdcerfeetetflfedaedbldxdadndaeddada`qdmcfeqdxdheqblfkap`waqfddq`fdgaycs`pcsefef`afjeveieifo`k``````", +"```````ybfevei`zft`afubzcsas`fam`fbwfaecdcdcdccfetbbblcieretedesed`h`heldm`qdafvdndleceqercledetaqbrapbkfaayfabwbz`fbiascs`p`j`vftf`a`epbu`t````", +"```````y`ybufnaefc`bdpcucs`pfubw`lbwbrdqdcehavfw`wcfcfereqfwercidt`hdae``qdtbqbqeddle`cfdtdxercifk`uavavecbwbw`fbz`m`mefay`jbc`d`aaobua`fg`t````", +"``````epbuddcvfjefca`bdsbzbzbhezbyaqaqbrdqehecdcfddccfeqdaedblazdtfhfhdxdtdnfednfvfvcfdtererdcehfl`wfkbkfafaap`fcefifiasasfudjbc`bcadudda``t````", +"``````a`foeoemak`adparcsarefaidwamapbwapbyazeheccfeccfdxbqesfmblesbqeldtdtbq`g`hfvbq`q`qeqerfweqclbbfmdhbwfa`ufubifxbtarcscb`b`bcv`v`vfgfgbu````", +"````atejfgfgcy`v`bbcfuasef`ffiezchco`uazezezap`uekdlererereqeddadnfvfved`ofvesesbqfvdle`dleddtdlclfmfkerbr`mapfibtbi`lbzfufuccfccvccdvfg`yfoat``", +"`````yfodiaj`v`v`x`bdpcsbzdeamamaxfkaqehfm`wav`ueteretbkbkcffhdxfednfefv`hbqdadxesfedtfwcfdtfwe`dcflcldlbkfdfibtap`fanfpayasao`idpagczfneifg`t``", +"````atfgfofgagccao`abjasbzcbfufxbibtbwfdapecdlavekerblbkeqeqdaesfedafvdndn`hfvfv`hdxeddtdtcffwdlecdhcleqehbkaqaqfkfkco`f`fayafctdjcadiajdv`yfo``", +"````atejbpczaocc`aaldpbzbzfudoen`mbtfiambtbtereretererbletetfeesbq`hfv`g`gdn`hdafhdabqfvbkbkdldlfwerclfkekecaqaqfdfidgef`b`pctccftakfoajfgbua```", +"````ata`befofoft`daldp`p`laubzambi`lby`lehfm`gavciererclfe`g`gfhdtdxed`g`gesfmdnfvfvdndnetdxedblblazfmfmapec`mfzcbarc`bzbxfcaoccftf`fgbcepfgbu``", +"`````y`yevbefjdv`xfpdp`jenbifd`lfufkfdbtazdw`merdtdtci`g`gfebledfhesdnfeesdafvededfvdaed`hdadaclflfmflezfibtbycobwfudgfuarfuds`v`xaodidia`atat``", +"````atfgaobudif`acfp`ebxacfu`fc`fxfdfdan`mdw`gaz`ocfekcletesdndxfecletesdn`h`hfvfhedclfheqfherek`gbyazfm`uaz`ubtamanfucbceaufcccccducaevfoatat``", +"````atfoejfof`fbcc`jcrbheffufualaxamfiancifkbbciehekflcleleqdadxfedn`gbq`hfvesdnblfmflbberedcletazeqazehapfm`w`lfubzcbcsbzcr`jdpacf`ftdvfn`yat``", +"````atfgbufodjfjdudp`afpfu`l`jfcbiefdoapavfkfketazbyazbldxdt`hes`hesdxdx`h`hesdndaet`gazeler`wazdhdhcidhanbxezfzchbibh`p`pfceffffcf`czfodd`yat``", +"````atatczdif``b`v`v`afffu`facfcfubidgfmcoez`lapbbap`gbbedecfhedetdaesesfv`h`qcifhfhdadletfl`wekfianfkcifk`lfkchfl`lbzcrcufc`ift`aaodddda`buat``", +"````at`tdif`dvagcycc`iff`pefcraxfz`fbianezfkap`uehfw`ufl`gcieqcderfh`hdnedeqdcfedmazdldxdl`gazaq`lfmfmdwfi`l`lan`wfdfucrc`fp`b`d`daoddbufnatat``", +"``````fga`f`dvdvcycc`xffdsdscrchezcrfzeffxezfieqecdlbkfebbcidh`qfhfhad`qelfedndadnfkblcfclcierazapaqdwaibhchaqanfxcecealfpef`x`bdvf`eiczfg`y````", +"``````at`yeiczeiajftftac`j`pfpaxalaxefbxfzch`maqfkbkerazclblbkdmdtdaaaedexfvaddafe`udmblflfkazbbazaqfiaqanbiamanaxfpbzds`pfcbcccdvftaoei`yep````", +"``````a`a`didif`f`acbxalfp`pbxax`jcefufzfzfmfmbbfifkfibkdhaveqelexfv`qcddndmcdadfeekdl`hflanfkfm`wfdfkapapbhcuefchcuau`bbz`jacccf``vdidvat`y````", +"``````a`epfoczdv`baoacefbxbzcscr`pfi`fcochchezez`mavekdcecfmfmdmfa`wdlapexcdcddmaabbazes`wfd`lan`maqaibwehapcofiauauau`befalbcdp`ddvfodieiat````", +"````````ata`difbftao`a`bbzfu`bagbzfdbrfiandoaiaifp`wekeqfw`wfkeke`apckaqelecerfkckcdfherer`ufk`wbyaqaidoanamanbzcufx`b`pbgbcbgccagdieiczep``````", +"````````at`yfgf`difbctagbzascrbcefaubififx`lananezdo`mcidhapav`uelcddcecape`dcflfaekbkeqekdwcofkfiapaidgefchbic`ffalftaldvf`bpf`fbdidia`a```````", +"````````at`yczddeiaof`dvfb`jbgccasc`crbhcrfpenchchcoanekeh`we``wfkelececaaek`qcdaqfk`ufiezdgdwfman`lbhenfzfzaifpcealcraoaodueobeajdifg`ya```````", +"``````````a`bueibueiajajddddbcbgalbzfcbh`j`pfpdoaichchavapdodmbtbyad`mfkbydweccfckaielfmbybt`l`mcodwanaxaxenbifxbzdsbxf`ftacfndkajfofgfg````````", +"``````````a``teifgbubeftdvafccbgalamef`j`dbxcofkaqcodo`famdgdeanaidqanape``me`fiaianfk`m`mbwfdapaqfzffenfpc`bhfu`pftagagft`jddddfofofga`````````", +"````````````fg`tbueibpf`dvevfbevbgfpfpcrenbxaxamfiananfkbiaxfpezezfxfkecbwbifzch`mezfiamdocochfi`lcobibibzfpfpbzcufjevccac`efgbubu`tej``````````", +"`````````````tbu`rejf`aodidvdjfcagacbzbhaxdochfxanfzfpbiaichanbychchchbt`lfzbhezcofxaiaichchaufzc`fxch`jdoffenefbgalbgbcbccceiddfo`y`r``````````", +"```````````````rejeifodvdvajacbcccccdgbibxfpdgaufuezfz`manfzanfxaufp`fcodocoezchchenauchfxchefff`jagffbxenbzbi`dftbc`edz`df`buddbudd````````````", +"```````````````y`rbuf`diaoajacbgevevcrfpfpfp`afffffc`faqfxchchfzc`dgfxdgbjfxaiaiancofxfpcodg`bffds`adgbxbzbz`e`v`vftbeev`zajf`ddei`t````````````", +"`````````````````yfoeyfbaj`zajbgevakalbxcccu`e`b`bc`efbic`axaxchfxfpezchbjfcdodochfx`fanbzcuaufxcv`bfp`pef`e`eeoeoaof`f`ajdv`rfn`r``````````````", +"``````````````````cn`rejeidvacdveoak`vccccfffpbibx`ac``jcucu`jfxbifxfpfxfxfxcodgc`aybiai`i`jch`j`a`edjagacbc`x`zfnddajf`eodvey`t````````````````", +"``````````````````eybfej`rejfoaoevcccc`v`xbcc`c`fffpbicubxcucuffc`cu`pfcfpdgbhdoaucu`jcuffbxbx`bcr`efjagbcfjeodkeodkevddfobpcney````````````````", +"````````````````````eyejbpejbpdddvaoaodjbcagbcft`jefchfxbiauc``a`ac`c`fc`afcfccufcenfp`jfffp`jdsfpftcycrbcccdz`zdkbebebfddbf`r``````````````````", +"``````````````````````cnbpeyfofofodudd`eacdjafcr`d`dcufpffef`jca`bff`jfcbxcuc`dsaecv`d`jds`dcy`vag`xagbcfteo`zbpfnbpbfej`r`r````````````````````", +"````````````````````````d`bpddbfbebgak`zfj`z`kdsdsbxffff`bdj`b`b`jcucucudgcueffp`b`bcacacvcvctct`dagcyfjccevddeoeybpd`ej`r``````````````````````", +"``````````````````````````eyddbp`r`k`z`zdzem`kfjfj`b`d`vdjcyctctcactctcv`dcr`bcvctaeaecv`b`jfjdsccakcveoakbedz`zd`ahewah````````````````````````", +"````````````````````````````ewcnbnbndd`kdzfjdzemakemae`zcv`dcaaeaecy`e`acadsag`vaeaecvakaffjcacrbcajfj`zbp`z`kfnewewcn``````````````````````````", +"```````````````````````````````rewbfbp`z`zbedzafcyakembeafctcaak`d`v`acvaeae`dff`dag`baeakfj`zcy`zbm`z`z`k`zbfd`ahcn````````````````````````````", +"```````````````````````````````````sd`eyfnbmeobm`zdz`saf`v`k`kcvbcag`bcvemaeaecvagcyaecvevafaf`zem`zd`dkbmd`bfbf````````````````````````````````", +"````````````````````````````````````ahewfoewbf`k`z`zdz`zafemememcvaf`kdz`vafaeafakemembmbpafdkdkbp`k`zbp`seyah``````````````````````````````````", +"`````````````````````````````````````````sah`zewdk`z`zdzaeaf`kemdzakakaeae`kemakemeo`z`kemdkbfbpdk`kd`d`bn``````````````````````````````````````", +"````````````````````````````````````````````ahbnbf`zd`d``sbm`kdz`sdkdk`sae`k`zbmd``k`sbmdz`kbnah`s`sbn``````````````````````````````````````````", +"````````````````````````````````````````````````bncnbmbnd`dkdkdkdkbm`sbnbnbndzd`d``sbm`sbfd`bnewah``````````````````````````````````````````````", +"``````````````````````````````````````````````````````cnd``s`s`sahd`dkbmbnbn`sbnd`bnbn`newah````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````ahcn`sbnahewbn`sewahbn````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass2.xpm b/hacks/images/bubbles/glass2.xpm new file mode 100644 index 00000000..ee236e5a --- /dev/null +++ b/hacks/images/bubbles/glass2.xpm @@ -0,0 +1,94 @@ +/* XPM */ +static char *glass2[] = { +/* width height ncolors chars_per_pixel */ +"12 12 75 2", +/* colors */ +"`` c None", +"`a c #25254C", +"`b c #23234A", +"`c c #212148", +"`d c #2E2E62", +"`e c #29293F", +"`f c #272754", +"`g c #414188", +"`h c #20202C", +"`i c #2E2E68", +"`j c #242447", +"`k c #25253E", +"`l c #B9B9ED", +"`m c #6767A3", +"`n c #2B2B47", +"`o c #29295C", +"`p c #252544", +"`q c #29295F", +"`r c #1F1F3E", +"`s c #2F2F68", +"`t c #2D2D66", +"`u c #30305F", +"`v c #4C4C6D", +"`w c #2B2B53", +"`x c #2F2F6E", +"`y c #34346C", +"`z c #3B3B55", +"a` c #303068", +"aa c #2C2C64", +"ab c #26264A", +"ac c #5D5D97", +"ad c #363674", +"ae c #3C3C66", +"af c #252556", +"ag c #30306E", +"ah c #3E3E54", +"ai c #2C2C6A", +"aj c #4C4C68", +"ak c #20204A", +"al c #2E2E5B", +"am c #343464", +"an c #16162C", +"ao c #292938", +"ap c #333384", +"aq c #3C3C6F", +"ar c #1E1E37", +"as c #38386B", +"at c #242454", +"au c #31316E", +"av c #181831", +"aw c #232349", +"ax c #272739", +"ay c #23234C", +"az c #37377A", +"b` c #1E1E3D", +"ba c #313174", +"bb c #3C3C78", +"bc c #383874", +"bd c #1B1B33", +"be c #40407F", +"bf c #292944", +"bg c #212150", +"bh c #2D2D76", +"bi c #191937", +"bj c #313169", +"bk c #22224D", +"bl c #18182C", +"bm c #2D2D65", +"bn c #232344", +"bo c #292961", +"bp c #27275F", +"bq c #242452", +"br c #484868", +"bs c #262657", +"bt c #242455", +/* pixels */ +"`````````vajajajbr``````", +"````ahaeae`yacasaq`zah``", +"`````w`f`dagacbb`y`u`u``", +"```naybm`i`mbabcaaamawar", +"``bf`ua`adbpaz`gai`ial`j", +"``bnbgbjaz`xbhapboaa`uav", +"``b`aybtbcaube`x`s`tbqbd", +"``anbiakafbb`l`i`q`o`rbl", +"`````rakbkaf`wbsay`c`k``", +"````ao`pay`aatab`bar`h``", +"````````ax`e`n`kax``````", +"````````````````````````" +}; diff --git a/hacks/images/bubbles/glass3.xpm b/hacks/images/bubbles/glass3.xpm new file mode 100644 index 00000000..e22c86cf --- /dev/null +++ b/hacks/images/bubbles/glass3.xpm @@ -0,0 +1,111 @@ +/* XPM */ +static char *glass3[] = { +/* width height ncolors chars_per_pixel */ +"14 14 90 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #383858", +"`c c #2E2E62", +"`d c #292967", +"`e c #3535A1", +"`f c #272751", +"`g c #23234D", +"`h c #29293F", +"`i c #353579", +"`j c #272754", +"`k c #20202C", +"`l c #2E2E3D", +"`m c #242447", +"`n c #25253E", +"`o c #3E3E67", +"`p c #1C1C3F", +"`q c #6767A3", +"`r c #2B2B47", +"`s c #29295C", +"`t c #2B2B61", +"`u c #29295F", +"`v c #1F1F3E", +"`w c #2F2F68", +"`x c #2D2D66", +"`y c #222251", +"`z c #2D2D69", +"a` c #33335B", +"aa c #37374B", +"ab c #22223D", +"ac c #28285A", +"ad c #2B2B53", +"ae c #2C2C36", +"af c #424266", +"ag c #232337", +"ah c #525265", +"ai c #32326A", +"aj c #1B1B2F", +"ak c #303068", +"al c #232351", +"am c #363674", +"an c #3C3C66", +"ao c #252556", +"ap c #27275B", +"aq c #363663", +"ar c #4C4C68", +"as c #2E2E5B", +"at c #29294C", +"au c #27274A", +"av c #252548", +"aw c #16162C", +"ax c #292938", +"ay c #353572", +"az c #38386B", +"b` c #4C4C85", +"ba c #2F2F83", +"bb c #20203F", +"bc c #313174", +"bd c #333379", +"be c #444458", +"bf c #272756", +"bg c #47477C", +"bh c #32326E", +"bi c #1B1B33", +"bj c #30306C", +"bk c #40407F", +"bl c #23233E", +"bm c #141422", +"bn c #343473", +"bo c #2D2D76", +"bp c #2E2E6D", +"bq c #40406E", +"br c #21213F", +"bs c #8080BA", +"bt c #25255A", +"bu c #1B1B39", +"bv c #35356D", +"bw c #262651", +"bx c #18182C", +"by c #373786", +"bz c #2B2B63", +"c` c #202037", +"ca c #1C1C33", +"cb c #242452", +"cc c #484868", +"cd c #1F1F43", +"ce c #2C2C5D", +"cf c #3535DD", +"cg c #262657", +"ch c #242455", +/* pixels */ +"``````````arccaharcc````````", +"``````bea``obqbqbqanafaa````", +"`````ladaqbv`qbsbgai`ca``b``", +"````a`a`asaib`bhb`bhakasau``", +"``c``j`c`d`dbd`eb`am`wce`aca", +"``bxasaobt`ibdbycf`iay`u`abx", +"``bl`a`t`ubnbdbocfbcbt`cbwbu", +"``bi`fch`sbhbkbabp`z`u`w`gaj", +"``bm`a`a`u`xbjaibgbzcgbf`paw", +"````agbralazap`t`ucbacbbaj``", +"`````kbrcdcbcbcgbw`y`vab`k``", +"``````axbrauatav`r`m`n`n````", +"``````````ax`h`r`nae````````", +"````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass4.xpm b/hacks/images/bubbles/glass4.xpm new file mode 100644 index 00000000..6dc1aad9 --- /dev/null +++ b/hacks/images/bubbles/glass4.xpm @@ -0,0 +1,178 @@ +/* XPM */ +static char *glass4[] = { +/* width height ncolors chars_per_pixel */ +"20 20 151 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #29293F", +"`j c #2C2C63", +"`k c #2A2A61", +"`l c #33334C", +"`m c #353579", +"`n c #272754", +"`o c #20202C", +"`p c #2E2E3D", +"`q c #2E2E68", +"`r c #242447", +"`s c #2C2C66", +"`t c #222245", +"`u c #181824", +"`v c #25253E", +"`w c #B9B9ED", +"`x c #1C1C3F", +"`y c #6767A3", +"`z c #2B2B47", +"a` c #272743", +"aa c #222248", +"ab c #292931", +"ac c #29295C", +"ad c #1D1D39", +"ae c #252544", +"af c #2B2B61", +"ag c #29295F", +"ah c #1F1F3E", +"ai c #2F2F68", +"aj c #2D2D66", +"ak c #30305F", +"al c #2C2C5B", +"am c #11111C", +"an c #262655", +"ao c #31316D", +"ap c #4C4C6D", +"aq c #222251", +"ar c #323264", +"as c #43436E", +"at c #212146", +"au c #37374B", +"av c #22223D", +"aw c #252536", +"ax c #1D1D42", +"ay c #2A2A5C", +"az c #28285A", +"b` c #2B2B53", +"ba c #333372", +"bb c #2F2F6E", +"bc c #2B2B3F", +"bd c #2C2C36", +"be c #232337", +"bf c #34346C", +"bg c #525265", +"bh c #32326A", +"bi c #303068", +"bj c #21214C", +"bk c #2C2C64", +"bl c #292957", +"bm c #232351", +"bn c #26264A", +"bo c #2F2F60", +"bp c #5D5D97", +"bq c #363674", +"br c #3C3C66", +"bs c #252556", +"bt c #30306E", +"bu c #414178", +"bv c #2C2C6A", +"bw c #20204A", +"bx c #2E2E5B", +"by c #29294C", +"bz c #242451", +"c` c #27274A", +"ca c #343464", +"cb c #4F4F64", +"cc c #252548", +"cd c #292938", +"ce c #333384", +"cf c #3C3C6F", +"cg c #353572", +"ch c #1E1E37", +"ci c #38386B", +"cj c #414156", +"ck c #242454", +"cl c #181831", +"cm c #232349", +"cn c #272739", +"co c #4C4C85", +"cp c #2F2F83", +"cq c #28285B", +"cr c #36366C", +"cs c #48486D", +"ct c #23234C", +"cu c #37377A", +"cv c #20203F", +"cw c #26265C", +"cx c #313174", +"cy c #4C4C60", +"cz c #27273F", +"d` c #3C3C78", +"da c #48485C", +"db c #383874", +"dc c #333379", +"dd c #444458", +"de c #272756", +"df c #32326E", +"dg c #1B1B33", +"dh c #1E1E2C", +"di c #30306C", +"dj c #40407F", +"dk c #292944", +"dl c #212150", +"dm c #141422", +"dn c #323271", +"do c #2D2D76", +"dp c #2E2E6D", +"dq c #21213F", +"dr c #8080BA", +"ds c #23232D", +"dt c #25255A", +"du c #35356D", +"dv c #191937", +"dw c #262651", +"dx c #313169", +"dy c #2C2C6E", +"dz c #22224D", +"e` c #18182C", +"ea c #373786", +"eb c #232344", +"ec c #2B2B63", +"ed c #292961", +"ee c #202037", +"ef c #1C1C33", +"eg c #242452", +"eh c #45456F", +"ei c #535380", +"ej c #1F1F43", +"ek c #2C2C5D", +"el c #3535DD", +"em c #262657", +"en c #393963", +"eo c #242455", +/* pixels */ +"``````````````cycyapbgcbcybg````````````", +"``````````dacycsehcsehapehcsddcj````````", +"````````au`cenbraseicibucicibrendd``````", +"``````auau`ccacidudrbpdrcfcrarakau`p````", +"`````p`lbx`nbhbfdxcobpcodjdu`sakalb`bd``", +"`````zbybxbocicgbvbbdn`ydbdfbfekbxbybe``", +"``dh`r`rbl`faidydndn`hd`dnbtecafakdwah`o", +"``dhdqejcqajdfcg`meacu`hbqdfdibi`jblbndh", +"``ch`rbxemaidudnbq`geldcbqdbdn`jafbxbnav", +"``dm`x`bdxdxcwbqdycpdocxdcbvedbkcqalebdg", +"```uccctdzbsag`qbqdpeacxbtaidiagekdwcvdm", +"``dmcl`xeoandtdfbv`wdjcediecbiaydectatch", +"``amdvcm`xaf`kagaodi`qdbbaecanazejdvdv`u", +"````e``xcvandlcqckdtcgagcq`qaqay`tbjef``", +"````dsclaxbwdzdebsckb`acegbjeg`eaaadds``", +"``````eeeeejbzanegdw`abmdl`b`rcnavaw````", +"````````eeczbc`b`dby`dbya``eae`iaw``````", +"``````````bdawa`dkc`aeae`i`i`vab````````", +"``````````````bd`pcdcdbdcdbd````````````", +"````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass5.xpm b/hacks/images/bubbles/glass5.xpm new file mode 100644 index 00000000..72aafe7e --- /dev/null +++ b/hacks/images/bubbles/glass5.xpm @@ -0,0 +1,195 @@ +/* XPM */ +static char *glass5[] = { +/* width height ncolors chars_per_pixel */ +"24 24 164 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #272751", +"`j c #23234D", +"`k c #29293F", +"`l c #2C2C63", +"`m c #2A2A61", +"`n c #33334C", +"`o c #272754", +"`p c #414188", +"`q c #20202C", +"`r c #2E2E3D", +"`s c #1C1C28", +"`t c #2E2E68", +"`u c #242447", +"`v c #2C2C66", +"`w c #181824", +"`x c #25253E", +"`y c #161622", +"`z c #B9B9ED", +"a` c #3E3E67", +"aa c #1C1C3F", +"ab c #6767A3", +"ac c #2B2B47", +"ad c #222248", +"ae c #292931", +"af c #29295C", +"ag c #252544", +"ah c #1E1E47", +"ai c #2B2B61", +"aj c #29295F", +"ak c #1F1F3E", +"al c #2F2F68", +"am c #2D2D66", +"an c #30305F", +"ao c #2C2C5B", +"ap c #11111C", +"aq c #262655", +"ar c #31316D", +"as c #4C4C6D", +"at c #323264", +"au c #2D2D69", +"av c #33335B", +"aw c #212146", +"ax c #37374B", +"ay c #22223D", +"az c #252536", +"b` c #1D1D42", +"ba c #28285A", +"bb c #2B2B53", +"bc c #333372", +"bd c #2F2F6E", +"be c #2C2C36", +"bf c #424266", +"bg c #232337", +"bh c #2F2FB0", +"bi c #34346C", +"bj c #525265", +"bk c #32326A", +"bl c #1B1B2F", +"bm c #3B3B55", +"bn c #303068", +"bo c #21214C", +"bp c #2C2C64", +"bq c #292957", +"br c #26264A", +"bs c #202044", +"bt c #5D5D97", +"bu c #2B2B5C", +"bv c #363674", +"bw c #3C3C66", +"bx c #252556", +"by c #30306E", +"bz c #3E3E54", +"c` c #2C2C6A", +"ca c #25252E", +"cb c #27275B", +"cc c #363663", +"cd c #4C4C68", +"ce c #20204A", +"cf c #2E2E5B", +"cg c #29294C", +"ch c #242451", +"ci c #27274A", +"cj c #343464", +"ck c #252548", +"cl c #16162C", +"cm c #292938", +"cn c #333384", +"co c #3C3C6F", +"cp c #353572", +"cq c #1E1E37", +"cr c #38386B", +"cs c #414156", +"ct c #242454", +"cu c #31316E", +"cv c #181831", +"cw c #232349", +"cx c #272739", +"cy c #4C4C85", +"cz c #2F2F83", +"d` c #28285B", +"da c #292952", +"db c #48486D", +"dc c #23234C", +"dd c #37377A", +"de c #1E1E3D", +"df c #26265C", +"dg c #313174", +"dh c #4C4C60", +"di c #27273F", +"dj c #3C3C78", +"dk c #48485C", +"dl c white", +"dm c #383874", +"dn c #333379", +"do c #444458", +"dp c #272756", +"dq c #1B1B33", +"dr c #1E1E2C", +"ds c #30306C", +"dt c #40407F", +"du c #292944", +"dv c #212150", +"dw c #23233E", +"dx c #343473", +"dy c #323271", +"dz c #2D2D76", +"e` c #2E2E6D", +"ea c #40406E", +"eb c #21213F", +"ec c #8080BA", +"ed c #23232D", +"ee c #25255A", +"ef c #35356D", +"eg c #191937", +"eh c #262651", +"ei c #313169", +"ej c #2C2C6E", +"ek c #22224D", +"el c #18182C", +"em c #373786", +"en c #2D2D65", +"eo c #232344", +"ep c #2B2B63", +"eq c #292961", +"er c #27275F", +"es c #1C1C33", +"et c #242452", +"eu c #45456F", +"ev c #484868", +"ew c #1F1F43", +"ex c #2C2C5D", +"ey c #3535DD", +"ez c #262657", +"f` c #393963", +"fa c #242455", +/* pixels */ +"``````````````````dkdhbjbjbjbjdh````````````````", +"``````````````csasascdevcdascddbevdh````````````", +"``````````dodobfa`dbeubfeueueacrbfbfcsax````````", +"````````bzcsbwf`bwcrbicobteccratcof`bmbzbz``````", +"```````n`navavanefcjbibt`zcrcobicratccf``nax````", +"``````acbbao`oat`fambycobtdldjbkbialan`can`n````", +"````dicg`icj`fbi`fefdyauarabbybiefbnaicfbbcg`x``", +"````ac`udcbqenbk`tdyabczdgdxdmdtbpcpcjeicwcgcq``", +"```wdq`acfaiefcpe`bydn`hcyeydmc`ambcef`fcf`u`y`s", +"```ydudaandfbnaubvdgerbhdd`h`pdyc`cu`tezcf`b`ubl", +"``elad`abqezbndmdsbccncnczeydnbvdmdxamep`fcgcv`w", +"```weoetdv`leidfdd`gbddzdzdncncneqeebpexan`ucvap", +"``elcwdaexehd`epaubd`hdz`hcz`gdycucueeba`oekcl`w", +"``eldebsdcbxfaeedmejcuemdtcnbdbyalafambuet`bdq`w", +"```yclakboce`fbx`mcper`veccyauei`mbncbaqdpdaesap", +"````clakegbsceetbxdsdjdt`zbt`tctajdvafahakayel``", +"````eldqdeebetboenepetezbnbxencb`lbaeteoaabldr``", +"``````blakb`ceetekambxctbbafezctdcbo`eew`xcq````", +"``````ed`qakbsawekchchchetd``jboceaddwcxesed````", +"````````cmazag`xdcek`bchctetbrci`deocqbg`q``````", +"```````````qbgayckaybr`uacek`beo`x`xazca````````", +"``````````````aecxdi`kagacag`xcxcxcm````````````", +"``````````````````ca`rcmbebebeae````````````````", +"````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass6.xpm b/hacks/images/bubbles/glass6.xpm new file mode 100644 index 00000000..63b01d0a --- /dev/null +++ b/hacks/images/bubbles/glass6.xpm @@ -0,0 +1,218 @@ +/* XPM */ +static char *glass6[] = { +/* width height ncolors chars_per_pixel */ +"30 30 181 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #3535A1", +"`h c #23234D", +"`i c #29293F", +"`j c #2C2C63", +"`k c #2A2A61", +"`l c #33334C", +"`m c #353579", +"`n c #272754", +"`o c #20202C", +"`p c #2E2E3D", +"`q c #1C1C28", +"`r c #2E2E68", +"`s c #242447", +"`t c #2C2C66", +"`u c #222245", +"`v c #181824", +"`w c #25253E", +"`x c #161622", +"`y c #B9B9ED", +"`z c #3E3E67", +"a` c #1C1C3F", +"aa c #6767A3", +"ab c #2B2B47", +"ac c #272743", +"ad c #292931", +"ae c #29295C", +"af c #1D1D39", +"ag c #252544", +"ah c #1E1E47", +"ai c #2B2B61", +"aj c #29295F", +"ak c #1F1F3E", +"al c #2F2F68", +"am c #2D2D66", +"an c #30305F", +"ao c #2C2C5B", +"ap c #11111C", +"aq c #262655", +"ar c #31316D", +"as c #4C4C6D", +"at c #222251", +"au c #323264", +"av c #2D2D69", +"aw c #33335B", +"ax c #43436E", +"ay c #2B2B67", +"az c #212146", +"b` c #37374B", +"ba c #22223D", +"bb c #252536", +"bc c #1D1D42", +"bd c #28285A", +"be c #2B2B53", +"bf c #333372", +"bg c #2F2F6E", +"bh c #2C2C36", +"bi c #424266", +"bj c #232337", +"bk c #2F2FB0", +"bl c #34346C", +"bm c #525265", +"bn c #32326A", +"bo c #1B1B2F", +"bp c #3B3B55", +"bq c #303068", +"br c #21214C", +"bs c #2C2C64", +"bt c #292957", +"bu c #232351", +"bv c #26264A", +"bw c #2F2F60", +"bx c #202044", +"by c #5D5D97", +"bz c #2B2B5C", +"c` c #363674", +"ca c #3C3C66", +"cb c #252556", +"cc c #30306E", +"cd c #3E3E54", +"ce c #414178", +"cf c #2C2C6A", +"cg c #2F2F4F", +"ch c #25252E", +"ci c #27275B", +"cj c #363663", +"ck c #4C4C68", +"cl c #20204A", +"cm c #2E2E5B", +"cn c #29294C", +"co c #242451", +"cp c #27274A", +"cq c #343464", +"cr c #4F4F64", +"cs c #252548", +"ct c #16162C", +"cu c #292938", +"cv c #333384", +"cw c #3C3C6F", +"cx c #353572", +"cy c #1E1E37", +"cz c #38386B", +"d` c #414156", +"da c #242454", +"db c #31316E", +"dc c #181831", +"dd c #232349", +"de c #272739", +"df c #393979", +"dg c #4C4C85", +"dh c #2F2F83", +"di c #28285B", +"dj c #292952", +"dk c #36366C", +"dl c #48486D", +"dm c #23234C", +"dn c #37377A", +"do c #20203F", +"dp c #1E1E3D", +"dq c #26265C", +"dr c #313174", +"ds c #4C4C60", +"dt c #27273F", +"du c #3C3C78", +"dv c #48485C", +"dw c white", +"dx c #383874", +"dy c #333379", +"dz c #444458", +"e` c #272756", +"ea c #47477C", +"eb c #32326E", +"ec c #1E1E2C", +"ed c #30306C", +"ee c #40407F", +"ef c #292944", +"eg c #212150", +"eh c #23233E", +"ei c #141422", +"ej c #343473", +"ek c #323271", +"el c #2D2D76", +"em c #2E2E6D", +"en c #40406E", +"eo c #21213F", +"ep c #272731", +"eq c #8080BA", +"er c #23232D", +"es c #25255A", +"et c #1B1B39", +"eu c #35356D", +"ev c #191937", +"ew c #262651", +"ex c #313169", +"ey c #2C2C6E", +"ez c #22224D", +"f` c #18182C", +"fa c #373786", +"fb c #2D2D65", +"fc c #232344", +"fd c #2B2B63", +"fe c #292961", +"ff c #27275F", +"fg c #202037", +"fh c #1C1C33", +"fi c #242452", +"fj c #45456F", +"fk c #484868", +"fl c #535380", +"fm c #1F1F43", +"fn c #2C2C5D", +"fo c #353573", +"fp c #262657", +"fq c #393963", +"fr c #242455", +/* pixels */ +"````````````````````````bmbmbmbmbmbmbm``````````````````````", +"``````````````````dscrasasascrckasasasfkckbm````````````````", +"````````````````dsdsdzbifjfjfjfjaxaxfjfjckdzdv``````````````", +"````````````d`dvfqdzenfkfjencaendlaxaxcabibi`zdvb```````````", +"``````````cd`zaw`cfqcacaceflczbydg`zencjcwca`cbpbpcd````````", +"````````d`cdb``cawcqczdkeubycwbyczdwcwczcqaucaawb`b`b```````", +"````````b``lcmcqaoczaublbndgeqdfeqczdgbn`jcmanfnawcg`l``````", +"``````cu`w`wcmcmcqblardxeu`yceareqdueualbleuexdjcmbeba`p````", +"````chabcg`acmbwbqczaiebcfdfdgekeqdudxebcxblbncmcm`ababjer``", +"`````o`aeodmaobdalbn`rcfdf`mdhdrdyeaejdubscxffbwbwdd`b`w`q``", +"````fhbadjcmbq`jcxcxekemeydr`gdy`geeekek`t`rexe`e``ndjdcdc``", +"```q`veocnbtdialbleb`rfo`medfadnelbkc`bffeedeufn`jcmfmbvfg`x", +"``ecbo`sbze`feaeayexavbgej`gbkdyeydhdudnemdbfdal`kfna``udc`v", +"```xeieodjbtfpexfbc`avekbg`gbkelfa`g`gdxcxcfdxamfpbtcpfcdoap", +"```vcya`btegex`kbldqdncfeycvdyelcv`gdycvfefeebaedianfmfcdc`q", +"``fhcyetahfncobdbs`tbncfdybgcf`gdhcfavavav`tfraifnbtbteteoei", +"```xdpaz`bbtcl`fesfbedfdekelbkdhaaavbgcf`jfe`fesbwez`bbxdcei", +"```xfhdcbx`hfratbresfdedcfee`meedffded`t`tbqdiaee``nazazdcap", +"`````vdp`sew`bbqaifpfpdbbsccdxdfekbyee`j`jdialbzfidmazafct``", +"`````vbodpevbcaqbdatcb`tfdamar`ydg`taicbaje`dadaahaketevbo``", +"`````qf`bjakdobdezegfbaidacibncxdgbddiajalatfibz`ubccyfh`q``", +"``````chbjbcbcfmbdaediatcbfpfpajfpdaesfpbudmco`h`eewfhf`````", +"`````````ocydp`waz`e`baqfiesfpdjfpfiaidacpewah`wafdpbb``````", +"````````chfgfgfmddcofibdfi`bfi`ada`hegbu`h`seodtbafhec``````", +"``````````cuepdo`wefdmfidd`b`hdae``bbvcn`dagakbabj`o````````", +"````````````erbbdeefcsefcpabezcp`habef`sbx`wehbber``````````", +"````````````````chbbba`ief`iacagabef`i`wba`wcu``````````````", +"``````````````````chbb`p`p`w`w`pcu`p`icucuch````````````````", +"````````````````````````adadcudeepadbh``````````````````````", +"````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass7.xpm b/hacks/images/bubbles/glass7.xpm new file mode 100644 index 00000000..750c2514 --- /dev/null +++ b/hacks/images/bubbles/glass7.xpm @@ -0,0 +1,230 @@ +/* XPM */ +static char *glass7[] = { +/* width height ncolors chars_per_pixel */ +"36 36 187 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #272751", +"`j c #23234D", +"`k c #29293F", +"`l c #2C2C63", +"`m c #2A2A61", +"`n c #33334C", +"`o c #353579", +"`p c #272754", +"`q c #414188", +"`r c #20202C", +"`s c #2E2E3D", +"`t c #1C1C28", +"`u c #2E2E68", +"`v c #242447", +"`w c #2C2C66", +"`x c #222245", +"`y c #181824", +"`z c #25253E", +"a` c #161622", +"aa c #B9B9ED", +"ab c #3E3E67", +"ac c #1C1C3F", +"ad c #6767A3", +"ae c #2B2B47", +"af c #272743", +"ag c #222248", +"ah c #292931", +"ai c #29295C", +"aj c #1D1D39", +"ak c #252544", +"al c #1E1E47", +"am c #2B2B61", +"an c #29295F", +"ao c #1F1F3E", +"ap c #2F2F68", +"aq c #2D2D66", +"ar c #30305F", +"as c #2C2C5B", +"at c #11111C", +"au c #262655", +"av c #31316D", +"aw c #4C4C6D", +"ax c #222251", +"ay c #323264", +"az c #2D2D69", +"b` c #33335B", +"ba c #43436E", +"bb c #2B2B67", +"bc c #212146", +"bd c #37374B", +"be c #22223D", +"bf c #252536", +"bg c #1D1D42", +"bh c #2A2A5C", +"bi c #28285A", +"bj c #2B2B53", +"bk c #333372", +"bl c #2F2F6E", +"bm c #2B2B3F", +"bn c #2C2C36", +"bo c #424266", +"bp c #232337", +"bq c #2F2FB0", +"br c #34346C", +"bs c #525265", +"bt c #32326A", +"bu c #1B1B2F", +"bv c #3B3B55", +"bw c #303068", +"bx c #21214C", +"by c #2C2C64", +"bz c #292957", +"c` c #232351", +"ca c #26264A", +"cb c #2F2F60", +"cc c #202044", +"cd c #5D5D97", +"ce c #2B2B5C", +"cf c #363674", +"cg c #3C3C66", +"ch c #252556", +"ci c #30306E", +"cj c #3E3E54", +"ck c #414178", +"cl c #2C2C6A", +"cm c #2F2F4F", +"cn c #25252E", +"co c #27275B", +"cp c #363663", +"cq c #4C4C68", +"cr c #20204A", +"cs c #2E2E5B", +"ct c #29294C", +"cu c #242451", +"cv c #27274A", +"cw c #343464", +"cx c #4F4F64", +"cy c #252548", +"cz c #16162C", +"d` c #292938", +"da c #333384", +"db c #3C3C6F", +"dc c #353572", +"dd c #1E1E37", +"de c #38386B", +"df c #414156", +"dg c #242454", +"dh c #31316E", +"di c #181831", +"dj c #232349", +"dk c #272739", +"dl c #393979", +"dm c #4C4C85", +"dn c #2F2F83", +"do c #28285B", +"dp c #292952", +"dq c #48486D", +"dr c #23234C", +"ds c #37377A", +"dt c #1E1E3D", +"du c #26265C", +"dv c #313174", +"dw c #4C4C60", +"dx c #27273F", +"dy c #3C3C78", +"dz c #48485C", +"e` c white", +"ea c #383874", +"eb c #333379", +"ec c #444458", +"ed c #272756", +"ee c #47477C", +"ef c #32326E", +"eg c #1B1B33", +"eh c #1E1E2C", +"ei c #30306C", +"ej c #40407F", +"ek c #292944", +"el c #212150", +"em c #23233E", +"en c #141422", +"eo c #343473", +"ep c #323271", +"eq c #2D2D76", +"er c #2E2E6D", +"es c #40406E", +"et c #21213F", +"eu c #272731", +"ev c #8080BA", +"ew c #23232D", +"ex c #25255A", +"ey c #1B1B39", +"ez c #35356D", +"f` c #191937", +"fa c #262651", +"fb c #313169", +"fc c #2C2C6E", +"fd c #22224D", +"fe c #18182C", +"ff c #373786", +"fg c #2D2D65", +"fh c #232344", +"fi c #2B2B63", +"fj c #292961", +"fk c #27275F", +"fl c #202037", +"fm c #1C1C33", +"fn c #242452", +"fo c #45456F", +"fp c #484868", +"fq c #535380", +"fr c #1F1F43", +"fs c #2C2C5D", +"ft c #3535DD", +"fu c #353573", +"fv c #262657", +"fw c #393963", +"fx c #242455", +/* pixels */ +"````````````````````````````````bsbsbsdwbs``````````````````````````````", +"````````````````````````dwbsdwcqcxbscqdwcqcxdzcxbs``````````````````````", +"````````````````````fpcxawcqawcqawawcqawfocqcqawfpcqcx``````````````````", +"``````````````````ececfpfpbofodqdqdqesbababadqfobafpeccj````````````````", +"``````````````dfeccjabcgesbobaabadcgabbaeefobaesbob`cgdfcjcj````````````", +"````````````cjdfbvcgfwfwcgcgesbrevdbcdeeesdedbfwdbcgcpbvbvdfcj``````````", +"``````````bdbvbvcg`ccpcwdecwayckcdeecddydcbrezdecpayfwb`ar`ncjbd````````", +"```````````saecmcscpcscwbwaqayeaevfqdyckbtdefbcpeicscbcscpb`cmae````````", +"`````````scvbjcmar`pcsfb`fbt`fcidmdecdcdefdyezaqbraz`farasasarek`s``````", +"``````bnaecmdjayb`fscsbwaqfbbwdyaacddheacdfudbfbbrbtfbaqbzcsdpafcmcn````", +"```````s`zbj`basfs`fbr`f`wdcepeqcfcdfue`dmdvcdbkbkbrfb`fbwbjcaaect`z````", +"`````taeaoccdrcsfdfgbwbr`ubb`oadebdndvebe`eadsejbyavfgcwbtcsdjbjaeddbf``", +"````eudidjbzdp`pbzbwbbefeperfjdabldadada`qcfdveofi`wfb`fay`ped`aeteg`k``", +"`````yflfadpcsfs`lbrdcav`wcfeoepdsda`qbqebdydsepfiaveabwbz`maybc`abufe``", +"````fmek`aararaiambwbyefcfcfbqfkeqejds`gft`qeofuclfkbw`ubibtcs`bcv`vfe``", +"```ydi`v`xdpbzamaxaqfkavererbkfffcfc`hdaeqdscffudcclbkfgapanayaodpczeg`t", +"``atbpao`adpbzdo`mfgbtepereperfcbqft`g`hffbqbkdlfucleiaqfbdg`bctfrfmfea`", +"```yetfh`xdpelfbfsfbaz`mdsci`gblffdneqftebda`hdafjfjfgbybwdgardr`xdia`at", +"``ateheycccredfsaxfgcibbeffjejdafc`g`heqblfjepclazazap`wfscbbz`jacfrflat", +"``atczey`v`afsacfsdgco`lbb`gebffereqft`qffdaer`wfgfifififjbzcu`i`adda`at", +"````a`dtcy`xdrcrexfxfvfgeabkbbdhffadejdndnblclepapdubhaqfvcefn`xdtegfe``", +"````a`dieybxfnbx`jfsfxfkfgfgdheoev`qdncdfcdlfjfi`wfiapcuchaubzaceydiat``", +"````atdifr`abz`bbzbranaifneifufidyckejepckffepfibyaianancu`bbgbgagegen``", +"````atczegeyf`bgascrcrelchanefdyfieaaa`qaq`uexduanbhfxaicecraoemajfea```", +"```````tfebedtccaled`dcoaqdoamdeaiandydyaifi`mfbaqfdfnbh`pagfrddfmfe````", +"```````t`reydidjagbzaxchanfnaianchch`lbhcoaichauc`chdoelbgbgbcegfm`r````", +"`````````reyaoacetcrfn`afd`ffvchc`fvbjaianfvco`bdrdgbz`e`vbe`zeyeg``````", +"```````````regacem`vccfnbxc`cu`jbifnfvcoc`bi`ich`adjac`xflajemew````````", +"``````````ewbpbpdtaobcbc`jchbic``ac``afafafnfd`jfncybcdxdkbedd`r````````", +"````````````d`ddbeakfh`kdrfd`b`b`jcudged`bcacvct`dcyccddewd``r``````````", +"``````````````eubndddxdxakaecvcaae`ecaagaecvafcabcfhbp`keucn````````````", +"``````````````````d`flem`z`s`v`kbc`bekaeagaeetafekd`bmbf````````````````", +"`````````````````````s`zdk`zae`kdxakaeekek`zekbfdkd`bn``````````````````", +"````````````````````````bnbmd`dkdk`sbndxd`bmbfbnah``````````````````````", +"````````````````````````````````cnbneu`sah``````````````````````````````", +"````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass8.xpm b/hacks/images/bubbles/glass8.xpm new file mode 100644 index 00000000..0fcd41b7 --- /dev/null +++ b/hacks/images/bubbles/glass8.xpm @@ -0,0 +1,240 @@ +/* XPM */ +static char *glass8[] = { +/* width height ncolors chars_per_pixel */ +"44 44 189 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #272751", +"`j c #23234D", +"`k c #29293F", +"`l c #2C2C63", +"`m c #2A2A61", +"`n c #33334C", +"`o c #353579", +"`p c #272754", +"`q c #414188", +"`r c #20202C", +"`s c #2E2E3D", +"`t c #1C1C28", +"`u c #2E2E68", +"`v c #242447", +"`w c #2C2C66", +"`x c #222245", +"`y c #181824", +"`z c #25253E", +"a` c #161622", +"aa c #B9B9ED", +"ab c #3E3E67", +"ac c #1C1C3F", +"ad c #6767A3", +"ae c #2B2B47", +"af c #272743", +"ag c #222248", +"ah c #292931", +"ai c #29295C", +"aj c #1D1D39", +"ak c #252544", +"al c #1E1E47", +"am c #2B2B61", +"an c #29295F", +"ao c #1F1F3E", +"ap c #2F2F68", +"aq c #2D2D66", +"ar c #30305F", +"as c #2C2C5B", +"at c #11111C", +"au c #262655", +"av c #31316D", +"aw c #4C4C6D", +"ax c #222251", +"ay c #323264", +"az c #2D2D69", +"b` c #33335B", +"ba c #43436E", +"bb c #2B2B67", +"bc c #212146", +"bd c #37374B", +"be c #22223D", +"bf c #252536", +"bg c #1D1D42", +"bh c #2A2A5C", +"bi c #28285A", +"bj c #2B2B53", +"bk c #333372", +"bl c #2F2F6E", +"bm c #2B2B3F", +"bn c #2C2C36", +"bo c #424266", +"bp c #232337", +"bq c #2F2FB0", +"br c #34346C", +"bs c #525265", +"bt c #32326A", +"bu c #1B1B2F", +"bv c #3B3B55", +"bw c #303068", +"bx c #21214C", +"by c #2C2C64", +"bz c #292957", +"c` c #232351", +"ca c #26264A", +"cb c #2F2F60", +"cc c #202044", +"cd c #5D5D97", +"ce c #2B2B5C", +"cf c #363674", +"cg c #3C3C66", +"ch c #252556", +"ci c #30306E", +"cj c #3E3E54", +"ck c #414178", +"cl c #2C2C6A", +"cm c #2F2F4F", +"cn c #25252E", +"co c #27275B", +"cp c #363663", +"cq c #4C4C68", +"cr c #20204A", +"cs c #2E2E5B", +"ct c #29294C", +"cu c #242451", +"cv c #27274A", +"cw c #343464", +"cx c #4F4F64", +"cy c #252548", +"cz c #16162C", +"d` c #292938", +"da c #333384", +"db c #3C3C6F", +"dc c #353572", +"dd c #1E1E37", +"de c #38386B", +"df c #414156", +"dg c #242454", +"dh c #31316E", +"di c #181831", +"dj c #232349", +"dk c #272739", +"dl c #393979", +"dm c #4C4C85", +"dn c #2F2F83", +"do c #28285B", +"dp c #292952", +"dq c #36366C", +"dr c #48486D", +"ds c #23234C", +"dt c #37377A", +"du c #20203F", +"dv c #1E1E3D", +"dw c #26265C", +"dx c #313174", +"dy c #4C4C60", +"dz c #27273F", +"e` c #3C3C78", +"ea c #48485C", +"eb c white", +"ec c #383874", +"ed c #333379", +"ee c #444458", +"ef c #272756", +"eg c #47477C", +"eh c #32326E", +"ei c #1B1B33", +"ej c #1E1E2C", +"ek c #30306C", +"el c #40407F", +"em c #292944", +"en c #212150", +"eo c #23233E", +"ep c #141422", +"eq c #343473", +"er c #323271", +"es c #2D2D76", +"et c #2E2E6D", +"eu c #40406E", +"ev c #21213F", +"ew c #272731", +"ex c #8080BA", +"ey c #23232D", +"ez c #25255A", +"f` c #1B1B39", +"fa c #35356D", +"fb c #191937", +"fc c #262651", +"fd c #313169", +"fe c #2C2C6E", +"ff c #22224D", +"fg c #18182C", +"fh c #373786", +"fi c #2D2D65", +"fj c #232344", +"fk c #2B2B63", +"fl c #292961", +"fm c #27275F", +"fn c #202037", +"fo c #1C1C33", +"fp c #242452", +"fq c #45456F", +"fr c #484868", +"fs c #535380", +"ft c #1F1F43", +"fu c #2C2C5D", +"fv c #3535DD", +"fw c #353573", +"fx c #262657", +"fy c #393963", +"fz c #242455", +/* pixels */ +"````````````````````````````````````````````bs``````````````````````````````````````````", +"````````````````````````````````dybseabsawbsbscxawcxbsdybs``````````````````````````````", +"````````````````````````````eedycqcqcqdrcxawcqawawawawfrfrcxcq``````````````````````````", +"````````````````````````eadyfrdybafrfqawawfqdrawawfrfrdrawcqeaeeee``````````````````````", +"````````````````````eeeebofrboawbofqdrbadrfqeufqfqbababafqfrbobobocjee``````````````````", +"``````````````````dfeebvfybvcgbaboeueueueuababfqdefqegeuabeufybocgdfeacj````````````````", +"````````````````bvbo`nfydffybocgcgdedbegfsfqeuegexeudbdqdedbdeabfybvcjdfcj``````````````", +"``````````````bdcjbvfyfyb`defyfydedbckexexebckdmaqdbdbdbayaydeaycpbvab`ccjbd````````````", +"`````````````s`ccjb`b`b`b`ardededeaydcexadckaddbdbaadqdqbrbtbrayb`cpb``c`ccm`n``````````", +"```````````n`n`ncmcsb`cpascpegfi`ucwbrcdcdebehaddbbrdmfaayaqcbb`arcscs`ccmb`ae`s````````", +"``````````aeafcmaeasfu`paraycbbtfd`lavecckegcdcdaaec`qfa`ufa`f`ubwarbzb`cscs`kbm````````", +"````````ewaectfjbzcsb`arcwbtdcapec`fdcaadmcd`ueqaddmekecav`fapbtecbwdparbjcmaoct`n``````", +"````````bddzcmbjdparcscb`fdbfdfidcdlcieqbbdlciebexeletegbwbk`ubtbwfufucsdpcm`zctbm``````", +"```````ycmdjdpctauaramefcsbwapehekereddleledcfdmdmdmerelecaqaqbrehcbbzarfc`vbjcyem`r````", +"``````bpaobefjccbzasenbw`ufafdblcl`oeldldnbqededdtcdbkdldlet`lekamcbbw`fbjauctdp`zfn````", +"`````yfoaj`bbzeodsfibhbrekavcfcletfldneddxeddadtdadmbkerercleh`ubwbwcbbzarbhdpfjdiei`t``", +"````atfoemfcdpbzasfi`ffadcekbkazeqerbkerdadtdmfhbqdldleddxfkfdapdcfdfcam`pbz`e`ifoepa```", +"````a`dd`v`bbzbjefdw`lbwbtehdceccf`hfeerbqfhedesbqfvdlcifwcifldhbrficbficsefcc`v`xajbp``", +"````fnfgeo`vfubzbwdwco`ufm`m`ucfbler`ofh`hfveddndnbqdldldtcffmbkbwapbwaiefaybgctczfgei``", +"`````yczacaodpbjayfxcobwapbkehdhblerdtdnfe`hbqfhbqfedtcfeqecaqeqbwfiapanbhbr`zdjbcaofo``", +"````atczf``bbzbzbhax`laqbwaqdhciblfeclfhfhdafmbqdabqdacidldtdhflcf`wby`fauef`vccakev`y``", +"``ata`fnagccbzenbhfiaifdehezdhdlet`geteddnbqesfvedbqesdndabbfmfmbtbyamfufuasbcccdidiepat", +"````fgfgao`dbg`e`falcobwfkfmdh`o`gcidnesdn`gdabqed`geteretblekazfk`u`fdocb`j`abgf`ev`y``", +"`````yeicv`v`b`pamfcbhfxfidwetazazdx`q`heted`qfveder`get`wciekehchcodgbhffefeffcczbu`y``", +"````epdvfjfj`acubzenanbifxbyaqci`w`gereleddnesehdnazdxbkcl`wfmfm`f`lfmayenau`bfceidia```", +"`````ybuev`xcc`j`pfzaxau`jezekcferblcifhfhdmdmdldtfmblekdhekaq`fbififzbzftbidudvdifgbu``", +"````atfgfoaobgal`pc`auamaxcoekapdcfwaqe`edeldnele`ekelfm`manapaqficubi`pdjfcacf`bgdvep``", +"`````ya`f`ag`bdpasbcfubraibifmfmdhcfanekdcdmdtdhflexblcifkbyfiaifian`pau`pagbgbceicza```", +"``````epdif`dubcefbgauenaxfmco`f`mecekfied`uavexfkbbaqfmdwanapcubifxffbgacftbef`di`y````", +"``````a`czbuf`ddddbcfffcfcdgdoancofdezbwecfkap`wehaifmbtfiandwaxenbibzagf`ccbpaj`t`y````", +"`````````yfoeyaceoevenfpffbx`mam`mbifpdwchapehaicocoamaibibtezfxdgfxeffjccfpeiddfg``````", +"````````ej`rdidvaobzalbzfp`mauchfpfkezfkau`f`fdechchchfzbic`axbxfpauff`ebg`pejej`t``````", +"```````````tf`f`ajal`zcrfpendsffaycochfzdgfzbjcoancofpdo`ben`affce`edjbcbebef`di````````", +"```````````t`rf`dvaoeobcdu`ece`bfpencucofxbic`auc`dgficuef`bbxffbg`ebedddvaobfew````````", +"````````````cnejbpaodvftdj`jcr`pcoen`j`jcu`ifcbifx`jc``jen`bbx`vccbe`z`zddddcn``````````", +"``````````````ewbpddfbddaccycr`dfp`jfpca`jcu`dc`cacv`dff`d`d`x`dft`z`zbeejcn````````````", +"````````````````fgfneoduembmfj`vag`act`bds`ac``j`j`acv`bbcagak`xdudvbpcn`t``````````````", +"``````````````````ewd`fnaeakemcyaecvdjaeaecrcvdsakaeakafcy`jao`zfnd`cn`t````````````````", +"````````````````````d`dkfndzd``zbm`v`k`b`ecvemaeca`vaedudz`zafew`kbfey``````````````````", +"````````````````````````bfdkd`dz`kafdzae`vemcyafakakaedzdzbed`dkcn``````````````````````", +"````````````````````````````ahdkbnbnbm`z`sdk`s`zd`bm`safd`bn`s``````````````````````````", +"````````````````````````````````bnbn`sd`d`dk`sbmbnah`s`sah``````````````````````````````", +"````````````````````````````````````````````cn``````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/glass9.xpm b/hacks/images/bubbles/glass9.xpm new file mode 100644 index 00000000..9e3ac20a --- /dev/null +++ b/hacks/images/bubbles/glass9.xpm @@ -0,0 +1,245 @@ +/* XPM */ +static char *glass9[] = { +/* width height ncolors chars_per_pixel */ +"50 50 188 2", +/* colors */ +"`` c None", +"`a c #27274E", +"`b c #25254C", +"`c c #383858", +"`d c #23234A", +"`e c #212148", +"`f c #2E2E62", +"`g c #292967", +"`h c #3535A1", +"`i c #272751", +"`j c #23234D", +"`k c #29293F", +"`l c #2C2C63", +"`m c #2A2A61", +"`n c #33334C", +"`o c #353579", +"`p c #272754", +"`q c #414188", +"`r c #20202C", +"`s c #2E2E3D", +"`t c #1C1C28", +"`u c #2E2E68", +"`v c #242447", +"`w c #2C2C66", +"`x c #222245", +"`y c #181824", +"`z c #25253E", +"a` c #161622", +"aa c #B9B9ED", +"ab c #3E3E67", +"ac c #1C1C3F", +"ad c #6767A3", +"ae c #2B2B47", +"af c #272743", +"ag c #222248", +"ah c #292931", +"ai c #29295C", +"aj c #1D1D39", +"ak c #252544", +"al c #1E1E47", +"am c #2B2B61", +"an c #29295F", +"ao c #1F1F3E", +"ap c #2F2F68", +"aq c #2D2D66", +"ar c #30305F", +"as c #2C2C5B", +"at c #11111C", +"au c #262655", +"av c #31316D", +"aw c #4C4C6D", +"ax c #222251", +"ay c #323264", +"az c #2D2D69", +"b` c #33335B", +"ba c #43436E", +"bb c #2B2B67", +"bc c #212146", +"bd c #37374B", +"be c #22223D", +"bf c #252536", +"bg c #1D1D42", +"bh c #2A2A5C", +"bi c #28285A", +"bj c #2B2B53", +"bk c #333372", +"bl c #2F2F6E", +"bm c #2B2B3F", +"bn c #2C2C36", +"bo c #424266", +"bp c #232337", +"bq c #2F2FB0", +"br c #34346C", +"bs c #525265", +"bt c #32326A", +"bu c #1B1B2F", +"bv c #3B3B55", +"bw c #303068", +"bx c #21214C", +"by c #292957", +"bz c #232351", +"c` c #26264A", +"ca c #2F2F60", +"cb c #202044", +"cc c #5D5D97", +"cd c #2B2B5C", +"ce c #363674", +"cf c #3C3C66", +"cg c #252556", +"ch c #30306E", +"ci c #3E3E54", +"cj c #414178", +"ck c #2C2C6A", +"cl c #2F2F4F", +"cm c #25252E", +"cn c #27275B", +"co c #363663", +"cp c #4C4C68", +"cq c #20204A", +"cr c #2E2E5B", +"cs c #29294C", +"ct c #242451", +"cu c #27274A", +"cv c #343464", +"cw c #4F4F64", +"cx c #252548", +"cy c #16162C", +"cz c #292938", +"d` c #333384", +"da c #3C3C6F", +"db c #353572", +"dc c #1E1E37", +"dd c #38386B", +"de c #414156", +"df c #242454", +"dg c #31316E", +"dh c #181831", +"di c #232349", +"dj c #272739", +"dk c #393979", +"dl c #4C4C85", +"dm c #2F2F83", +"dn c #28285B", +"do c #292952", +"dp c #36366C", +"dq c #48486D", +"dr c #23234C", +"ds c #37377A", +"dt c #20203F", +"du c #1E1E3D", +"dv c #26265C", +"dw c #313174", +"dx c #4C4C60", +"dy c #27273F", +"dz c #3C3C78", +"e` c #48485C", +"ea c white", +"eb c #383874", +"ec c #333379", +"ed c #444458", +"ee c #272756", +"ef c #47477C", +"eg c #32326E", +"eh c #1B1B33", +"ei c #1E1E2C", +"ej c #30306C", +"ek c #40407F", +"el c #292944", +"em c #212150", +"en c #23233E", +"eo c #141422", +"ep c #343473", +"eq c #323271", +"er c #2D2D76", +"es c #2E2E6D", +"et c #40406E", +"eu c #21213F", +"ev c #272731", +"ew c #8080BA", +"ex c #23232D", +"ey c #25255A", +"ez c #1B1B39", +"f` c #35356D", +"fa c #191937", +"fb c #262651", +"fc c #313169", +"fd c #2C2C6E", +"fe c #22224D", +"ff c #18182C", +"fg c #373786", +"fh c #2D2D65", +"fi c #232344", +"fj c #2B2B63", +"fk c #292961", +"fl c #27275F", +"fm c #202037", +"fn c #1C1C33", +"fo c #242452", +"fp c #45456F", +"fq c #484868", +"fr c #535380", +"fs c #1F1F43", +"ft c #2C2C5D", +"fu c #3535DD", +"fv c #353573", +"fw c #262657", +"fx c #393963", +"fy c #242455", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````e`bscwbscwbsbsbsbsbsbsbscw````````````````````````````````````", +"````````````````````````````````bse`bscpbse`awawcwbsbsdqawawbsdxdxcwcw``````````````````````````````", +"````````````````````````````e`eddxfqcwcpfqfqawawdqawdqawawfqcwawawfqfqe`cw``````````````````````````", +"````````````````````````cie`e`dxfqboboawfpfpdqfpbafpawfpdqbofpabdqfqfqedcfdee```````````````````````", +"``````````````````````edede`cifqbodqabfpfpbabobaccbabafpbaddbaetfpfqabbobobodee`````````````````````", +"````````````````````deedbvbvfxfxcfetboetfpcfewetddetetdaefetbaetabetbofxabcfedcici``````````````````", +"``````````````````bdedbd`cabdefxababfxddetddcccjefbacjeaetddddcfdpdaddababb``cdeedde````````````````", +"````````````````bvbdbvfx`cb`fxcfcffxdddaddefccaaeaefewbwdldadaddcoayddcvcfb``cbvbdbvci``````````````", +"```````````````s`cbvbdb`b`b`cocvdddaddayf`braadlfrccdldzewdddaebddfcbwayfxcfb``cbd`cbd`s````````````", +"````````````bd`sclclbjb`crb`arcofr`ubtbtfcdkaaewewdlcjdabtdabtcvddebayaycadoarb``c`n`ncl`s``````````", +"``````````bdbv`c`ccub`b`b`ascrdp`fcadzaqbwfjebcjeaccewaaccdlfrdlegbw`f`lcab`crcrcrclclelbpbd````````", +"``````````bnbmcuclclcrb``pararcv`ff`fcegf`dzewcjcjeqdleabkavf`fc`mbrcaegfcaycabjararcrae`sbm````````", +"````````evaedycragcacvb`apcrasbwf``faybtavekewaddleqdkccccdkbrdzfcavapbrfhf`biascac`bjcuel`kbf``````", +"````````aeae`vcldo`acrcacr`fbtddaqapebceckbleqdzdseqaaadekdwebdkavceapbrbt`fftamcrbybjaeclbpbp``````", +"```````rfnbeakdocubzarfw`faiarbraqegejbkcheqeqekd``oefekewdzchekbkaqfhbtbkapcrcacr`j`vdocbbpfn`t````", +"``````cz`zdoakbccbbyasdr`fap`uf`fcejck`obkdl`odmfudwecdwaadzbkdzdbaz`legaqftar`fcadofbdobjafdccm````", +"``````bfehdc`aeefifbftaiambw`gavbkblck`gckd`eqecec`hfgd`addsepbkfvfkapazavf`fw`fbycrcd`a`vehbubp````", +"`````tbuehdyfbasdocaapayayebebbteq`geqchfvdwecbqdkaddsfudwdzbkckdwfjbrapf`bwf`byfwbyasdr`iezbucy`t``", +"`````yfnfieu`bdi`abydn`mfcf`f`egdbavdbec`odwcefgecdsd`dmbqepceeqf`az`wejdbbrambi`lcdft`bcbc``va`ei``", +"````a`eoenfifsaycrbyfl`mfc`uan`webceebdmer`gdwbqdsdsdmdmbqekdkeccechckfkejegfhbiftarby`a`v`vfiffbu``", +"````fmcycxdidt`iardpdnemanavflejazeqesepcefgblerfud`fgfderfgdkdsdkdzfkeqbkapapbt`lctfceuas`vcydhfn``", +"````ehdheudtagbybjcabidnapapfcebejblchcheqer`hbqbqerbqfufgecdsebcedkbkbleqf`fjambicaaycu`vcxa`du`y``", +"````fnfndhdtbgdobybifocnbwameqckdgeqeqfdesfdfgfgdwflfddmfufudwch`odschflejebdvayby`pee`vcbacfndcbu``", +"````bube`vacfe`iembyfc`f`ufc`wdveqdkeqflfddwfudm`her`hd`fgbqecd`ecbbflfkfjapdvbwdnftas`jfifieh`yeo``", +"````ffehdhdhdrcqalft`jembtai`wfkdg`obbesbldmfddm`gecfud`dmbbdw`ochbl`ufkap`weganaiar`j`j`ddu`adhff``", +"````ffdcdrdtbj`a`pfhfebibh`legfkesapaqeq`obqbqfddkfu`hd`dwfkchdw`wcheq`ufjemfyaucdby`peectduezdhbu``", +"`````tfadhag`v`iee`fcqfweefleyanaqfjazazebfg`g`qfu`hadcher`q`h`gazdwaibbap`lfw`waybxct`aagcbeueofn``", +"````eoa`ffcbfididr`eaxeybzbhcgaqepdlbkckazeqds`qfueqfdblefeqdzchdg`wfheyamey`laibyalbiagdraodheheo``", +"````at`ydhdh`dfsal`pfyalfyemeyey`waqdgazckepbkdw`qekepecfjdmejflazfj`ubw`lbiftaxee`beecbcbbcdu`ta```", +"````a`a`a`ficbalcqeeauct`fcgdffyflejapds`wefdleradewegaaegeseqbr`lfl`u`megamamctfb`vfebc`deudceoat``", +"``````eofffacb`abyftcbbybtfcanfwaidvapepap`wegazdzdlek`uerfgepdgfj`laqdncn`mbyfoct`p`vbgacezdhbu````", +"```````yffdhfsficbeealbybxbiemcncnamflch`u`uccew`udgdlf``wdldbcgflanbweefycnaxeeacezfsdyfmdh`y`t````", +"```````teoeiezajdcdc`ealeeai`jaxaiamcgavaiew`ucc`w`mandzanebflfcamfldvbiemdffw`pfeezcbdcbpeh`yeo````", +"`````````tfffffmaoakdtalamfbdremfjamaiaidffraiddegdbfhancnbrdn`mamegfwaxfocgftct`x`efeezeifn`t``````", +"````````ex`tehbeezdubydialcdaxcnbidndfbhfwbweydf`mandfcgdvananfyfofycncgcnaxfoacbg`e`pfadueiex``````", +"```````````rbufndcajacfscbbycqfofodnaifhfyai`paxcnfweyddcg`pcgfwfofedifeaxbyalfs`j`kduehfmfm````````", +"```````````yeifndhbefsao`vaxbxbxcsfebyfwbzfybidfcgbjfwaidnambibybzbx`afocdbc`vfidtezajbueha`````````", +"`````````````y`r`rezduaocxficb`jfw`abz`jct`jdnfwbzfwdnaufofofw`afo`i`ddiducb`zdudcezdu`rex``````````", +"``````````````evbudjfmajcbagbcctbcfwcgaufoct`afofb`afodf`jbzemfobx`dfe`val`xczdjbebpdccm````````````", +"````````````````evcmezfneufsaoelcqcxctfeaufecsfectbxbzfeae`b`jdrc``b`x`ecb`zbpfmfmeiev``````````````", +"``````````````````ffbubpfiafafbmbc`vag`bc`csdr`j`bct`jfefbcxcx`j`xdificxacbeenbfev`t````````````````", +"````````````````````cmczczdy`zak`kcucucudrcuaecxc`cxdrcxaeelak`vc``jajakbpafbfbf`r``````````````````", +"``````````````````````cmczbpdjdc`kcxelaoelakagbc`aaeel`bbxakakeu`zdtbm`zdjbpevbf````````````````````", +"````````````````````````cmbfeibfbmeuel`kelelafelelakaeelaf`k`k`zdjbebm`zbncmah``````````````````````", +"````````````````````````````czbnczbp`zafbmaedyafelbmdy`zdybeczdjczbf`kbpex``````````````````````````", +"`````````````````````````````````sevdjbncz`zdj`sczcz`k`k`s`sdjbfahevbn``````````````````````````````", +"``````````````````````````````````````evah`sbncz`kev`sbnczbnczah````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade.pov b/hacks/images/bubbles/jade.pov new file mode 100644 index 00000000..7c1cb023 --- /dev/null +++ b/hacks/images/bubbles/jade.pov @@ -0,0 +1,24 @@ +#include "colors.inc" +#include "shapes.inc" +#include "textures.inc" + +/* The following make the field of view as wide as it is high + * Thus, you should have the -W and -H command line options + * equal to each other. */ +camera { + location <5.8, 0, 0> + up <0, 1, 0> + right <1, 0, 0> + look_at <0, 0, 0> +} + +sphere { + <0,0,0>, 2.5 + texture { Jade + scale <0.7, 0.7, 0.7> + rotate y*clock } + finish { phong 0.4 } +} + +light_source {<6, 1, 0> color White} +light_source {<6.1, 1, 0> color White} diff --git a/hacks/images/bubbles/jade1.xpm b/hacks/images/bubbles/jade1.xpm new file mode 100644 index 00000000..2a13045e --- /dev/null +++ b/hacks/images/bubbles/jade1.xpm @@ -0,0 +1,75 @@ +/* XPM */ +static char *jade1[] = { +/* width height ncolors chars_per_pixel */ +"10 10 58 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #149914", +"`d c #179317", +"`e c #158B15", +"`f c #148914", +"`g c #148514", +"`h c #0F890F", +"`i c #0D830D", +"`j c #0F730F", +"`k c #0F6F0F", +"`l c #0E6B0E", +"`m c #077307", +"`n c #0E630E", +"`o c #0B630B", +"`p c #026502", +"`q c #046104", +"`r c #0A550A", +"`s c #0B530B", +"`t c #065306", +"`u c #054F05", +"`v c #074B07", +"`w c #064706", +"`x c #003700", +"`y c #042B04", +"`z c #011901", +"a` c #21B621", +"aa c #1AAC1A", +"ab c #18A818", +"ac c #17A217", +"ad c #189E18", +"ae c #127C12", +"af c #107C10", +"ag c #0F7A0F", +"ah c #0B800B", +"ai c #0E720E", +"aj c #0A760A", +"ak c #106A10", +"al c #0F6A0F", +"am c #0A6E0A", +"an c #0B620B", +"ao c #0D580D", +"ap c #076007", +"aq c #045E04", +"ar c #015E01", +"as c #015201", +"at c #034803", +"au c #044604", +"av c #083E08", +"aw c #014601", +"ax c #044004", +"ay c #063606", +"az c #052E05", +"b` c #013401", +"ba c #042404", +"bb c #002600", +"bc c #022002", +/* pixels */ +"```````v`l`g`k`v````", +"````an`gad`cajaqal``", +"``az`f`hahah`parapao", +"```wagac`m`aa`aa`o`x", +"``ak`d`qai`babau`e`w", +"``b`aeafat`u`ias`j`s", +"``bc`n`kafam`jaw`xay", +"````avaxau`t`r`n`z``", +"```````ybbavazba````", +"````````````````````" +}; diff --git a/hacks/images/bubbles/jade10.xpm b/hacks/images/bubbles/jade10.xpm new file mode 100644 index 00000000..e601fecf --- /dev/null +++ b/hacks/images/bubbles/jade10.xpm @@ -0,0 +1,259 @@ +/* XPM */ +static char *jade10[] = { +/* width height ncolors chars_per_pixel */ +"60 60 192 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #139713", +"`k c #149514", +"`l c #1A8B1A", +"`m c #159315", +"`n c #129312", +"`o c #158B15", +"`p c #128D12", +"`q c #148914", +"`r c #158715", +"`s c #148514", +"`t c #0F890F", +"`u c #128312", +"`v c #0F870F", +"`w c #0E850E", +"`x c #108110", +"`y c #0D830D", +"`z c #0F7F0F", +"a` c #127912", +"aa c #137513", +"ab c #107710", +"ac c #0C7D0C", +"ad c #0E750E", +"ae c #0F730F", +"af c #0F6F0F", +"ag c #0F6D0F", +"ah c #0E6B0E", +"ai c #0E690E", +"aj c #077307", +"ak c #0F650F", +"al c #0E630E", +"am c #0B630B", +"an c #0D5B0D", +"ao c #0A5F0A", +"ap c #036703", +"aq c #0B570B", +"ar c #075D07", +"as c #026502", +"at c #046104", +"au c #0A550A", +"av c #0B530B", +"aw c #016101", +"ax c #0C4F0C", +"ay c #0A510A", +"az c #025B02", +"b` c #094F09", +"ba c #045704", +"bb c #0A4D0A", +"bc c #065306", +"bd c #0A4B0A", +"be c #065106", +"bf c #015901", +"bg c #074D07", +"bh c #054F05", +"bi c #074B07", +"bj c #084908", +"bk c #094709", +"bl c #084508", +"bm c #064706", +"bn c #014F01", +"bo c #004B00", +"bp c #063D06", +"bq c #063B06", +"br c #073907", +"bs c #033D03", +"bt c #004100", +"bu c #013F01", +"bv c #033B03", +"bw c #053505", +"bx c #003D00", +"by c #063306", +"bz c #053105", +"c` c #023502", +"ca c #003700", +"cb c #042B04", +"cc c #042904", +"cd c #012301", +"ce c #022102", +"cf c #011D01", +"cg c #021B02", +"ch c #011901", +"ci c #011701", +"cj c #011501", +"ck c #011301", +"cl c #010D01", +"cm c #21B621", +"cn c #1CB41C", +"co c #22AA22", +"cp c #1AAC1A", +"cq c #18A818", +"cr c #1F9C1F", +"cs c white", +"ct c #18A418", +"cu c #17A217", +"cv c #189E18", +"cw c #189A18", +"cx c #149C14", +"cy c #149014", +"cz c #119011", +"d` c #128A12", +"da c #0F8C0F", +"db c #128612", +"dc c #148214", +"dd c #138013", +"de c #127E12", +"df c #127C12", +"dg c #107C10", +"dh c #0F7A0F", +"di c #0B800B", +"dj c #0E780E", +"dk c #0B7C0B", +"dl c #117211", +"dm c #0A7A0A", +"dn c #0E720E", +"do c #0A780A", +"dp c #0A760A", +"dq c #106A10", +"dr c #0B720B", +"ds c #0F6A0F", +"dt c #0A700A", +"du c #0A6E0A", +"dv c #0B6C0B", +"dw c #0A6A0A", +"dx c #0B680B", +"dy c #067006", +"dz c #0C660C", +"e` c #0A660A", +"ea c #056E05", +"eb c #056C05", +"ec c #0B620B", +"ed c #0C600C", +"ee c #0D5E0D", +"ef c #056A05", +"eg c #066806", +"eh c #076407", +"ei c #0D580D", +"ej c #0A5C0A", +"ek c #076007", +"el c #046404", +"em c #0A5A0A", +"en c #075A07", +"eo c #085808", +"ep c #045E04", +"eq c #095409", +"er c #015E01", +"es c #055605", +"et c #055405", +"eu c #015601", +"ev c #015401", +"ew c #035003", +"ex c #015201", +"ey c #034C03", +"ez c #034A03", +"f` c #B1FFB1", +"fa c #074207", +"fb c #034803", +"fc c #044604", +"fd c #074007", +"fe c #083E08", +"ff c #014601", +"fg c #024402", +"fh c #034203", +"fi c #044004", +"fj c #053805", +"fk c #063606", +"fl c #013A01", +"fm c #023802", +"fn c #052E05", +"fo c #013401", +"fp c #013201", +"fq c #042C04", +"fr c #013001", +"fs c #012E01", +"ft c #012C01", +"fu c #042604", +"fv c #012A01", +"fw c #022802", +"fx c #042404", +"fy c #002600", +"fz c #022002", +"g` c #011E01", +"ga c #001000", +"gb c #000A00", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````fwbdftaxbdbqavfjc`bkfvfycc``````````````````````````````````````````````", +"``````````````````````````````````````````fnfjbpfaeefofrftaqbubifhbdbmfibkanfdfj````````````````````````````````````````", +"````````````````````````````````````byfvfofidqaldqdqafa`a`bcfraoagafbubcbianeifafdfrce``````````````````````````````````", +"````````````````````````````````byfraybjalfrbxfga`aidlenenffbsb`fffbeyddecaqbedlcafpbpbdby``````````````````````````````", +"``````````````````````````````feeianbiezagbtakeyah`rdedge`bo`sfobndfffenafesffembsbubib`fofk````````````````````````````", +"``````````````````````````bybqbjbmbxeqejenendde`addh`oadafbibobnbmboekbabne`dxffeyeybeagdqaqbkfq````````````````````````", +"````````````````````````fwftaneebuedamaoenabdhdb`q`qdr`q`iaiejagbf`qcabaflbaekdgdceteoejbeayavfabz``````````````````````", +"``````````````````````fkbqfialdsbtetdv`uduad`qdrdpcw`o`zazafcwcy`qdnevdpekcyahaeenar`rfrakakfdfifafw````````````````````", +"````````````````````brbpb`emaafia``rdg`i`o`zcw`zdjcwct`w`oe`dodpaodnduelegexbfamaoaubaemakfgeyfybibqfv``````````````````", +"``````````````````fec`bbaledfma`af`saddj`uehdbcv`ed`aj`fcpdp`madegerbx`oeldpd`d`dt`sev`rboa`dlafcacabkfw````````````````", +"````````````````fwbkaydqecb`dcdv`rdc`scwexdp`g`ecvawdxdber`y`hctdiawdgfbdpduegcy`pdwepbodfenemaldsbmbmbqfn``````````````", +"``````````````cffafralfjc`dnecaqaddb`x`zevatdp`vacfgeyerelfgetda`fdyaw`u`n`pdmd`cwdbexeqboa`ffeta`affhfmbzfn````````````", +"``````````````fwfmeeemedaadca`eoepdrcvcvegeuebdoajefdhcncmeyetdicndocye`as`tcp`f`vcw`eeuaiflewaiffdldlayeife````````````", +"````````````feavfieeaaeyfr`sdeexdwcvcu`meldk`fct`dcudidyamcyar`ycuct`tesdvea`eefdodp`e`peubearbobibhageeb`fvcd``````````", +"``````````fxcdbdandlffesboek`xemdb`pdkbfel`k`dcncpajcmefewdjapdmefea`f`jcz`h`hdycydtd`cwegepfcfmdfaragemalbdbkch````````", +"``````````fwbqbjakagenewencyad`gdrazeraccucpcpcncu`zdharap`kasdo`ndiap`k`dcuajcncpcwepdkcycydtdgdwafdlbcedeeblcc````````", +"````````fxfrfnayeqbceyes`qekatexfldu`tcpdo`y`hcudiades`hewdmdicp`ccn`wapasaw`ges`xbherbxdbcy`idbekdlesa`dqaleibwcg``````", +"````````fnfpeefhfbafalbodeehdwdder`p`e`yaddodicndkefcqcxdacq`c`d`ccz`h`eescme`drene`eaelfhegegdwedalewagauemavaxcc``````", +"````````brbzakeebceyfcek`o`odhbief`k`ediapajcncx`fdict`ccucqcncm`ccx`tdr`ed`ardyebdpazegdgcvateoekaeenagedakeifdg```````", +"``````cebdeieeala`alewekdrdrdbegeg`k`fcpdacmctdid`czczcn`ddacucm`c`cajasdmdmawdyea`fczacazcvexfgbnaraba`ameoeiblfech````", +"``````byfjfadqfgauej`redaebnex`m`f`vczcxcpdadaawea`neadp`e`r`lcrcmcvdyefcncxajcydydyczdicwepcacabsbaabdea`ezb`bbbwfw````", +"``````cdfebdakfgezet`s`u`z`uepeg`fcpctcpcqcq`teydmczdpa`coco`b`baacm`rdicmcn`jef`majascpdjbf`o`gemfhdddfddeobibsfefw````", +"````cjbwfsbmbmbubh`rbodhdh`iegctefcwcucucncpcpdhaj`yabco`b`a`a`a`a`lcodpcmcqczdicp`ecpcvdb`efgehambmabdxaiemcabkbqfqga``", +"````g`blblfifhdqbcfiba`qdhcw`xfbcwefacdydacncqeacmd`co`b`af`f`f``acocrcwcq`ccxeaef`merajegbxe`a``iba`renecemdqeibrchcc``", +"````fxbqbdaneefgecffeydu`q`i`iepcpame`awdkcpcpar`ycm`b`a`af`f`f``a`b`l`e`ccn`jasdieady`pacatahcabuai`rewecfgdlcabqbqby``", +"````cibkaxfianfafgffaie`cycwcvefelajdbbtawcz`jaw`t`e`b`a`af`csf``a`b`ldh`w`nasap`yczdpcw`kacahbcboba`odnbhbualalc`brg```", +"````g`bkavbvb`bceebvetewekdh`xd`dp`kaccycydocncvdacvco`b`af`f`f``a`bcralapef`fcy`w`ycz`gcw`zazdb`qe``r`rfgfcdqakcdfefn``", +"````fnfybqanfhbebhafenew`ibadu`wdp`k`wfbapdacparczcm`c`b`b`a`a`acocraed`cucpcpdoer`ydpdp`m`mcy`xbadca`dfdfecauavfafycc``", +"````fzfvfdaudqbgecbcenbo`iaeeueheuelatefczcncuacdncu`cco`lcr`b`b`l`lcrczcq`wdkcpdpdhfcflducweh`i`oabdcdlemeqbmaqeichfn``", +"````cbfrfjblfcagbxbha`dnarbobnehdxfbaz`kcv`fda`een`jcn`ddvdldlaecrdraoczcq`f`y`d`ndoac`eelcydhadardv`rdlejeqavbjbbbyfu``", +"````fxbrbqbsfifhaifbah`oddduehdgcyeoeg`gcucvajdv`t`e`hcpdmcm`d`vajeo`ddy`n`ecx`dcv`f`meu`e`g`z`g`qdcahaheyedb`fmbdcdfx``", +"````fncdfkbdb`bmafezdn`rdedn`xdueubu`o`ycw`fdidj`hcpct`deaen`udk`j`yefelebcz`dcpd``fac`edcbnex`i`sa`aea`beemaufpbwfuch``", +"````cjfnfteib`c`ejecaoa`ad`idbbaeuaideazdkcv`pazdp`d`d`tdyasefcucn`fdibfbfcwdoct`p`wdpeuexameh`o`sendcaialakalc`bkfecf``", +"````ckceftaxbsaqaldlejagde`uehepepbgexeg`e`wacerbfdmdi`dasapdpcvcpcueben`tdpfcdtdpdwdtekbcfidcada`aeabagakakaqbqfwbyfz``", +"````clg`bzfafoblemdldzdfdfecfiexbnfcdg`icvegd`eufbat`ierct`ubhat`wdydvcp`y`kacfbelegexfibgexbodxaeabaabhfcayavfdcgfzck``", +"``````fxfwbdfdfjfceedldzamboeqbebmbebhcvducy`gdregeuegdkaccyer`eaceladdgel`x`zevazcveoezboboe``raiddaibgfdfdbvbdcjfx````", +"``````fxcdblfafofjbgdlbcbcaufrbsfidlexeu`q`icv`g`kcwcw`gcwegcwdeeodedhfgbu`iexatdudrbnbobadddgaeffbhaoeeakbdbrbdcjfz````", +"``````ckfzfqfabpbjcaedakemakeya`abewdjardjcydbehdwdreg`ictdbdrdebu`gcteldwabepdu`i`xdgdr`re`dveyalb`anaubzfofwfyfnck````", +"````````g`cccfbpbjfmbiaifceeakfieddcekdg`q`s`gdgdudrdrcwcvcvcweuflembudh`udtdv`gdwendne`ekesbtedaqavflflbdblbdcdch``````", +"````````fzcecfbpcbfiaveeaufbeebheyetewdddn`u`q`i`odb`i`gcwcvdjehdgbgepdudwep`udjbafffhagedaaedafbmdqflc`fjfncdcfcg``````", +"````````clcffzblcdbvfobsaldlbsecabddaf`odne`esbadgdr`x`o`ocwdudbdgekehbaaeeqdj`rdga`ffafbheoaadlcaftbdfmbkfzfkfxgb``````", +"``````````fxcbfkfsc`frbmeibic`bedlabdzdcaeareyfiardvdnduaddge`dg`sduehboa`eje``r`rendleoaiaaaiakavfifnftfkfkcecj````````", +"``````````gbfxfnfebpeibveiakflanfgejafdldxetbob`ardvdedv`o`oabene`dxekbnboaodfaebebibca`eqeqakdqeebsfqfvfwfwfxcl````````", +"````````````clfxcdfkbwfwanbjavflfaafeya`agafeyddarah`se`aedeababdxenaoewdn`samdldsbcafejaibgdqalaqc`fqbrg`ceci``````````", +"``````````````fxfubybkfsfjanayaubibubxdldsaidzaodfabafaoe`a`dddxe`fbewe`aea`anbcaodzagdqeedqaqeiaxftbwfwcech````````````", +"``````````````gbfucgbzfebybpeieeaqfhdqeeakeqaiemdsdzeoaidcezecbhaidzeoemafecb`aaakagaqayaqb`blbkbdblfkcffzgb````````````", +"````````````````gbcgfxbyfefjaxeieeayfiflfrbjeebxfcdsbxezagbxbcememeyaobhaubcbeakedaqalb`eiblavfrchccfzfzcj``````````````", +"``````````````````clcgcjccbwaxavfaaqeeeib`fiblaybiemfgfhblblbdfcfhembeemdlbbdqaueianfableibdfrfvcbcccccj````````````````", +"````````````````````gbfubzfnbrbkbpc`fpbpbvfjcafhakayavakflbmakbdbidqeefccabiakavbvfrbqblblfefqcbbzfxcj``````````````````", +"``````````````````````gbcgcgg`fwfefvbkbdaxfmanfpalaycafaaudqalfob`bifmaxaqaneibdfrbqbkbkfeccbybyfxck````````````````````", +"````````````````````````clcgcgfnfwfqfvfabwc`bqeiblbsfeavbvbsfrbvanbbfabzeiblc`bwbwbpfafeccg`fxfxcl``````````````````````", +"``````````````````````````gbckchcfccbrbyfkbdfjbkfabpbrfkcdbveiaxaxbbfafdbwfefvfvfwbrfefkcffzcgcl````````````````````````", +"``````````````````````````````gagafzcbfnbrfkfkfyfybzfebkbdbdfefefvbkfubzfnfnbzfebrfqfxfxcgck````````````````````````````", +"````````````````````````````````gbclckfxfnbyfnfwfwbzfqfkfqcdfnfqchfucgbrccfnfwfncccjcgcjgb``````````````````````````````", +"````````````````````````````````````clclcjcjcjckgaccfxcdcdcecicfcgfzcgcefufncefzckclgb``````````````````````````````````", +"``````````````````````````````````````````clgacjcjcgcjcjcjgachcjfzcgfzfxfzckgacl````````````````````````````````````````", +"````````````````````````````````````````````````clgbclckckcjcigackgaclgbgb``````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade11.xpm b/hacks/images/bubbles/jade11.xpm new file mode 100644 index 00000000..a556fe25 --- /dev/null +++ b/hacks/images/bubbles/jade11.xpm @@ -0,0 +1,271 @@ +/* XPM */ +static char *jade11[] = { +/* width height ncolors chars_per_pixel */ +"72 72 192 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #139713", +"`k c #149514", +"`l c #1A8B1A", +"`m c #159315", +"`n c #129312", +"`o c #158B15", +"`p c #128D12", +"`q c #148914", +"`r c #158715", +"`s c #148514", +"`t c #0F890F", +"`u c #128312", +"`v c #0F870F", +"`w c #0E850E", +"`x c #108110", +"`y c #0D830D", +"`z c #0F7F0F", +"a` c #127912", +"aa c #137513", +"ab c #107710", +"ac c #0C7D0C", +"ad c #0E750E", +"ae c #0F730F", +"af c #0F6F0F", +"ag c #0F6D0F", +"ah c #0E6B0E", +"ai c #0E690E", +"aj c #077307", +"ak c #0F650F", +"al c #0E630E", +"am c #0B630B", +"an c #0D5B0D", +"ao c #0A5F0A", +"ap c #036703", +"aq c #0B570B", +"ar c #075D07", +"as c #026502", +"at c #046104", +"au c #0A550A", +"av c #0B530B", +"aw c #016101", +"ax c #0C4F0C", +"ay c #0A510A", +"az c #025B02", +"b` c #094F09", +"ba c #045704", +"bb c #0A4D0A", +"bc c #065306", +"bd c #0A4B0A", +"be c #065106", +"bf c #015901", +"bg c #074D07", +"bh c #054F05", +"bi c #074B07", +"bj c #084908", +"bk c #094709", +"bl c #084508", +"bm c #064706", +"bn c #014F01", +"bo c #004B00", +"bp c #063D06", +"bq c #063B06", +"br c #073907", +"bs c #033D03", +"bt c #004100", +"bu c #013F01", +"bv c #033B03", +"bw c #053505", +"bx c #003D00", +"by c #063306", +"bz c #053105", +"c` c #023502", +"ca c #003700", +"cb c #042B04", +"cc c #042904", +"cd c #012301", +"ce c #022102", +"cf c #011D01", +"cg c #021B02", +"ch c #011901", +"ci c #011701", +"cj c #011501", +"ck c #011301", +"cl c #010D01", +"cm c #21B621", +"cn c #1CB41C", +"co c #22AA22", +"cp c #1AAC1A", +"cq c #18A818", +"cr c #1F9C1F", +"cs c white", +"ct c #18A418", +"cu c #17A217", +"cv c #189E18", +"cw c #189A18", +"cx c #149C14", +"cy c #149014", +"cz c #119011", +"d` c #128A12", +"da c #0F8C0F", +"db c #128612", +"dc c #148214", +"dd c #138013", +"de c #127E12", +"df c #127C12", +"dg c #107C10", +"dh c #0F7A0F", +"di c #0B800B", +"dj c #0E780E", +"dk c #0B7C0B", +"dl c #117211", +"dm c #0A7A0A", +"dn c #0E720E", +"do c #0A780A", +"dp c #0A760A", +"dq c #106A10", +"dr c #0B720B", +"ds c #0F6A0F", +"dt c #0A700A", +"du c #0A6E0A", +"dv c #0B6C0B", +"dw c #0A6A0A", +"dx c #0B680B", +"dy c #067006", +"dz c #0C660C", +"e` c #0A660A", +"ea c #056E05", +"eb c #056C05", +"ec c #0B620B", +"ed c #0C600C", +"ee c #0D5E0D", +"ef c #056A05", +"eg c #066806", +"eh c #076407", +"ei c #0D580D", +"ej c #0A5C0A", +"ek c #076007", +"el c #046404", +"em c #0A5A0A", +"en c #075A07", +"eo c #085808", +"ep c #045E04", +"eq c #095409", +"er c #015E01", +"es c #055605", +"et c #055405", +"eu c #015601", +"ev c #015401", +"ew c #035003", +"ex c #015201", +"ey c #034C03", +"ez c #034A03", +"f` c #B1FFB1", +"fa c #074207", +"fb c #034803", +"fc c #044604", +"fd c #074007", +"fe c #083E08", +"ff c #014601", +"fg c #024402", +"fh c #034203", +"fi c #044004", +"fj c #053805", +"fk c #063606", +"fl c #013A01", +"fm c #023802", +"fn c #052E05", +"fo c #013401", +"fp c #013201", +"fq c #042C04", +"fr c #013001", +"fs c #012E01", +"ft c #012C01", +"fu c #042604", +"fv c #012A01", +"fw c #022802", +"fx c #042404", +"fy c #002600", +"fz c #022002", +"g` c #011E01", +"ga c #001000", +"gb c #000A00", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````brfebwfabdfafvbwbqfqbr````````````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````feblaxfnfofjbkfaaqeibmfiavblavblbdbwfk````````````````````````````````````````````````````", +"````````````````````````````````````````````````fnfrftfpbjalavfcdqfjbmakedagafakbmfcaqbsfyanavaxbz``````````````````````````````````````````````", +"````````````````````````````````````````````ftbqfmbjanakalaldldlaaafemaqbtfbafagdlfhflbufvalbpfwc`frft``````````````````````````````````````````", +"````````````````````````````````````````fvbdbdbmalfyb`bhfgdqaianeydzesa`bsbvdlbheyesddafbjezaufhcaakbwbbbl``````````````````````````````````````", +"````````````````````````````````````cebkanalbgbmedfbfsfbbeah`rdcdf`samdlbncaewbofh`raraeaeaveoejfdfcbmavanfkcb``````````````````````````````````", +"``````````````````````````````````bravayfcbialaaeoa`eyesecdvdedxdnen`oedfcaieobedle`ekabarambjemfmbifbdqdqanfabz````````````````````````````````", +"``````````````````````````````fwfaaxfmeefyejemaoamenewardv`qcydbdbadafafepexemfhex`oca`oenad`odndcddddaaafdqeefafvfk````````````````````````````", +"````````````````````````````fqftayfidqb`eoecetarde`i`i`g`o`u`idb`idpdgdgdzejexatepafeudfbhddevdnabaoc`anbcfgbubdaycdfk``````````````````````````", +"``````````````````````````fkbdcabldqaiafece`dg`idrad`q`uegdr`id``xegad`qategfgfh`ieudtdu`gflaoahewbafi`sftaybxbubbfifqfy````````````````````````", +"````````````````````````brbdbsaueqdlfiaeddaedg`i`o`x`o`mdudpcwcwcyege``xdodperdnbfegelegevbfbnejaobibaekfffffgeyfhanbvfjfv``````````````````````", +"``````````````````````fefacaakeqalaudcah`r`idg`q`xdudrcv`m`e`tdk`k`ed`erarcyeneabfameudteg`wdbdbdudeedevaoewfibtbxfleeavaxfe````````````````````", +"````````````````````ccblfadqaqeoeedcecewbofoa`ddbiegac`ecpcydpbfatap`yctcpdkefdp`dbce`ategeg`v`i`iduekbaaien`rbiauejbgfab`fjfn``````````````````", +"``````````````````ccbkavfiembeaiaedfbnbndtdu`zdoeueldpcw`n`h`xeren`z`derelda`ddkd`erbx`y`pacac`gctdjepfcafba`saqffecaabgfvbqbwci````````````````", +"``````````````````fxeifmakbxalbtahffbodj`u`xcycyazbfebdpajapdgaodhapcnaddvapcpcucnasaodk`k`pcycp`kctdtbffhfobnfretendlafbmfefwbr````````````````", +"````````````````fwblfoanakdzeyaoekboemeudjcyct`gdycwebacdmacdpcn`uascwekdrajcpczdy`edxd``wct`dd`dk`gctdhdeaedlba`oaibtdldqakbkfvfy``````````````", +"``````````````ccfyfdeiemaabhejekdudgexatcycv`gd`eldpcv`jcpcqcudidyawe``uardmczcp`f`wesdhcn`nczegdodtcw`wdjexbebabnflfraoagedakbzfjfn````````````", +"``````````````fefdbmaldlbhbtfme`dgdjbidrcy`mdo`ibf`n`dcncn`daj`z`eetd`ezapdmajeadkcndadi`w`e`tbferaj`wcwd`dubafcdc`rdvaoaieqdqbbfdfe````````````", +"````````````cebzblayakdsbcbcboardhdjexd`docvfger`h`dcncpcn`fas`kapasaw`p`dehapasawad`w`d`d`f`tap`ecpajdk`mdj`zbaendgabdedlbcdqanayblg```````````", +"````````````brbpavauedamdzeye``oadepadatcweb`pcu`f`hcq`fcm`yeydjcue`cvas`m`ycucncxdoawasea`wapad`ueycyesdrcwcw`o`q`iesdxafecauananfafe``````````", +"``````````cfbwfjeebmbeeoagff`se`ehexep`sdpcy`dcxerajdmdacpeaeyapead``ddacxcq`c`c`j`yasdrasd`ffdv`ddjer`oendp`z`xadddboaiesdlafdqanbdfece````````", +"``````````fefaanfceqeoaiaia``odrehegdxafac`f`ddp`qdoeacpcueaefcxcpcqcxcp`c`d`ccu`j`jcyewdvenffdrbtaoeldybfeyepegbabaembseya`ememakavaxfq````````", +"````````fzccbzeeeqeebhbtfcba`rcyd`djbieucy`ecvajapdo`f`ndabtdicx`ccn`jcqcncn`ccn`w`wdr`fcmd``udyebdobfajeffccvepeuepbobnendcejemalavfdcech``````", +"````````fnfabdanakbefgbteybadhdh`x`geueu`tcu`e`hdkcp`dcudyasdacxcu`c`j`p`fcp`ccmcqebaseaajeaad`wajcx`kdodmahaz`odzbnboehdnabahecdqbmbkfvfz``````", +"````````ccbdfaaledfbaqdcbnbna`bueoegct`pcy`y`fcpcq`f`hczenaj`tdida`d`i`r`r`e`ccm`feb`k`ncqdaaraserdoda`ydyddeladeccafoe`a`dddfedbmdqeifdfn``````", +"``````fxfvfrfaakbmfbauezfmboekdrepeodr`ecv`hcxctcncudiea`mdm`fdicmcrcrcr`bcrcr`r`z`rea`dcncxdo`eapebaj`yazeyelamde`ibiboa``ra`dlflbiaybqfyg`````", +"``````fxfac`bbakbxfbbheneodedb`z`zexbfd`cv`ectcncncqcueaasaj`wdj`bcoco`bcr`a`a`l`raadicm`ccnczaw`zapapctdveoazfgeuafeoejdgabaea`bmfcbzfqfvch````", +"``````cbbqbjfib`bubiejbmetdv`zdjcvepcyeaacct`d`ncncncndmareaaca`cr`b`a`a`a`a`bcr`leiaccmcpcqdidk`ednbfey`eeueubuatepezaiabaedzembgfpbdbrfvcd````", +"``````fnbweifibgbufaeyagba`q`u`icwdrfbdjerdy`tajdacmcqcxawapd`co`b`a`af`f`f``a`bcrcocwcu`ccn`yefefcucnerdyegbxahfhem`iev`rendzemfbbkeiblccfw````", +"````cgg`bdbdalb`ezfgamffewdh`i`g`od`euazbeafbfapdicqcn`wbh`wcm`b`b`af`f`csf`f``a`b`bcocn`ccp`tcndmapajdy`wdpazfl`ubueoae`sesecaobheeeifrbqfyck``", +"````fzbybkanbmeeflbtejffewen`gcw`i`idpelbfe`ad`meaczcmeaaj`jco`b`a`af`f`f`f`f``a`acrdbcvcpczdyasdi`ydy`tcv`pdpflbhexddekdddxeoemeqeqaufwaxfecg``", +"````cgbrfjanbseqbuftftemffendu`ucw`o`zebacd`efcpenajcqdyaj`pcv`c`a`af`f`f`f``a`a`ldq`celawardhefdk`k`f`k`md`dudcbnehenardc`sbhfgejaleefaaxfqfx``", +"````cgbzftbdfobdembeaieqekbaexdjepdhcyacd``edpbt`mdm`najdo`j`eco`b`b`a`af``a`a`bcocrdudy`naccpd``wdo`h`gcvcvdpegdhdb`ie`dddcaheyfcakaqfdfjfqch``", +"````g`cbfqfwfmbueqbcbhfaenaragbobaduacdudk`kelardydacx`j`p`hcm`c`b`bco`a`a`a`b`b`ldj`p`ncq`f`j`ycydpdpazeg`pcw`g`zbnekdcdeabdlagakayavayfafefz``", +"````ccbzftbpauakaueyaoeyenewboam`iepehbfeuegafdycz`dcu`najascu`c`ccr`lcr`b`bcr`lcrducz`fcxdi`tcndp`dbxenecdocwduepa`badddcaiaiagfhfhaqanfkfecc``", +"````fxbrfrfdbdbiakbcbcetabafbaboageuepdzeodnat`h`hcu`kdias`q`ncn`cdbafa`aa`ccobdegeb`n`fcpdmcz`d`jdpaceadnegcvdhduekesdx`sabaiecfcbkavaxfkfqfx``", +"````cibzftfdfofibiafa`eydd`rdvdvepepdu`iev`odk`e`e`ncxefaodk`hctcucvegcmegdbdw`o`idwajczcq`kcp`dcv`n`vcyezazehcy`qdb`uaddxaheoaub`bsfmbkbzbyfx``", +"````cjfqbrc`fabmbseebhfgaodc`sdhdv`zdhbf`iazel`e`e`d`perdmctcp`hcpctdpcmejdk`pdycnelapdi`hcp`e`dcvcv`pdtdxamfbex`q`oddaeafafeoemalbmbvfrbwfkci``", +"````gaccfwfneibjfcauamfgag`rad`o`odjdwbfezdbbfac`k`k`e`ycwcu`dcpctcz`dfgdbdp`n`ndaapefcvapcpcpcp`pcw`vdpen`gdc`r`o`s`oahaga`aieqakeiavfrfwbrcj``", +"````gag`fefeaxaybmfcaiecaoa`a``o`idebabaeqdgeobfdp`k`fdpffdicvcp`yapdpaseacu`d`ecxajctercvcv`y`e`v`xdodw`i`oejba`s`sabamdfaidlakdqb`bvaxcebzga``", +"``````fzfnaxaxb`cdbxema`ejaeab`rdnekepepaheuepat`edk`felcweldm`yer`uefefdp`jcn`dczapendi`tbfdh`zdpatdudtcwdnfieoen`rabdfabdlageealbjbqfrcfce````", +"``````fufeg`fafacafieeaaecdedc`rbo`rbabnah`gexazafep`eegbfflebaterbfcwbfeneldi`kaze`cv`y`n`pepbhdududwbu`sbgevdden`saba`a`ecbgbgayanfdfycjg`````", +"``````cgbyfeaxfdbqblbgdlaaama`dfafafedbgflcafcaiat`xcwaceg`gfgctatatazcwerbhdkacbfdbcyegd`cyegbxfbaeflbebuboboewdxdeaeaidlbicafjbmblaxfwg`cg````", +"``````clfxbyfjbdfmfyfhalafeoenbtb`ffbgfmfobmexba`z`icv`vdodod``mdk`vdpateuddeleuerejafadazdoduexehekbndfdebodvafdeahbcafalalakbbavfsbdccfuga````", +"````````fucbfnaxaxcabdfcdleoeoa`bmb`fofodlbababadgcv`gcycycvd`ac`ect`gdt`e`qbcdvae`iamcyemfh`regdr`ue`arbadw`r`ra`fbfbfcakalakcabqbdbkfxcf``````", +"````````fxcbfnc`bbfpbscaemdsalbtfgffddagboe`duekdg`gcwdhepdwdrep`pcv`ed`doexeoaoeufbegdreheodudrcyad`o`sdg`ramaobhbpb`bbaqaqfwfrbrcfbrfqfz``````", +"````````cichccfkaxfsavfdbidlbcbxdsb`fieddcbodnde`q`z`idbaddrdrdrcycvcwcvcwatbufgecemdhdbdre``x`odwexdve`afenesfaemeyc`faflbsbjeifvfecdccga``````", +"``````````cgcdfkbkbkfrbsanaleeezdqbteyeyewffe`deab`s`icwdb`xdh`i`icwcvcwdhdr`ueqbeekduehe`ducyehen`oeyb`ewfmaybhaaeoakcacafveibvbyfncfch````````", +"``````````ckcig`fefrccbsalfidqfgdqaqeoaiafaoaf`rdnehdvdwdj`qdhdbcw`i`g`gdjdrdrbabaepexaieqex`udedvewa`bsc`fgbhdldlaibpflfrfmfjbkg`brgacg````````", +"````````````fzcdfeblg`bvfrbsbieqflb`ema`dfabdcdcahamarbsaiepdwdjdg`u`i`odr`q`o`xe`ehexahafen`o`o`saoaabmeyejaoafafeqfcbseic`fvbyfncccg``````````", +"````````````gafubybrbrfjc`caayakbgfrfbaiaadlecdcafenboafffbaekduekdv`s`udvehadadeke`bodlfhesab`rdeetagbhecaaakejeeanb`fpfrbdfsbkbrfzcg``````````", +"``````````````fxcefqfebqfvaveiaqaleeauavfbaidla`dzeneyfiffendx`rdnab`q`idharekdndnenenewecdn`recbtbjbhdfaieqaualdqakaqfmfqfebzfqcjfz````````````", +"``````````````cjchfxbzfjbwblbjavbgb`fleebjdqemdeagaebca`ffarah`sdne`dea`abdedvamararewafdeaeeobvdsbhaaamemakbgeeeialavftfqbzfwchcjga````````````", +"````````````````cifubybybdfsfteieibjb`bsfhfyezafdsedemejamdlababdxecaedf`rahafar`rbhecafaedzbmeybcaadldldldqakakaneifdfvfqfkcffxcg``````````````", +"``````````````````fxcccdfefefwfjeieialaqb`avbgdldlafaaagafdeafaoafamaresameyesafbceoaoamagbheyaaaidsalemauakeibmbjblfabqfefzcecj````````````````", +"``````````````````gbcegaccfefvcdfaeianavanflbqcafhbueqbgeyemaibcbhfgfmdeaoaiaiamaiedbcejemfabeakededdqaqbvaqbjaxbdfjfjfkcecccgcl````````````````", +"````````````````````clfzfxfwfefvfaavavbkavauavfidqbxfabkc`ejembgfbafc`bteybhfbdlbcecfbakejbqdlananayb`alb`eifaaxbwfyfycig`fxcj``````````````````", +"``````````````````````clcjfzfwbzfkbdaxfdbkayeeavayfob`bqbpeeejfcbufhfabxbqbxbueqemb`eddqalauemaueianbsbdfaaxaxbzfvcbfnfnfuci````````````````````", +"````````````````````````gbcgfzfkfebrbkfabqfrc`fibvbdfofibiakaydqbqfcbxbiakfsfheqakaqfcflfhanakb`bvfrbyfmaxbkfecdfqbyccfxcj``````````````````````", +"``````````````````````````ckcjcccifqcbfwfjfvfrc`g`bvfdfrbsakbgfmfjfheedqdqfhfldqb`bvcdbianeeanblblfofdbdfdfefzbybycccgcl````````````````````````", +"````````````````````````````clfxcicccefnfwchfrfrftc`blfmeiavblbsfvbsbbayfabdfaanavbseebjbsblfabdaxaxblbkfeccfucffxfzgb``````````````````````````", +"``````````````````````````````gbcicicbfqcdbyblbqbdfdfebdavfofrbdaxfrfwbzaxblaneiaxfafrfjfsftfrfvfvbwfefeccfzccfxcgcl````````````````````````````", +"``````````````````````````````````gackcgcgfxbrbybrfafkbwbqaxaxfabrfwfpbdbkbqbkbkblbqfafvcffyfyfnbyfkfececfcjfzcj````````````````````````````````", +"````````````````````````````````````gbgacjfxbyccbzfebzfvccfvfwbqbkblbqblbqbqfsfkfybrbzfwfyfqbrfebrfucjchcgcjcl``````````````````````````````````", +"````````````````````````````````````````clgbcgfxfnbyfqfqfwccbzcbbybyfyfwfnbzbzcfchfxbrfwbzcdfncccccjcjcjcl``````````````````````````````````````", +"````````````````````````````````````````````clcifzcichckcgcbccfuccfwcbg`cecfbrfncefzfubybzcbchchgagacl``````````````````````````````````````````", +"````````````````````````````````````````````````gbclcgchckfxcjchchcccifxckgachcicjchfzfufxcjgaclgb``````````````````````````````````````````````", +"``````````````````````````````````````````````````````clclckcggacicicjcgcgcjcgcgcgcgckcjclgb````````````````````````````````````````````````````", +"``````````````````````````````````````````````````````````````clgbgbgbgbgbclgbgbclgb````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade2.xpm b/hacks/images/bubbles/jade2.xpm new file mode 100644 index 00000000..b070304a --- /dev/null +++ b/hacks/images/bubbles/jade2.xpm @@ -0,0 +1,95 @@ +/* XPM */ +static char *jade2[] = { +/* width height ncolors chars_per_pixel */ +"12 12 76 2", +/* colors */ +"`` c None", +"`a c #35CB35", +"`b c #1AA71A", +"`c c #158B15", +"`d c #148914", +"`e c #158715", +"`f c #137513", +"`g c #107710", +"`h c #0F6D0F", +"`i c #0E6B0E", +"`j c #0E690E", +"`k c #0F650F", +"`l c #0E630E", +"`m c #0A5F0A", +"`n c #036703", +"`o c #0B570B", +"`p c #075D07", +"`q c #0A550A", +"`r c #0C4F0C", +"`s c #0A510A", +"`t c #045704", +"`u c #065106", +"`v c #074D07", +"`w c #074B07", +"`x c #094709", +"`y c #063B06", +"`z c #073907", +"a` c #033D03", +"aa c #033B03", +"ab c #053505", +"ac c #003D00", +"ad c #053105", +"ae c #003700", +"af c #042904", +"ag c #012301", +"ah c #011501", +"ai c #1CB41C", +"aj c #17A217", +"ak c #189E18", +"al c #189A18", +"am c #119011", +"an c #128A12", +"ao c #0F8C0F", +"ap c #148214", +"aq c #138013", +"ar c #0F7A0F", +"as c #0B800B", +"at c #0A7A0A", +"au c #0A780A", +"av c #0A760A", +"aw c #0B720B", +"ax c #0F6A0F", +"ay c #0A6A0A", +"az c #056C05", +"b` c #056A05", +"ba c #076407", +"bb c #0D580D", +"bc c #0A5C0A", +"bd c #046404", +"be c #075A07", +"bf c #045E04", +"bg c #055605", +"bh c #035003", +"bi c #015201", +"bj c #B1FFB1", +"bk c #034803", +"bl c #044604", +"bm c #074007", +"bn c #083E08", +"bo c #024402", +"bp c #044004", +"bq c #013A01", +"br c #052E05", +"bs c #042C04", +"bt c #012A01", +"bu c #000A00", +/* pixels */ +"`````````l`ja`aqae``````", +"`````zbp`calaubd`mbobt``", +"`````fbibdaj`pbgau`u`h``", +"``adbl`w`nasaiawazakbebm", +"``bp`tbkaoanbjalb`ac`ebb", +"```qbebaamaj`aamavalap`o", +"```rbcbf`batavbeavbp`g`y", +"``af`wbp`dawalaraybgbqag", +"````abbq`h`i`gbhax`vbs``", +"````bu`xaa`s`kblaabnah``", +"````````bradbr`zaf``````", +"````````````````````````" +}; diff --git a/hacks/images/bubbles/jade3.xpm b/hacks/images/bubbles/jade3.xpm new file mode 100644 index 00000000..3e8a1025 --- /dev/null +++ b/hacks/images/bubbles/jade3.xpm @@ -0,0 +1,114 @@ +/* XPM */ +static char *jade3[] = { +/* width height ncolors chars_per_pixel */ +"14 14 93 2", +/* colors */ +"`` c None", +"`a c #35CB35", +"`b c #1CB11C", +"`c c #1AA71A", +"`d c #169D16", +"`e c #179717", +"`f c #179317", +"`g c #158B15", +"`h c #148914", +"`i c #158715", +"`j c #0F890F", +"`k c #128312", +"`l c #0D830D", +"`m c #127912", +"`n c #137513", +"`o c #0C7D0C", +"`p c #0E750E", +"`q c #0F730F", +"`r c #0F6F0F", +"`s c #0F6D0F", +"`t c #0E6B0E", +"`u c #077307", +"`v c #0E630E", +"`w c #0B630B", +"`x c #0A5F0A", +"`y c #0A550A", +"`z c #0B530B", +"a` c #0C4F0C", +"aa c #094F09", +"ab c #045704", +"ac c #0A4D0A", +"ad c #065306", +"ae c #0A4B0A", +"af c #065106", +"ag c #015901", +"ah c #054F05", +"ai c #074B07", +"aj c #084908", +"ak c #084508", +"al c #064706", +"am c #073907", +"an c #033D03", +"ao c #053505", +"ap c #063306", +"aq c #042B04", +"ar c #042904", +"as c #011D01", +"at c #011901", +"au c #21B621", +"av c #1CB41C", +"aw c white", +"ax c #18A418", +"ay c #189A18", +"az c #149C14", +"b` c #149014", +"ba c #0F8C0F", +"bb c #128612", +"bc c #148214", +"bd c #138013", +"be c #107C10", +"bf c #0A760A", +"bg c #0F6A0F", +"bh c #0A6A0A", +"bi c #0C660C", +"bj c #0A660A", +"bk c #0B620B", +"bl c #0C600C", +"bm c #056A05", +"bn c #066806", +"bo c #076407", +"bp c #0D580D", +"bq c #0A5C0A", +"br c #076007", +"bs c #046404", +"bt c #0A5A0A", +"bu c #075A07", +"bv c #095409", +"bw c #035003", +"bx c #034C03", +"by c #074207", +"bz c #034803", +"c` c #044604", +"ca c #074007", +"cb c #083E08", +"cc c #024402", +"cd c #053805", +"ce c #023802", +"cf c #012E01", +"cg c #042604", +"ch c #022802", +"ci c #042404", +"cj c #022002", +"ck c #011E01", +/* pixels */ +"``````````aa`rbdahbp````````", +"``````akbi`gay`hal`qbgce````", +"````aebu`kbnayah`c`o`xahcf``", +"`````sb`cc`bbj`eaubmbfbbai``", +"``ambd`q`o`dba`f`cbxbfbkbcae", +"``aebk`fbeav`aawbc`j`obqadae", +"``ca`wbvbsaxau`abfazcc`t`mbp", +"``a``s`f`xax`d`ubm`lbo`i`nae", +"``aqaaajab`ebhagbzagbwafc`cb", +"````cjai`rbj`pbhbr`gafblam``", +"````asaoanbtadbiad`v`yaecg``", +"``````cichcdby`zceacaeci````", +"``````````arcgckapat````````", +"````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade4.xpm b/hacks/images/bubbles/jade4.xpm new file mode 100644 index 00000000..ce3dc397 --- /dev/null +++ b/hacks/images/bubbles/jade4.xpm @@ -0,0 +1,170 @@ +/* XPM */ +static char *jade4[] = { +/* width height ncolors chars_per_pixel */ +"20 20 143 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #1A8B1A", +"`k c #158B15", +"`l c #148914", +"`m c #158715", +"`n c #148514", +"`o c #0F890F", +"`p c #128312", +"`q c #0E850E", +"`r c #0D830D", +"`s c #0F7F0F", +"`t c #127912", +"`u c #107710", +"`v c #0C7D0C", +"`w c #0E750E", +"`x c #0F730F", +"`y c #0F6F0F", +"`z c #0E6B0E", +"a` c #077307", +"aa c #0F650F", +"ab c #0E630E", +"ac c #0B630B", +"ad c #0D5B0D", +"ae c #036703", +"af c #0B570B", +"ag c #075D07", +"ah c #026502", +"ai c #046104", +"aj c #0A550A", +"ak c #0B530B", +"al c #016101", +"am c #094F09", +"an c #065306", +"ao c #0A4B0A", +"ap c #065106", +"aq c #074D07", +"ar c #054F05", +"as c #074B07", +"at c #084908", +"au c #094709", +"av c #084508", +"aw c #064706", +"ax c #014F01", +"ay c #004B00", +"az c #063B06", +"b` c #073907", +"ba c #004100", +"bb c #013F01", +"bc c #033B03", +"bd c #053505", +"be c #003700", +"bf c #042B04", +"bg c #042904", +"bh c #012301", +"bi c #022102", +"bj c #021B02", +"bk c #011901", +"bl c #011701", +"bm c #011501", +"bn c #011301", +"bo c #010D01", +"bp c #21B621", +"bq c #1CB41C", +"br c #22AA22", +"bs c #1AAC1A", +"bt c #18A818", +"bu c white", +"bv c #18A418", +"bw c #17A217", +"bx c #189E18", +"by c #189A18", +"bz c #149014", +"c` c #119011", +"ca c #128A12", +"cb c #128612", +"cc c #127E12", +"cd c #127C12", +"ce c #107C10", +"cf c #0F7A0F", +"cg c #0B800B", +"ch c #0E780E", +"ci c #0B7C0B", +"cj c #117211", +"ck c #0A7A0A", +"cl c #0E720E", +"cm c #0A760A", +"cn c #106A10", +"co c #0B720B", +"cp c #0F6A0F", +"cq c #0A6E0A", +"cr c #0B6C0B", +"cs c #0A6A0A", +"ct c #0B680B", +"cu c #067006", +"cv c #0A660A", +"cw c #056C05", +"cx c #0B620B", +"cy c #0D5E0D", +"cz c #056A05", +"d` c #066806", +"da c #076407", +"db c #0D580D", +"dc c #076007", +"dd c #0A5A0A", +"de c #075A07", +"df c #085808", +"dg c #045E04", +"dh c #015E01", +"di c #055605", +"dj c #015201", +"dk c #034C03", +"dl c #034A03", +"dm c #074207", +"dn c #034803", +"do c #044604", +"dp c #083E08", +"dq c #014601", +"dr c #044004", +"ds c #053805", +"dt c #063606", +"du c #013A01", +"dv c #023802", +"dw c #052E05", +"dx c #013401", +"dy c #042C04", +"dz c #013001", +"e` c #042604", +"ea c #012A01", +"eb c #022802", +"ec c #042404", +"ed c #002600", +"ee c #022002", +"ef c #011E01", +"eg c #001000", +/* pixels */ +"``````````````dwdmdzbbaoauds````````````", +"``````````dpasba`zce`ncd`yddasdt````````", +"````````azcpcr`wcm`sbycldc`x`maadm``````", +"``````aucxcr`ncmbxcb`halcmbzdgdecpaz````", +"````dpcydzdjbwci`dcuagbvcrcz`eapascybh``", +"````dwan`ldj`o`rcg`hcgbqahdidhbzdc`tdb``", +"``bicyabcod``fbpcabqbw`cckcuc`bxax`tdbbk", +"``bdaw`mcfbvbwbsa`br`a`jbpcgbs`eacctbedy", +"``auaddqbzczcbc``o`abu`b`qaecm`vayclabb`", +"``eacnan`idaaibqclbr`b`jbtbsdoby`kcjawbk", +"``bhamdlcccq`k`f`h`d`p`rcwbs`vax`n`taje`", +"``efdxcjcddjced`dndharcu`rdndjdj`xarakee", +"``bndmbedd`tchbzcs`ico`gcscqcecvabajebbn", +"````eebcabcx`ycvce`kcqdc`x`mdqdfbedvdt``", +"````bodtaddudk`yagcv`udeclcj`yaqafb`bl``", +"``````bjdpdbdratdodlandkajaaabavbkee````", +"````````bjebaudvabdmabasafaoaubgec``````", +"``````````egbfdtedaudpaudwdpecbn````````", +"``````````````bobmbmbkbjeebo````````````", +"````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade5.xpm b/hacks/images/bubbles/jade5.xpm new file mode 100644 index 00000000..120e97b1 --- /dev/null +++ b/hacks/images/bubbles/jade5.xpm @@ -0,0 +1,200 @@ +/* XPM */ +static char *jade5[] = { +/* width height ncolors chars_per_pixel */ +"24 24 169 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #149914", +"`h c #179317", +"`i c #139713", +"`j c #149514", +"`k c #1A8B1A", +"`l c #159315", +"`m c #129312", +"`n c #158B15", +"`o c #148914", +"`p c #158715", +"`q c #148514", +"`r c #128312", +"`s c #0F870F", +"`t c #0E850E", +"`u c #108110", +"`v c #0D830D", +"`w c #0F7F0F", +"`x c #127912", +"`y c #137513", +"`z c #107710", +"a` c #0C7D0C", +"aa c #0E750E", +"ab c #0F730F", +"ac c #0F6F0F", +"ad c #0F6D0F", +"ae c #0E6B0E", +"af c #0E690E", +"ag c #077307", +"ah c #0F650F", +"ai c #0E630E", +"aj c #0B630B", +"ak c #0D5B0D", +"al c #0A5F0A", +"am c #036703", +"an c #0B570B", +"ao c #075D07", +"ap c #0A550A", +"aq c #0B530B", +"ar c #016101", +"as c #0C4F0C", +"at c #0A510A", +"au c #025B02", +"av c #045704", +"aw c #0A4D0A", +"ax c #065306", +"ay c #0A4B0A", +"az c #065106", +"b` c #015901", +"ba c #074D07", +"bb c #054F05", +"bc c #074B07", +"bd c #084908", +"be c #094709", +"bf c #084508", +"bg c #064706", +"bh c #014F01", +"bi c #004B00", +"bj c #063B06", +"bk c #073907", +"bl c #033D03", +"bm c #004100", +"bn c #033B03", +"bo c #053505", +"bp c #003D00", +"bq c #063306", +"br c #053105", +"bs c #003700", +"bt c #042B04", +"bu c #042904", +"bv c #012301", +"bw c #022102", +"bx c #011D01", +"by c #021B02", +"bz c #011901", +"c` c #011701", +"ca c #011501", +"cb c #011301", +"cc c #010D01", +"cd c #1CB41C", +"ce c #1AAC1A", +"cf c #1F9C1F", +"cg c #18A418", +"ch c #17A217", +"ci c #189E18", +"cj c #189A18", +"ck c #149C14", +"cl c #149014", +"cm c #119011", +"cn c #128A12", +"co c #0F8C0F", +"cp c #128612", +"cq c #148214", +"cr c #138013", +"cs c #127C12", +"ct c #0F7A0F", +"cu c #0B800B", +"cv c #0B7C0B", +"cw c #117211", +"cx c #0A7A0A", +"cy c #0E720E", +"cz c #0A780A", +"d` c #0A760A", +"da c #106A10", +"db c #0B720B", +"dc c #0F6A0F", +"dd c #0A700A", +"de c #0A6E0A", +"df c #0B6C0B", +"dg c #0A6A0A", +"dh c #067006", +"di c #0C660C", +"dj c #0A660A", +"dk c #056E05", +"dl c #056C05", +"dm c #0B620B", +"dn c #0C600C", +"do c #0D5E0D", +"dp c #056A05", +"dq c #066806", +"dr c #076407", +"ds c #0D580D", +"dt c #0A5C0A", +"du c #076007", +"dv c #046404", +"dw c #0A5A0A", +"dx c #075A07", +"dy c #045E04", +"dz c #095409", +"e` c #015E01", +"ea c #055605", +"eb c #015601", +"ec c #035003", +"ed c #015201", +"ee c #034C03", +"ef c #034A03", +"eg c #B1FFB1", +"eh c #074207", +"ei c #034803", +"ej c #044604", +"ek c #074007", +"el c #083E08", +"em c #014601", +"en c #024402", +"eo c #034203", +"ep c #044004", +"eq c #053805", +"er c #063606", +"es c #013A01", +"et c #023802", +"eu c #052E05", +"ev c #042C04", +"ew c #013001", +"ex c #012E01", +"ey c #012C01", +"ez c #012A01", +"f` c #022802", +"fa c #042404", +"fb c #002600", +"fc c #022002", +"fd c #011E01", +"fe c #001000", +"ff c #000A00", +/* pixels */ +"``````````````````eleubedsaqbfer````````````````", +"``````````````ayaibbafdiblbbcrefbsaw````````````", +"``````````f`etdtajaoclaadyeobsaacq`ydoer````````", +"````````bkapepab`n`lcjdqczcydvb`alduenakez``````", +"``````buepafbhdeebcj`u`wdvcvbpa`cgej`qdmezc`````", +"``````ek`yduedcidv`icharaoceea`mcz`tazesadbr````", +"````bkapdi`naadl`f`feedj`lcdar`t`reacj`hacakel``", +"````brdoejclbc`eam`mcucdcdcddbcndlagcidydxdwek``", +"``faeheietdbdb`gcddk`fcf`b`pdkckam`vdv`h`xcwatfd", +"``euepehav`heidhcockcn`aeg`bcjcddpe`bpdw`pdwdsf`", +"``bkbleyem`r`wcndxdhci`aeg`a`caocv`jdedrcqendoev", +"``brapeedxajdrdqcm`mchcf`b`kcmcud`dxcj`xcqadanel", +"``evehdoalctctau`ee`cecgdtdhamceciddei`nacdwbner", +"``fcasbpdt`pdyeb`edvcx`rd``ddxb`d`ddep`p`zdobjbw", +"``cceqfbacbmbabg`w`scn`sebebacczdrcsdfaeaiawayfe", +"````buexbcbpepbi`ocpdbcicjenctdjdgdjeaeeesdsbv``", +"````fcbfewdzdw`zaebldg`rdb`ueddx`qbgaldzdsbqby``", +"``````faboaqesdaad`xaedj`zajecabdcajbaaievbz````", +"``````ffbubvakeseobaafenalajaxehdnanbdeqbwcc````", +"````````fferbeewbnepatejahdzejakbnetelbqca``````", +"``````````ffbtbqayayewewasdseweyezelbucc````````", +"``````````````ffeuevbrbqeubxbkbvbuca````````````", +"``````````````````ccbyc`bybycbff````````````````", +"````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade6.xpm b/hacks/images/bubbles/jade6.xpm new file mode 100644 index 00000000..521acf93 --- /dev/null +++ b/hacks/images/bubbles/jade6.xpm @@ -0,0 +1,222 @@ +/* XPM */ +static char *jade6[] = { +/* width height ncolors chars_per_pixel */ +"30 30 185 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #139713", +"`k c #149514", +"`l c #1A8B1A", +"`m c #159315", +"`n c #129312", +"`o c #158B15", +"`p c #128D12", +"`q c #148914", +"`r c #158715", +"`s c #148514", +"`t c #0F890F", +"`u c #128312", +"`v c #0F870F", +"`w c #0E850E", +"`x c #108110", +"`y c #0D830D", +"`z c #0F7F0F", +"a` c #127912", +"aa c #137513", +"ab c #107710", +"ac c #0C7D0C", +"ad c #0E750E", +"ae c #0F730F", +"af c #0F6F0F", +"ag c #0F6D0F", +"ah c #0E6B0E", +"ai c #0E690E", +"aj c #077307", +"ak c #0F650F", +"al c #0E630E", +"am c #0B630B", +"an c #0D5B0D", +"ao c #0A5F0A", +"ap c #036703", +"aq c #0B570B", +"ar c #075D07", +"as c #026502", +"at c #046104", +"au c #0A550A", +"av c #0B530B", +"aw c #0C4F0C", +"ax c #0A510A", +"ay c #025B02", +"az c #094F09", +"b` c #045704", +"ba c #065306", +"bb c #0A4B0A", +"bc c #065106", +"bd c #015901", +"be c #074D07", +"bf c #054F05", +"bg c #074B07", +"bh c #084908", +"bi c #094709", +"bj c #084508", +"bk c #064706", +"bl c #014F01", +"bm c #004B00", +"bn c #063D06", +"bo c #063B06", +"bp c #073907", +"bq c #033D03", +"br c #004100", +"bs c #013F01", +"bt c #033B03", +"bu c #053505", +"bv c #003D00", +"bw c #063306", +"bx c #053105", +"by c #023502", +"bz c #003700", +"c` c #042B04", +"ca c #042904", +"cb c #012301", +"cc c #022102", +"cd c #011D01", +"ce c #021B02", +"cf c #011901", +"cg c #011701", +"ch c #011501", +"ci c #011301", +"cj c #010D01", +"ck c #21B621", +"cl c #1CB41C", +"cm c #22AA22", +"cn c #1AAC1A", +"co c #18A818", +"cp c #1F9C1F", +"cq c #18A418", +"cr c #17A217", +"cs c #189E18", +"ct c #189A18", +"cu c #149C14", +"cv c #149014", +"cw c #119011", +"cx c #128A12", +"cy c #0F8C0F", +"cz c #128612", +"d` c #148214", +"da c #138013", +"db c #127E12", +"dc c #127C12", +"dd c #107C10", +"de c #0F7A0F", +"df c #0B800B", +"dg c #0E780E", +"dh c #0B7C0B", +"di c #117211", +"dj c #0A7A0A", +"dk c #0E720E", +"dl c #0A780A", +"dm c #0A760A", +"dn c #106A10", +"do c #0B720B", +"dp c #0F6A0F", +"dq c #0A6E0A", +"dr c #0B6C0B", +"ds c #0A6A0A", +"dt c #0B680B", +"du c #067006", +"dv c #0C660C", +"dw c #0A660A", +"dx c #056E05", +"dy c #056C05", +"dz c #0B620B", +"e` c #0C600C", +"ea c #0D5E0D", +"eb c #056A05", +"ec c #066806", +"ed c #076407", +"ee c #0D580D", +"ef c #0A5C0A", +"eg c #076007", +"eh c #046404", +"ei c #0A5A0A", +"ej c #075A07", +"ek c #085808", +"el c #045E04", +"em c #095409", +"en c #015E01", +"eo c #055605", +"ep c #055405", +"eq c #015601", +"er c #035003", +"es c #015201", +"et c #034C03", +"eu c #B1FFB1", +"ev c #074207", +"ew c #034803", +"ex c #044604", +"ey c #074007", +"ez c #083E08", +"f` c #014601", +"fa c #024402", +"fb c #044004", +"fc c #053805", +"fd c #063606", +"fe c #013A01", +"ff c #023802", +"fg c #052E05", +"fh c #013401", +"fi c #013201", +"fj c #042C04", +"fk c #013001", +"fl c #012E01", +"fm c #012C01", +"fn c #042604", +"fo c #012A01", +"fp c #022802", +"fq c #042404", +"fr c #002600", +"fs c #022002", +"ft c #011E01", +"fu c #001000", +"fv c #000A00", +/* pixels */ +"````````````````````````fpfmbbavbyfoca``````````````````````", +"``````````````````bwfhdndnafa`fkagbsbgeeeycc````````````````", +"````````````````eebgagakahdbdw`sblf`aff`bqbgfh``````````````", +"````````````fpanbsamejde`qdo`iefbdbzfeegd`ekbcavbx``````````", +"``````````bpazaaa`dd`octdgcq`odlaodqecbdaob`aketbgfo````````", +"````````fpaxdzd``r`ses`gcsdten`hdfdddmec`peldceidpbkfg``````", +"````````ffeiaaa`elcsecdyajdeckepclcvascn`v`eaierf`diee``````", +"``````cbanf`bm`xczdheh`dcnckerapeb`fcw`hcvcxecexdcagalbi````", +"````fqfgemet`qatfe`tdl`hdfeoerdf`c`was`g`xencz`iegeodneece``", +"````bpakbaex`odeeb`eapcl`fcqcrcl`c`t`eardyayddategeje`eeft``", +"````fcdnau`raees`fcwcncydxdx`e`lckduclajducwctbzbqaba`azbu``", +"``chflbkbfbmdeecebcrclcnajab`b`a`acmckcwcncnczfaamabaibzbofu", +"``fqbbeadzet`q`icndwdhcn`y`b`aeu`a`l`c`jdfduacahbs`rdzdibobw", +"``ftavazeaepeg`xdmaccvclcycm`aeu`acpap`f`wcwctay`q`rfadncbfg", +"``fseydndzej`ieqeqatcwcrdk`c`l`b`lcpcodhdmexdqed`od`eibkeefg", +"``fqbofbaiahdaedcveccraj`t`hdj`daj`d`ncucs`m`e`z`qahetazbbfq", +"``chfmazefaoadczeqdbdh`pdm`dduebcldfbddl`pdmesed`sd`alalbicd", +"``cjbxfheidvdcfbblddcscxew`icqbf`wdr`yacehesbebmaeaaexavceci", +"````cbevfcdibafkfbes`qcs`kctctctekdebsesdqblb`ddf`aoakbpch``", +"````ftcdbhbgexake`eg`q`gdqdocsctfebs`udrdsdkegbraqfebbbbcf``", +"````cjfscbfhalbqabafdkeodd`x`odqddedaedgddf`bfaabzbbbifdfv``", +"``````fqezeeeefefaafdtbmardb`oabdwegbmdcbcbaemakeafjfpfq````", +"````````fnbifcaxbgbvdpdvdcafdwdadweraeanaoageaaqawbucc``````", +"````````fvfqezaweafbfkeaexbvagbaeiaoaubce`aleeavcffsch``````", +"``````````fvbxbpbnfibtbzakavfeakbgeabzakbtbobjfjbxch````````", +"````````````cjcefpfobubobjezbtfkaneveebybuevcafqcj``````````", +"````````````````fuc`bpfdfrezbbezfofnfgbxbpfqce``````````````", +"``````````````````cjchchfufqcbcgcecefncccifv````````````````", +"````````````````````````cjcjcicgcicjfv``````````````````````", +"````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade7.xpm b/hacks/images/bubbles/jade7.xpm new file mode 100644 index 00000000..8c26b3d5 --- /dev/null +++ b/hacks/images/bubbles/jade7.xpm @@ -0,0 +1,232 @@ +/* XPM */ +static char *jade7[] = { +/* width height ncolors chars_per_pixel */ +"36 36 189 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #139713", +"`k c #149514", +"`l c #1A8B1A", +"`m c #159315", +"`n c #129312", +"`o c #158B15", +"`p c #128D12", +"`q c #148914", +"`r c #158715", +"`s c #148514", +"`t c #0F890F", +"`u c #128312", +"`v c #0F870F", +"`w c #0E850E", +"`x c #108110", +"`y c #0D830D", +"`z c #0F7F0F", +"a` c #127912", +"aa c #137513", +"ab c #107710", +"ac c #0C7D0C", +"ad c #0E750E", +"ae c #0F730F", +"af c #0F6F0F", +"ag c #0F6D0F", +"ah c #0E6B0E", +"ai c #0E690E", +"aj c #077307", +"ak c #0F650F", +"al c #0E630E", +"am c #0B630B", +"an c #0D5B0D", +"ao c #0A5F0A", +"ap c #036703", +"aq c #0B570B", +"ar c #075D07", +"as c #026502", +"at c #046104", +"au c #0A550A", +"av c #0B530B", +"aw c #016101", +"ax c #0C4F0C", +"ay c #0A510A", +"az c #025B02", +"b` c #094F09", +"ba c #045704", +"bb c #0A4D0A", +"bc c #065306", +"bd c #0A4B0A", +"be c #065106", +"bf c #015901", +"bg c #074D07", +"bh c #054F05", +"bi c #074B07", +"bj c #084908", +"bk c #094709", +"bl c #084508", +"bm c #064706", +"bn c #014F01", +"bo c #004B00", +"bp c #063D06", +"bq c #063B06", +"br c #073907", +"bs c #033D03", +"bt c #013F01", +"bu c #033B03", +"bv c #053505", +"bw c #003D00", +"bx c #063306", +"by c #053105", +"bz c #023502", +"c` c #003700", +"ca c #042904", +"cb c #012301", +"cc c #022102", +"cd c #011D01", +"ce c #021B02", +"cf c #011901", +"cg c #011701", +"ch c #011501", +"ci c #011301", +"cj c #010D01", +"ck c #21B621", +"cl c #1CB41C", +"cm c #22AA22", +"cn c #1AAC1A", +"co c #18A818", +"cp c #1F9C1F", +"cq c #18A418", +"cr c #17A217", +"cs c #189E18", +"ct c #189A18", +"cu c #149C14", +"cv c #149014", +"cw c #119011", +"cx c #128A12", +"cy c #0F8C0F", +"cz c #128612", +"d` c #148214", +"da c #138013", +"db c #127E12", +"dc c #127C12", +"dd c #107C10", +"de c #0F7A0F", +"df c #0B800B", +"dg c #0E780E", +"dh c #0B7C0B", +"di c #117211", +"dj c #0A7A0A", +"dk c #0E720E", +"dl c #0A780A", +"dm c #0A760A", +"dn c #106A10", +"do c #0B720B", +"dp c #0F6A0F", +"dq c #0A700A", +"dr c #0A6E0A", +"ds c #0B6C0B", +"dt c #0A6A0A", +"du c #0B680B", +"dv c #067006", +"dw c #0C660C", +"dx c #0A660A", +"dy c #056E05", +"dz c #056C05", +"e` c #0B620B", +"ea c #0C600C", +"eb c #0D5E0D", +"ec c #056A05", +"ed c #066806", +"ee c #076407", +"ef c #0D580D", +"eg c #0A5C0A", +"eh c #076007", +"ei c #046404", +"ej c #0A5A0A", +"ek c #075A07", +"el c #085808", +"em c #045E04", +"en c #095409", +"eo c #015E01", +"ep c #055605", +"eq c #055405", +"er c #015601", +"es c #015401", +"et c #035003", +"eu c #015201", +"ev c #034C03", +"ew c #034A03", +"ex c #B1FFB1", +"ey c #074207", +"ez c #034803", +"f` c #044604", +"fa c #074007", +"fb c #083E08", +"fc c #014601", +"fd c #024402", +"fe c #034203", +"ff c #044004", +"fg c #053805", +"fh c #063606", +"fi c #013A01", +"fj c #023802", +"fk c #052E05", +"fl c #013401", +"fm c #013201", +"fn c #042C04", +"fo c #013001", +"fp c #012E01", +"fq c #012C01", +"fr c #042604", +"fs c #012A01", +"ft c #022802", +"fu c #042404", +"fv c #002600", +"fw c #022002", +"fx c #011E01", +"fy c #001000", +"fz c #000A00", +/* pixels */ +"````````````````````````````````fbeyeybvfn``````````````````````````````", +"````````````````````````fkfqbjavdnbmeaafbmaqfvavby``````````````````````", +"````````````````````fsbdalb`fdaievepbsdievdabjauc`bvbl``````````````````", +"``````````````````avf`aleleve`dbdk`of`eldieharbjfjezdney````````````````", +"``````````````fnaydneleqdb`i`o`i`idddweuemerbhesabbzbcbtayfh````````````", +"````````````brbsenffdadd`o`odrctcvdxdleobfeiesbnaobafcfdfebufs``````````", +"``````````caeyaqebe`boa`biaccndmat`ycnec`ddxed`v`iehai`raubgb`fk````````", +"``````````efakalahbo`ucvazdzajdddecldscnclao`kcv`kdqfebneqdibmft````````", +"````````fvefaaegdreucv`geicscncrdvdxarcw`fepclcwdlctdgbebnfoagakfg``````", +"``````ccblakbcbodeeudlfd`hclclasapaw`dapaw`w`d`t`eaj`m`zekabdidnayfx````", +"``````bvebbeag`seeemdm`deodjcnevdy`dcu`c`jasasfc`deoek`zadboepafanfb````", +"````fwbyenbhf``rcxbicvcsap`fcydf`c`jcl`c`wdock`udzbfeccserboekegalfacf``", +"````caeyeaaqbna`elcqcv`fco`hek`tcy`i`r`c`f`kcoareocydveie`fla`dcbmeffk``", +"````eybbbwbhelcz`zbfcscqclcras`w`bcmcp`a`rdf`ccw`zapdsazerelddaebmbyfs``", +"````bvffbtevba`uctezeo`tcycoawcx`b`aex`acpct`c`yeccldvbwfe`i`rdwezefca``", +"``fwbkbmfieget`g`idmbfaddyckajcm`aexexex`aczcndvdfdvcsdmbhdadaelenauaxce", +"``cefqflejaieheuemcvcxdm`m`ndl`e`b`aex`acmdr`ncn`w`hcsdmde`idaahf`aqfgcf", +"``cafqauauaoekbo`ieeerafcwcrajcr`c`l`bcpcpcwcu`tdmbwe`ctembad`aifeaqfhca", +"``cgfqflbia`dadsemdresdh`ecuao`hcrededdt`iajcocncs`vewee`q`uduelb`fjbyfu", +"``fyfteff`amagad`odtewbf`k`ect`dcq`dcz`ncyecapcn`p`vekd``o`oagaiakavftch", +"````fkaxcbejegabdkemahem`e`fctdjeoecdmclcwek`tdedmdrctffekababagalbqcd``", +"````bxaxbqbgaaa`afeafif`atctedfdatazeodhbfcvcxedezfibtboduaedic`bmaxfx``", +"````frfkaxbddielbmfldibadd`gcvcx`e`g`ebcaeamej`rdodxba`ra`ezakakbqbkcd``", +"````cgcaaxavbibcdpffd`dk`q`iaddocvctctbte`dedo`xdtdsafepejbzfibjfscbfy``", +"``````cgfbcaaldndnelafafdkdsdgdect`gdgdobaeuen`udsa`bzbhdibpfofgfxfy````", +"``````fybxbrbzaybgezaae`afbofceheh`sdsadehbofeabdbage`akebb`fofpbrce````", +"````````cfbybvbjbgfibjejagbcfcahdkdbabdsaretdbeldpaaejbgefavfnftch``````", +"``````````cafbftefalb`bgdiaaafafafaramepbcaoagevaialauefbjeyfbcc````````", +"``````````cjfufbeyavavavdneybzejezbzevezbcezegdianb`b`eybvfvfxch````````", +"````````````fzfwfbbkbqbzbuflbiaybqbwakfeakf`feakbubxaxfbfncach``````````", +"``````````````cjcgccftfofqblefblfsbbeyeyavebbseyaxblfbfrfufz````````````", +"``````````````````cicebrbrfhbqaxbrfmbkbkbleycdfvbxfbcdfw````````````````", +"````````````````````cjcefkfnftbybxfvfkbycfbrbyfkcachcj``````````````````", +"````````````````````````fzcecichcfcgcicfchfwfufyfz``````````````````````", +"````````````````````````````````fzfzfzfzcj``````````````````````````````", +"````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade8.xpm b/hacks/images/bubbles/jade8.xpm new file mode 100644 index 00000000..3c737378 --- /dev/null +++ b/hacks/images/bubbles/jade8.xpm @@ -0,0 +1,240 @@ +/* XPM */ +static char *jade8[] = { +/* width height ncolors chars_per_pixel */ +"44 44 189 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #139713", +"`k c #149514", +"`l c #1A8B1A", +"`m c #159315", +"`n c #129312", +"`o c #158B15", +"`p c #128D12", +"`q c #148914", +"`r c #158715", +"`s c #148514", +"`t c #0F890F", +"`u c #128312", +"`v c #0F870F", +"`w c #0E850E", +"`x c #108110", +"`y c #0D830D", +"`z c #0F7F0F", +"a` c #127912", +"aa c #137513", +"ab c #107710", +"ac c #0C7D0C", +"ad c #0E750E", +"ae c #0F730F", +"af c #0F6F0F", +"ag c #0F6D0F", +"ah c #0E6B0E", +"ai c #0E690E", +"aj c #077307", +"ak c #0F650F", +"al c #0E630E", +"am c #0B630B", +"an c #0D5B0D", +"ao c #0A5F0A", +"ap c #036703", +"aq c #0B570B", +"ar c #075D07", +"as c #026502", +"at c #046104", +"au c #0A550A", +"av c #0B530B", +"aw c #016101", +"ax c #0C4F0C", +"ay c #0A510A", +"az c #025B02", +"b` c #094F09", +"ba c #045704", +"bb c #0A4D0A", +"bc c #065306", +"bd c #0A4B0A", +"be c #065106", +"bf c #015901", +"bg c #074D07", +"bh c #054F05", +"bi c #074B07", +"bj c #084908", +"bk c #094709", +"bl c #084508", +"bm c #064706", +"bn c #014F01", +"bo c #004B00", +"bp c #063D06", +"bq c #063B06", +"br c #073907", +"bs c #033D03", +"bt c #004100", +"bu c #013F01", +"bv c #033B03", +"bw c #053505", +"bx c #003D00", +"by c #063306", +"bz c #053105", +"c` c #023502", +"ca c #003700", +"cb c #042B04", +"cc c #042904", +"cd c #012301", +"ce c #022102", +"cf c #011D01", +"cg c #021B02", +"ch c #011901", +"ci c #011701", +"cj c #011501", +"ck c #011301", +"cl c #010D01", +"cm c #21B621", +"cn c #1CB41C", +"co c #22AA22", +"cp c #1AAC1A", +"cq c #18A818", +"cr c #1F9C1F", +"cs c #18A418", +"ct c #17A217", +"cu c #189E18", +"cv c #189A18", +"cw c #149C14", +"cx c #149014", +"cy c #119011", +"cz c #128A12", +"d` c #0F8C0F", +"da c #128612", +"db c #148214", +"dc c #138013", +"dd c #127E12", +"de c #127C12", +"df c #107C10", +"dg c #0F7A0F", +"dh c #0B800B", +"di c #0E780E", +"dj c #0B7C0B", +"dk c #117211", +"dl c #0A7A0A", +"dm c #0E720E", +"dn c #0A780A", +"do c #0A760A", +"dp c #106A10", +"dq c #0B720B", +"dr c #0F6A0F", +"ds c #0A6E0A", +"dt c #0B6C0B", +"du c #0A6A0A", +"dv c #0B680B", +"dw c #067006", +"dx c #0C660C", +"dy c #0A660A", +"dz c #056E05", +"e` c #056C05", +"ea c #0B620B", +"eb c #0C600C", +"ec c #0D5E0D", +"ed c #056A05", +"ee c #066806", +"ef c #076407", +"eg c #0D580D", +"eh c #0A5C0A", +"ei c #076007", +"ej c #046404", +"ek c #0A5A0A", +"el c #075A07", +"em c #085808", +"en c #045E04", +"eo c #095409", +"ep c #015E01", +"eq c #055605", +"er c #055405", +"es c #015601", +"et c #015401", +"eu c #035003", +"ev c #015201", +"ew c #034C03", +"ex c #034A03", +"ey c #B1FFB1", +"ez c #074207", +"f` c #034803", +"fa c #044604", +"fb c #074007", +"fc c #083E08", +"fd c #014601", +"fe c #024402", +"ff c #034203", +"fg c #044004", +"fh c #053805", +"fi c #063606", +"fj c #013A01", +"fk c #023802", +"fl c #052E05", +"fm c #013401", +"fn c #013201", +"fo c #042C04", +"fp c #013001", +"fq c #012E01", +"fr c #012C01", +"fs c #042604", +"ft c #012A01", +"fu c #022802", +"fv c #042404", +"fw c #002600", +"fx c #022002", +"fy c #011E01", +"fz c #001000", +/* pixels */ +"````````````````````````````````````````````br``````````````````````````````````````````", +"````````````````````````````````bzftfkbvavakbsavb`aqbwfbfc``````````````````````````````", +"````````````````````````````bwfgalaldpafafbcecebdkbubic`bpfmfq``````````````````````````", +"````````````````````````fhavaubgbldkerahdbaoauekdeewaof`eadpfffmbw``````````````````````", +"````````````````````fobbfaemdrewdrardfdfduekama`eoelamdydbfdbjaiakbbch``````````````````", +"``````````````````fravakexamam`q`scx`odidiaoffdxenfaevdddyabeqfdembgaqbl````````````````", +"````````````````bpbmekbeabdbdg`z`ods`z`mdqafeeatew`u`zemffba`rfdfdbubxbmft``````````````", +"``````````````fbfkaufe`sdd`q`zdqdn`gcxdo`e`ydtfaedfeejdqczdg`qeuboecf`fjfmby````````````", +"````````````fcecakbha`eaeuesefescz`f`yawdme`d`cpdzcsbf`ydocvdiekdebnfkaibiaybr``````````", +"``````````fybjb`exbtei`odgdacxaoeddodydiapcucs`dd`asep`y`f`mcsdqdc`oabemaaecbzcd````````", +"``````````bqayagbhewdtev`zcs`pdmctcp`fdhaj`eard`cp`wewas`jedaj`pefbeelb`emecanfh````````", +"````````blegdpdxeleq`idd`xeebucscncncyepawewfeeierajcpcn`nbfepcz`pefabdddyekdpavfc``````", +"````````c`egekeheu`udufjdm`z`edj`fcmapdiczapascq`cdjdtawapelbceadjcu`gdgeidcecalbw``````", +"``````fobrffbedd`rdqdyabdscudlasdncpfe`fcq`h`ccn`j`jeicsdy`mdvdz`uejenbob`afemecegfo````", +"``````bqegdpfeafba`ocudvdncpcy`tcnd`dzct`c`jcq`ccndncndnaraj`ke`dzesevdueqdvekdpblfl````", +"````fvfpanaqbpddbobhaecu`fdhctcq`h`m`tdjct`o`rcm`eaj`ycqcpdwaj`nedatbhexefdbddbgakbqch``", +"````fuftegbuembo`s`xdsencvcscncncycsdjdi`l`b`b`b`ldkcq`cd`eiedbf`gbfffahbe`rdkexezbrfi``", +"````cdbkakbuemfddgdgcvemaj`hac`dcmcme``l`b`a`aey`aeccu`d`yedbuea`u`qcababo`raoembzfuce``", +"````fcbdbmbuamfmdm`i`gbfeaarap`t`dfecu`b`aeyeyey`aco`dcmcy`eeddw`pencxfmdxafdxexfac`fc``", +"````bravalbifkbmei`xcvdqatdwcpawcndwcx`b`aeyeyey`bdpdodo`das`j`w`pdsbuazel`rfdbeakfpfl``", +"````fcblbwehbe`rarbadu`mdncsbtdncqedcpco`b`a`a`acrcodnctajcsacdjcu`xdidqdsa`dkbealbjbr``", +"``cgflfkb`bgamfdbndxazef`eeedzcsctdldh`ccocr`b`b`lef`hcyac`h`gfecscvendddgddehffanegbzfz", +"````bzbqfmaqbtam`sarahds`uazcuct`nbudhcqcmcr`cdi`demd``fcwcs`p`p`edi`xdqdmdbeheobqegfy``", +"````flfpblffaoeldd`o`xadabes`kcu`tepcq`fcnapdm`pajedej`f`d`fctdobfdddy`rababemecfgc`cc``", +"````fuftegfgaiela``s`ibacxevaz`w`ndfctcndwaje`cpctdl`zbx`ycu`xdsdxebdm`raoahagdpbdaxfl``", +"````fxbkayfmebaidbdeeuaret`iefcu`m`oazedawdzepd`cybfajczbfdseeaz`sdberafdca`aqakblfufx``", +"````ccfwezfbbmaaamahfpehfmbc`sdg`eeebxazdw`gazajdwfeaz`vdncaehbseo`sdvdedkaialbsaxfvfx``", +"````fzccblbjayaubcf`alfkeoeles`g`gcs`e`pcu`wcuf`el`idfaoabdydgbabo`o`sfeewakcdfpfrcfcj``", +"``````flfwbjbdffaffedbauffdydy`o`gdqefef`icu`xdccxfa`xeeef`gdy`ua`aobiakbjbgecfpbybz````", +"``````cecdbdbybvebbgbmewew`rddadcx`o`u`icvcvdicvahatdyei`oefbob`eualdkewdpblblfibyce````", +"````````cefcfxc`fjekftekdedddcdyetafefdfda`gdq`qdgeiafbe`r`seuafbcekaibgfmfnaxfuby``````", +"````````fvbzezc`fmaybgbuamafddaofdbobaaddmdcdsdydteiboeoabdcagbcaaemdpaqfkfyfpbycj``````", +"``````````chfibdfiavegfjfwbudeabbhfdei`sdy`rabdtameiardbaofkbeamecbgecanfqfwcdch````````", +"``````````clflfcfpbqanecauaudkdka`a`a`dxagdxaheqeabhdxagbtdkdralauakfgaxfhbrfxcj````````", +"````````````cjfxbrfrbkanalfgbkbbbibudrf`exfpemdxemehbhemexalecalbibjbkfqfucech``````````", +"``````````````fzcffobzaxbdanauffblezdkfafec`ftfeekb`alfralaqanblayavbrcbflfx````````````", +"````````````````cjflccfcfcc`c`fgfmbjavavbsaub`fqdpb`bwegecfmccbqezbzbzflci``````````````", +"``````````````````chcjcccdbkfcfhfregbkaxc`bjbsfkavfgc`c`bpbkbdbdfccffvfz````````````````", +"````````````````````clcjbzbzfifcbrezbkfnbzbpaxbkbkfbfhbzfcftfiflcffxcl``````````````````", +"````````````````````````clfsflfoficbbzflbqftbqftchfublfofuflcgcgcj``````````````````````", +"````````````````````````````cjckchckcefvfsfufsfychciflflcgckfz``````````````````````````", +"````````````````````````````````clclfzcjchcgcicgfxfvcgcjcl``````````````````````````````", +"````````````````````````````````````````````cl``````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/bubbles/jade9.xpm b/hacks/images/bubbles/jade9.xpm new file mode 100644 index 00000000..85f5ca98 --- /dev/null +++ b/hacks/images/bubbles/jade9.xpm @@ -0,0 +1,248 @@ +/* XPM */ +static char *jade9[] = { +/* width height ncolors chars_per_pixel */ +"50 50 191 2", +/* colors */ +"`` c None", +"`a c #69E169", +"`b c #35CB35", +"`c c #23BD23", +"`d c #1CB11C", +"`e c #1AA71A", +"`f c #169D16", +"`g c #179717", +"`h c #149914", +"`i c #179317", +"`j c #139713", +"`k c #149514", +"`l c #1A8B1A", +"`m c #159315", +"`n c #129312", +"`o c #158B15", +"`p c #128D12", +"`q c #148914", +"`r c #158715", +"`s c #148514", +"`t c #0F890F", +"`u c #128312", +"`v c #0F870F", +"`w c #0E850E", +"`x c #108110", +"`y c #0D830D", +"`z c #0F7F0F", +"a` c #127912", +"aa c #137513", +"ab c #107710", +"ac c #0C7D0C", +"ad c #0E750E", +"ae c #0F730F", +"af c #0F6F0F", +"ag c #0F6D0F", +"ah c #0E6B0E", +"ai c #0E690E", +"aj c #077307", +"ak c #0F650F", +"al c #0E630E", +"am c #0B630B", +"an c #0D5B0D", +"ao c #0A5F0A", +"ap c #036703", +"aq c #0B570B", +"ar c #075D07", +"as c #026502", +"at c #046104", +"au c #0A550A", +"av c #0B530B", +"aw c #016101", +"ax c #0C4F0C", +"ay c #0A510A", +"az c #025B02", +"b` c #094F09", +"ba c #045704", +"bb c #0A4D0A", +"bc c #065306", +"bd c #0A4B0A", +"be c #065106", +"bf c #015901", +"bg c #074D07", +"bh c #054F05", +"bi c #074B07", +"bj c #084908", +"bk c #094709", +"bl c #084508", +"bm c #064706", +"bn c #014F01", +"bo c #004B00", +"bp c #063D06", +"bq c #063B06", +"br c #073907", +"bs c #033D03", +"bt c #004100", +"bu c #013F01", +"bv c #033B03", +"bw c #053505", +"bx c #003D00", +"by c #063306", +"bz c #053105", +"c` c #023502", +"ca c #003700", +"cb c #042B04", +"cc c #042904", +"cd c #012301", +"ce c #022102", +"cf c #011D01", +"cg c #021B02", +"ch c #011901", +"ci c #011701", +"cj c #011501", +"ck c #011301", +"cl c #010D01", +"cm c #21B621", +"cn c #1CB41C", +"co c #22AA22", +"cp c #1AAC1A", +"cq c #18A818", +"cr c #1F9C1F", +"cs c #18A418", +"ct c #17A217", +"cu c #189E18", +"cv c #189A18", +"cw c #149C14", +"cx c #149014", +"cy c #119011", +"cz c #128A12", +"d` c #0F8C0F", +"da c #128612", +"db c #148214", +"dc c #138013", +"dd c #127E12", +"de c #127C12", +"df c #107C10", +"dg c #0F7A0F", +"dh c #0B800B", +"di c #0E780E", +"dj c #0B7C0B", +"dk c #117211", +"dl c #0A7A0A", +"dm c #0E720E", +"dn c #0A780A", +"do c #0A760A", +"dp c #106A10", +"dq c #0B720B", +"dr c #0F6A0F", +"ds c #0A700A", +"dt c #0A6E0A", +"du c #0B6C0B", +"dv c #0A6A0A", +"dw c #0B680B", +"dx c #067006", +"dy c #0C660C", +"dz c #0A660A", +"e` c #056E05", +"ea c #056C05", +"eb c #0B620B", +"ec c #0C600C", +"ed c #0D5E0D", +"ee c #056A05", +"ef c #066806", +"eg c #076407", +"eh c #0D580D", +"ei c #0A5C0A", +"ej c #076007", +"ek c #046404", +"el c #0A5A0A", +"em c #075A07", +"en c #085808", +"eo c #045E04", +"ep c #095409", +"eq c #015E01", +"er c #055605", +"es c #055405", +"et c #015601", +"eu c #015401", +"ev c #035003", +"ew c #015201", +"ex c #034C03", +"ey c #034A03", +"ez c #B1FFB1", +"f` c #074207", +"fa c #034803", +"fb c #044604", +"fc c #074007", +"fd c #083E08", +"fe c #014601", +"ff c #024402", +"fg c #034203", +"fh c #044004", +"fi c #053805", +"fj c #063606", +"fk c #013A01", +"fl c #023802", +"fm c #052E05", +"fn c #013401", +"fo c #013201", +"fp c #042C04", +"fq c #013001", +"fr c #012E01", +"fs c #012C01", +"ft c #042604", +"fu c #012A01", +"fv c #022802", +"fw c #042404", +"fx c #002600", +"fy c #022002", +"fz c #011E01", +"g` c #001000", +"ga c #000A00", +/* pixels */ +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"``````````````````````````````````````fvcdfsbwbsehehfqbdblbkbqfm````````````````````````````````````", +"````````````````````````````````fvfvc`ayakalepauaabcakdkfgb`aufnbjbkfp``````````````````````````````", +"````````````````````````````cdehbmaqanelbeexfeexdragfraobedebcfobbayedbqbl``````````````````````````", +"````````````````````````fmbdedbiecelbmfeah`rafdc`o`sfba`ecemaffeenbufkbiedfdfj``````````````````````", +"``````````````````````fpehfhaqenebema`ejdm`i`gdvfhbadcfhba`oevdmdwahaoaodkakblcd````````````````````", +"````````````````````fsbbbmeyelemaodb`i`i`u`icudqbeaha`ateu`g`rahbnabdzflenbudpbjbz``````````````````", +"``````````````````fdfobidkfeab`rad`xdf`zdt`mcxekbheadsbxetatdvfaamewbodbfea`fgbpbvfr````````````````", +"````````````````brfndpakbcdz`r`q`odids`ecuczcycueeenbfeeeq`eefac`xdiaebabiesfabxbkbdcf``````````````", +"``````````````fdbdedebfea`ahab`saeel`v`ecucxffcpdj`h`fdobxaododtaccxdqeoewdbexc`drbsbkfj````````````", +"````````````ftehfnanfla`bseg`u`x`peme``yeacpdzeeerdv`f`fcu`x`t`t`p`pcsatfkewbgexagdkcacdfw``````````", +"``````````cjfifhagaiexdz`ibn`zcv`mdadn`yd``vapeqemdq`t`nap`odqcycsdjcxcuazbgejbobmdkecfnfuce````````", +"``````````brbbdpaffeec`rdueo`iczeke``dcpcnapff`gdfasdjdjcs`wdndh`weqdx`g`patecevemameialbvbq````````", +"````````chbqb`akaoeserdfeg`xdtbedxcpcncqcqdzasapdqaseedncme`cnctdjeq`ods`zdgaddvdf`saiepalbbcd``````", +"````````brfmb`enbefe`qbaetbeef`t`ee`d``jdhem`mczdjdhcn`c`fdxasas`madbceq`uda`i`uejfea`dkakehbr``````", +"``````cefpedbmelaiabdcegetfa`vcpajeqee`cdlaj`dcqcs`ccncq`jasev`zex`uemdxat`idteoaifnaheiedavblfw````", +"``````bzfvalakfaafev`ucv`zfa`pcp`t`ycmctev`ncq`ccwcp`c`cd`btawas`gdxcyekdnddeo`uejbadwaiaiayf`ch````", +"``````fpanakffakfebn`gca`z`w`taccncn`jdje`d``y`dda`qcmcm`jej`j`hfaajdl`kdxdgdmcafbdzdddebcakehby````", +"````chblavakbifebiegdidtbhcxcp`fcpcmcycndh`jdqcrco`b`ba`die``cct`ydze`dxbfdddybudmbo`ra`aibmf`fuce``", +"````cjfuaybmffeieladdgcuduaj`pct`fcmcpemaj`z`l`b`a`a`acoa`cmcmcpd`e``icp`eazbcefamah`rafdycafifscd``", +"````byfdbvfbavfaep`o`ucvekffcvajajcq`fcyas`e`b`aezezez`a`b`ictcmd`eqeqekdoekenendybnabdyenbxfobdcc``", +"````cdfqbjedbudyfhdz`ucx`zdodudwcp`ycmdw`kcm`b`aezezez`acr`i`dcndxasacdxcsdn`ofbbmemdfexfaakfhbdbr``", +"````fmbpbsbmfffqfhemdt`i`pac`zdn`e`dcwebcyco`b`aezezez`a`lcodufaardocy`hcxczeoeuegej`oesfaakavblfp``", +"````cbbqbkakepfeboarbneo`x`w`p`naddo`jcpcy`c`c`b`a`a`acrcrcz`ncnaj`u`v`w`pcx`x`gdzdmaedebgecaybyby``", +"````fdfqaldpbiaoboev`idfeoeobfatdx`f`f`wdm`d`c`lcr`bcocrdp`pcq`ycy`kbffbfgcxdiba`o`sdcafdrbmavf`fd``", +"````fmbzbdfhalffdudcejboazcvduekcucpcteq`d`e`e`icr`bdgaacpdjcq`h`kct`p`zdcefcvaddudwdbececanfhfqby``", +"````fzfdbjfgepeybe`r`oeg`uegamekcpcp`kdz`kcncp`hekel`wdx`iap`v`d`e`ncu`vbcaf`i`idcabdeenecayc`bkfm``", +"````fmfsaxb`ehaibh`rdm`i`zbnenbudt`wctdnd`cpcqdhctcu`jcy`tasexdn`ecv`m`zeienfn`o`oaoa`dkededaxfuby``", +"````fmfxavf`edelebaedbddaretbcetazefcvekeqdhee`easdo`dcp`wda`vateqczegdqejbnamdmdda`ahdkdpaqbpcdfy``", +"````fwfxbkfnfieddkabdebna`ewendf`icucubffaefdu`odabhea`pbcdf`y`metetdvewamfl`oaraea`a`fbanavbdfpcg``", +"````g`fzfrf`bzfgakelemelb`bsbvdceucz`g`zdtdodj`peqatateeazarazacdsetazddamboam`rardedpfkavfqbdcdck``", +"``````fwbzavbdbkelenbcfsbvfhbodzeo`g`gcz`i`z`gcsczetbxadcxeb`rab`gdt`qejbaaedcaffabtalfkbdaxfdfy````", +"``````ftcdfqfvb`fgafexagfefhdkdudv`ocvdgejdv`zcucu`wcuffeteg`xewdt`ieg`qdcdweybtbvalbiedbjcccgfy````", +"``````cjcfchc`c`fkecbibtbtesevexdcdg`i`oda`u`gcu`gdgewey`idtdqegcxeg`s`obofsbtaafgfkfcanfufdftcj````", +"````````cgfyf`cdbvfkalaaexabdbafdbdmdzewdfdmda`o`idt`xduejbaaeai`qddbnfebtbhebafcafrbqfqfjfjcc``````", +"````````cjchfubwflfkaubgakebdedy`sduevb`erdvdzdtdfdzdidfejevdkbodf`rendkendkalalayfnc`fxbrbyci``````", +"``````````fwccbqfibpalakbjc`bxaiabambhfneradabdm`odfdzdvdmarardcaba`alaienauauakalfqcdbwfyfw````````", +"``````````gafwfzblfqbjavaqfhdkbxafaoenbeaiaeabam`r`rabaoeyenafabaaexafdkdkelededehbzbwcccega````````", +"````````````cjfwfmfdblbdalanbibuafakafeca`ebdyarexebexdkenbcaheibcaadrelauakbjavbdfdccfwcj``````````", +"``````````````g`fzbzfdfiavbbaqfhedfuf`fkfbelffbtanbcenexeibeauffafecelalb`avbkbqchcdfwcg````````````", +"````````````````g`fybzfjbdbkblehayfbbdalbgaqfgbuanblfbepauedakfgauaqehbsbpaxbwfmcbfmcg``````````````", +"``````````````````cjccfzfdfcbqflbvfhcafhedb`aybib`bibpanedbsakalalfnfjfoaxf`fvcccccj````````````````", +"````````````````````cjcgfmcecdfufufnbqbpanbmbqf`ehbmehedbdfvbbblblaxaxbkblcdfmfwg```````````````````", +"``````````````````````cjclfwftbrbzbkfiaxfifqbdbkfqf`ehavavbpc`fzfrfxfjfdfycfceck````````````````````", +"````````````````````````gacgfycbccbrbrfxfxbzbdbdbdfdfdcffzfqfmbzfdbrbyfwchcgcl``````````````````````", +"````````````````````````````gag`fyfwcececcfpbybzcbfucbcbcfcdbyfmfmcicjcgga``````````````````````````", +"````````````````````````````````gackcgcifychchcccfchcjckcgchccfycjg`ga``````````````````````````````", +"``````````````````````````````````````gagagackcjchfycjchcgg`clga````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````", +"````````````````````````````````````````````````````````````````````````````````````````````````````" +}; diff --git a/hacks/images/noseguy/nose-f1.xbm b/hacks/images/noseguy/nose-f1.xbm new file mode 100644 index 00000000..543af3e4 --- /dev/null +++ b/hacks/images/noseguy/nose-f1.xbm @@ -0,0 +1,38 @@ +#define nose_f1_width 64 +#define nose_f1_height 64 +static unsigned char nose_f1_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, + 0x08,0x00,0xc0,0x1f,0x00,0x20,0x00,0x00,0x08,0x00,0x30,0x60,0x00,0x20,0x00, + 0x00,0xf8,0xff,0x0f,0x80,0xff,0x3f,0x00,0x00,0x00,0x02,0x02,0x00,0x82,0x00, + 0x00,0x00,0x00,0x03,0x01,0x00,0x84,0x01,0x00,0x00,0x00,0x81,0x00,0x00,0x08, + 0x01,0x00,0x00,0x80,0x80,0x00,0x00,0x08,0x02,0x00,0x00,0x80,0x40,0x00,0x00, + 0x10,0x02,0x00,0x00,0x40,0x40,0x00,0x00,0x10,0x04,0x00,0x00,0x40,0x20,0x00, + 0x00,0x20,0x04,0x00,0x00,0x60,0x20,0x00,0x00,0x20,0x0c,0x00,0x00,0x20,0x20, + 0x00,0x00,0x20,0x08,0x00,0x00,0x20,0x20,0x00,0x00,0x20,0x08,0x00,0x00,0x10, + 0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00, + 0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00, + 0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10, + 0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,0x00,0x00,0x30,0x00,0x01,0x00,0x04, + 0x18,0x00,0x00,0x20,0x00,0x02,0x00,0x02,0x08,0x00,0x00,0x20,0x00,0x0c,0x80, + 0x01,0x08,0x00,0x00,0x60,0x00,0x30,0x60,0x00,0x0c,0x00,0x00,0x40,0x00,0xc0, + 0x1f,0x00,0x04,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0xc0,0x0f,0x00,0x00,0x00, + 0x00,0x40,0x10,0x20,0x10,0x00,0x00,0x00,0x00,0x20,0x60,0x30,0x20,0x00,0x00, + 0x00,0x00,0x20,0xc0,0x18,0x20,0x00,0x00,0xc0,0x7f,0x10,0x80,0x0d,0x40,0xe0, + 0x01,0x70,0xc0,0x18,0x00,0x05,0x40,0x1c,0x06,0x10,0x00,0x0f,0x00,0x05,0x80, + 0x07,0x08,0x08,0x00,0x06,0x00,0x05,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x05, + 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80, + 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00, + 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00, + 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84, + 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08, + 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-f1.xpm b/hacks/images/noseguy/nose-f1.xpm new file mode 100644 index 00000000..a6e03bfb --- /dev/null +++ b/hacks/images/noseguy/nose-f1.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_f1_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXX. ", +" .................ooooooooooo............... ", +" .OOOOOOO.ooooooooooooooo.OOOOO. ", +" ..OOOOOO.ooooooooooooooooo.OOOO.. ", +" .OOOOOO.ooooooooooooooooooo.OOOO. ", +" .OOOOOOO.ooooooooooooooooooo.OOOOO. ", +" .OOOOOO.ooooooooooooooooooooo.OOOO. ", +" .OOOOOOO.ooooooooooooooooooooo.OOOOO. ", +" .OOOOOO.ooooooooooooooooooooooo.OOOO. ", +" ..OOOOOO.ooooooooooooooooooooooo.OOOO.. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ", +" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ", +" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ", +" ..OOOOOOOOOO.ooooooooooooooooo.OOOOOOOO.. ", +" .OOOOOOOOOOO.ooooooooooooooo.OOOOOOOOO. ", +" .OOOOOOOOOOOO..ooooooooooo..OOOOOOOOOO. ", +" ..OOOOOOOOOOOOO..ooooooo..OOOOOOOOOOO.. ", +" .OOOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" ................................ ", +" ", +" ..... ...... ", +" .+++++. .++++++. ", +" .+++++++.. ..+++++++. ", +" .++++++++.. ..++++++++. ", +" ......... .++++++++++.. ..++++++++++. .... ", +" ...+++++++.. ..+++++++++++. .+++++++++++. ...++++.. ", +" .+++++++++++....@+++++++++++. .+++++++++++@....++++++++. ", +" .+++++++++++++..@@+++++++++++. .++++++++++@@..++++++++++. ", +" .+++++++++++++++..@++++++++++. .+++++++++@@..++++++++++++. ", +" .+++++++++++++++++..@+++++++++. .++++++++@..++++++++++++++. ", +" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ", +" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ", +" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ", +" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ", +" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.@++. ", +" .+@@.+++++++++++++++++++++++. .+++++++++++++++++++.@@+. ", +" .++@@..+++++++++++++++++++++.. ..+++++++++++++++++..@@++. ", +" .++@@++++++++++++++++++++++@. .@++++++++++++++++++@@++. ", +" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ", +" ........................... ....................... ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-f2.xbm b/hacks/images/noseguy/nose-f2.xbm new file mode 100644 index 00000000..6851b201 --- /dev/null +++ b/hacks/images/noseguy/nose-f2.xbm @@ -0,0 +1,38 @@ +#define nose_f2_width 64 +#define nose_f2_height 64 +static unsigned char nose_f2_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, + 0x08,0x00,0xe0,0x0f,0x00,0x20,0x00,0x00,0x08,0x00,0x18,0x30,0x00,0x20,0x00, + 0x00,0xf8,0xff,0x07,0xc0,0xff,0x3f,0x00,0x00,0x00,0x02,0x01,0x00,0x81,0x00, + 0x00,0x00,0x00,0x83,0x00,0x00,0x82,0x01,0x00,0x00,0x00,0x41,0x00,0x00,0x04, + 0x01,0x00,0x00,0x80,0x40,0x00,0x00,0x04,0x02,0x00,0x00,0x80,0x20,0x00,0x00, + 0x08,0x02,0x00,0x00,0x40,0x20,0x00,0x00,0x08,0x04,0x00,0x00,0x40,0x10,0x00, + 0x00,0x10,0x04,0x00,0x00,0x60,0x10,0x00,0x00,0x10,0x0c,0x00,0x00,0x20,0x10, + 0x00,0x00,0x10,0x08,0x00,0x00,0x30,0x10,0x00,0x00,0x10,0x08,0x00,0x00,0x10, + 0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00, + 0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00, + 0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x04,0x10, + 0x00,0x00,0x30,0x40,0x00,0x00,0x04,0x10,0x00,0x00,0x20,0x80,0x00,0x00,0x02, + 0x18,0x00,0x00,0x20,0x00,0x01,0x00,0x01,0x08,0x00,0x00,0x60,0x00,0x06,0xc0, + 0x00,0x08,0x00,0x00,0x80,0x00,0x18,0x30,0x00,0x0c,0x00,0x00,0x80,0x00,0xe0, + 0x0f,0x00,0x04,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00, + 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xe0,0x00,0x07,0x02,0x10,0x00,0x00, + 0x00,0x30,0x00,0x8c,0x01,0x20,0x00,0x00,0x00,0x0c,0x00,0x90,0x00,0x20,0x00, + 0x00,0x00,0x04,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20, + 0x00,0x00,0x00,0x42,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x02, + 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x06,0x20,0x00,0x00,0x00,0x21,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x03,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00, + 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-f2.xpm b/hacks/images/noseguy/nose-f2.xpm new file mode 100644 index 00000000..3763b58d --- /dev/null +++ b/hacks/images/noseguy/nose-f2.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_f2_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ", +" ................ooooooooooo................ ", +" .OOOOOO.ooooooooooooooo.OOOOOO. ", +" ..OOOOO.ooooooooooooooooo.OOOOO.. ", +" .OOOOO.ooooooooooooooooooo.OOOOO. ", +" .OOOOOO.ooooooooooooooooooo.OOOOOO. ", +" .OOOOO.ooooooooooooooooooooo.OOOOO. ", +" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ", +" .OOOOO.ooooooooooooooooooooooo.OOOOO. ", +" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ", +" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ", +" ..OOOOOO.ooooooooooooooooooooooo.OOOOOO. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", +" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ", +" ..OOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ", +" .OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO.. ", +" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ", +" ..OOOOOOOOOO..ooooooooooo..OOOOOOOOOOO. ", +" .OOOOOOOOOOO..ooooooo..OOOOOOOOOOOO.. ", +" .OOOOOOOOOOOOO.......OOOOOOOOOOOOOO. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" ................................ ", +" ", +" ......... ", +" ........ .+++++++++. ", +" ...++++++++... .++++++++++. ", +" ..++++++++++++.. ..++++++++++++. ", +" ..++++++++++++++++. .@++++++++++++. ", +" .++++@..+++++++++++..@@++++++++++++. ", +" .++++..++++++++++++++..@++++++++++++. ", +" .+++@.+++++++++++++++++.@+++++++++++. ", +" .+++@.+++++++++++++++++++.@++++++++++. ", +" .+++@.+++++++++++++++++++..++++++++++. ", +" .+++@.+++++++++++++++++++++++++++++++. ", +" .++++++++++++++++++++++++++++++++++++@. ", +" ..@++++++++++++++++++++++++++++++++++@. ", +" .@@+++++++++++++++++++++++++++++++++@. ", +" .@@++++++++++++++++++++++++++++++++@@. ", +" .@@@++++++++++++++++++++++++++++++@. ", +" ..@@@++++++++++++++++++++@@@++++@@. ", +" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ", +" .............................. ", +" ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-f3.xbm b/hacks/images/noseguy/nose-f3.xbm new file mode 100644 index 00000000..e70f2293 --- /dev/null +++ b/hacks/images/noseguy/nose-f3.xbm @@ -0,0 +1,38 @@ +#define nose_f3_width 64 +#define nose_f3_height 64 +static unsigned char nose_f3_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, + 0x04,0x00,0xf0,0x07,0x00,0x10,0x00,0x00,0x04,0x00,0x0c,0x18,0x00,0x10,0x00, + 0x00,0xfc,0xff,0x03,0xe0,0xff,0x1f,0x00,0x00,0x00,0x81,0x00,0x80,0x40,0x00, + 0x00,0x00,0x80,0x41,0x00,0x00,0xc1,0x00,0x00,0x00,0x80,0x20,0x00,0x00,0x82, + 0x00,0x00,0x00,0x40,0x20,0x00,0x00,0x02,0x01,0x00,0x00,0x40,0x10,0x00,0x00, + 0x04,0x01,0x00,0x00,0x20,0x10,0x00,0x00,0x04,0x02,0x00,0x00,0x20,0x08,0x00, + 0x00,0x08,0x02,0x00,0x00,0x30,0x08,0x00,0x00,0x08,0x06,0x00,0x00,0x10,0x08, + 0x00,0x00,0x08,0x04,0x00,0x00,0x10,0x08,0x00,0x00,0x08,0x0c,0x00,0x00,0x08, + 0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00, + 0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00, + 0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x08, + 0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x0c,0x00,0x00,0x18,0x40,0x00,0x00,0x01, + 0x04,0x00,0x00,0x10,0x80,0x00,0x80,0x00,0x04,0x00,0x00,0x10,0x00,0x03,0x60, + 0x00,0x06,0x00,0x00,0x30,0x00,0x0c,0x18,0x00,0x01,0x00,0x00,0x20,0x00,0xf0, + 0x07,0x00,0x01,0x00,0x00,0x60,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x40,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0x40,0xe0,0x00,0x07,0x00, + 0x00,0x00,0x04,0x80,0x31,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x09,0x00,0x30, + 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x20,0x00,0x00,0x00,0x04,0x00,0x03,0x00, + 0x43,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x42,0x00,0x00,0x00,0x04,0x40,0x00, + 0x00,0x84,0x00,0x00,0x00,0x04,0x60,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00, + 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0xc0,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00, + 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-f3.xpm b/hacks/images/noseguy/nose-f3.xpm new file mode 100644 index 00000000..c60c5f37 --- /dev/null +++ b/hacks/images/noseguy/nose-f3.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_f3_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ", +" ................ooooooooooo................ ", +" .OOOOOO.ooooooooooooooo.OOOOOO. ", +" ..OOOOO.ooooooooooooooooo.OOOOO.. ", +" .OOOOO.ooooooooooooooooooo.OOOOO. ", +" .OOOOOO.ooooooooooooooooooo.OOOOOO. ", +" .OOOOO.ooooooooooooooooooooo.OOOOO. ", +" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ", +" .OOOOO.ooooooooooooooooooooooo.OOOOO. ", +" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ", +" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ", +" .OOOOOO.ooooooooooooooooooooooo.OOOOOO.. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", +" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", +" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ", +" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOO.. ", +" ..OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO. ", +" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ", +" .OOOOOOOOOOO..ooooooooooo..OOOOOOOOOO.. ", +" ..OOOOOOOOOOOO..ooooooo..OOOOOOOOOOO. ", +" .OOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" ................................ ", +" ", +" ......... ", +" .+++++++++. ........ ", +" .++++++++++. ...++++++++... ", +" .++++++++++++.. ..++++++++++++.. ", +" .++++++++++++@. .++++++++++++++++.. ", +" .++++++++++++@@..+++++++++++..@++++. ", +" .++++++++++++@..++++++++++++++..++++. ", +" .+++++++++++@.+++++++++++++++++.@+++. ", +" .++++++++++@.+++++++++++++++++++.@+++. ", +" .++++++++++..+++++++++++++++++++.@+++. ", +" .+++++++++++++++++++++++++++++++.@+++. ", +" .@++++++++++++++++++++++++++++++++++++. ", +" .@++++++++++++++++++++++++++++++++++@.. ", +" .@+++++++++++++++++++++++++++++++++@@. ", +" .@@++++++++++++++++++++++++++++++++@@. ", +" .@++++++++++++++++++++++++++++++@@@. ", +" .@@++++@@@++++++++++++++++++++@@@.. ", +" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ", +" .............................. ", +" ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-f4.xbm b/hacks/images/noseguy/nose-f4.xbm new file mode 100644 index 00000000..024eead8 --- /dev/null +++ b/hacks/images/noseguy/nose-f4.xbm @@ -0,0 +1,38 @@ +#define nose_f4_width 64 +#define nose_f4_height 64 +static unsigned char nose_f4_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x1e,0x00, + 0x00,0x00,0x00,0x38,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00, + 0x03,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x04,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x08,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x10,0x00,0x80, + 0x1f,0x00,0x40,0x00,0x00,0x08,0x00,0x60,0x60,0x00,0x80,0x00,0x00,0x08,0x00, + 0x10,0x80,0x00,0x80,0x00,0x00,0x04,0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x04, + 0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x02,0x00,0x18,0x80,0x01,0x00,0x02,0x00, + 0x02,0x00,0x68,0x60,0x01,0x00,0x02,0x00,0x02,0x00,0x88,0x1f,0x01,0x00,0x02, + 0x00,0x02,0x00,0x08,0x00,0x01,0x00,0x02,0x00,0x02,0x00,0x10,0x80,0x00,0x00, + 0x03,0x00,0x06,0x00,0x60,0x60,0x00,0x80,0x02,0x00,0x0c,0x00,0x80,0x1f,0x00, + 0x40,0x01,0x00,0x14,0x00,0x00,0x00,0x00,0x20,0x01,0x00,0x28,0x00,0x00,0x00, + 0x00,0x90,0x00,0x00,0x50,0x00,0x00,0x00,0x00,0x48,0x00,0x00,0xa0,0x01,0x00, + 0x00,0x00,0x26,0x00,0x00,0x40,0x1e,0x00,0x00,0xc0,0x11,0x00,0x00,0x80,0xe1, + 0x03,0x00,0x3c,0x0c,0x00,0x00,0x00,0x0e,0xfc,0xff,0x83,0x03,0x00,0x00,0x00, + 0xf0,0x01,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00, + 0x00,0x80,0x03,0x00,0x0c,0x00,0x00,0x00,0x00,0x80,0x02,0x00,0x14,0x00,0x00, + 0x00,0x00,0x60,0x04,0x00,0x12,0x00,0x00,0xc0,0x7f,0x10,0x04,0x00,0x22,0xe0, + 0x01,0x70,0xc0,0x18,0x08,0x00,0x61,0x1c,0x06,0x10,0x00,0x0f,0x30,0xc0,0x80, + 0x07,0x08,0x08,0x00,0x06,0xc0,0x3f,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x02, + 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80, + 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00, + 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00, + 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84, + 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08, + 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-f4.xpm b/hacks/images/noseguy/nose-f4.xpm new file mode 100644 index 00000000..faa52e03 --- /dev/null +++ b/hacks/images/noseguy/nose-f4.xpm @@ -0,0 +1,73 @@ +/* XPM */ +static char * nose_f4_xpm[] = { +"64 64 6 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ", +" ............... ", +" ....XXXXXXXXXXXXXXX.... ", +" ...XXXXXXXXXXXXXXXXXXXXXXX... ", +" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ", +" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ", +" .XXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXX..XXXXXXXXXX..XXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXX.X..XXXXXX..X.XXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXX.XXX......XXX.XXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXXX.. ", +" ..XXXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. . ", +" ..XXXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX.X. ", +" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ", +" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ", +" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ", +" .X..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..XX. ", +" .XX....XXXXXXXXXXXXXXXXXXXXXXXXX...XXX. ", +" ..XXXX.....XXXXXXXXXXXXXXXX....XXXX.. ", +" ...XXXXXX................XXXXX... ", +" .....XXXXXXXXXXXXXXXXXX.... ", +" ................... ", +" ...oooooooooooooooo.. ", +" .+.oooooooooooooooo.+. ", +" ..+++.oooooooooooooo.++. ", +" ......... .+++++.oooooooooooooo.+++. .... ", +" ...+++++++.. ..++++++.oooooooooooo.++++.. ...++++.. ", +" .+++++++++++....@+++++++..oooooooo..++++++@....++++++++. ", +" .+++++++++++++..@@+++++++++........+++++++@@..++++++++++. ", +" .+++++++++++++++..@+++++++++++.++++++++++@@..++++++++++++. ", +" .+++++++++++++++++..++++++++++. .+++++++++..++++++++++++++. ", +" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ", +" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ", +" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ", +" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ", +" .++.++++++++++++++++++++++++. .++++++++++++++++++++.@+@. ", +" .@+@.+++++++++++++++++++++++. .+++++++++++++++++++.@+@. ", +" .@@+@..++++++++++++++++++++@.. ..@++++++++++++++++..@++@. ", +" .@@+++++++++++++++++++++++@@. .@@+++++++++++++++++++@@. ", +" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ", +" ........................... ....................... ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-l1.xbm b/hacks/images/noseguy/nose-l1.xbm new file mode 100644 index 00000000..e3cb7030 --- /dev/null +++ b/hacks/images/noseguy/nose-l1.xbm @@ -0,0 +1,38 @@ +#define nose_l1_width 64 +#define nose_l1_height 64 +static unsigned char nose_l1_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00, + 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00, + 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00, + 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00, + 0x18,0x00,0x20,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x40,0x00,0x80,0x00,0x00, + 0x00,0x08,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x00,0x01,0x20,0x00, + 0x00,0x00,0x04,0x00,0x00,0x06,0x18,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x07, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00, + 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xc0,0x00,0x03,0x03,0x10,0x00,0x00, + 0x00,0x30,0x00,0x0c,0x01,0x20,0x00,0x00,0x00,0x08,0x00,0x98,0x00,0x20,0x00, + 0x00,0x00,0x0c,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20, + 0x00,0x00,0x00,0x42,0x00,0x80,0x00,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01, + 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x01,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00, + 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-l1.xpm b/hacks/images/noseguy/nose-l1.xpm new file mode 100644 index 00000000..205d18be --- /dev/null +++ b/hacks/images/noseguy/nose-l1.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_l1_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .............................. ", +" ", +" ......... ", +" ........ .+++++++++. ", +" ...++++++++... .++++++++++. ", +" ..++++++++++++.. ..++++++++++++. ", +" ..++++++++++++++++. .@++++++++++++. ", +" .++++@..+++++++++++..@@++++++++++++. ", +" .++++..++++++++++++++..@++++++++++++. ", +" .+++@.+++++++++++++++++.@+++++++++++. ", +" .+++@.+++++++++++++++++++.@++++++++++. ", +" .+++@.+++++++++++++++++++..++++++++++. ", +" .+++@.+++++++++++++++++++++++++++++++. ", +" .++++++++++++++++++++++++++++++++++++@. ", +" ..@++++++++++++++++++++++++++++++++++@. ", +" .@@+++++++++++++++++++++++++++++++++@. ", +" .@@++++++++++++++++++++++++++++++++@@. ", +" .@@@++++++++++++++++++++++++++++++@. ", +" ..@@@++++++++++++++++++++@@@++++@@. ", +" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ", +" .............................. ", +" ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-l2.xbm b/hacks/images/noseguy/nose-l2.xbm new file mode 100644 index 00000000..fa39343b --- /dev/null +++ b/hacks/images/noseguy/nose-l2.xbm @@ -0,0 +1,38 @@ +#define nose_l2_width 64 +#define nose_l2_height 64 +static unsigned char nose_l2_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00, + 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00, + 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00, + 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00, + 0x18,0x00,0x10,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x20,0x00,0x80,0x00,0x00, + 0x00,0x08,0x00,0x40,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x80,0x00,0x20,0x00, + 0x00,0x00,0xe4,0x00,0x00,0x03,0x18,0x00,0x00,0x00,0x26,0x03,0x00,0xfc,0x07, + 0x00,0x00,0x00,0x12,0x0c,0x00,0x00,0xf8,0xff,0xff,0xff,0x11,0x10,0x80,0x1f, + 0x00,0x00,0x00,0x00,0x08,0x20,0x60,0x60,0xc0,0x07,0x00,0x00,0x04,0x40,0x10, + 0xc0,0x20,0x08,0x00,0x1f,0x02,0x40,0x08,0x00,0x21,0x10,0xc0,0x60,0x02,0x40, + 0x04,0x00,0x12,0x20,0x20,0x80,0x02,0x20,0xc2,0x00,0x14,0x40,0x18,0x00,0x03, + 0x20,0x22,0x00,0x0c,0x80,0x04,0x03,0x02,0x10,0x12,0x00,0x08,0x80,0x86,0x00, + 0x04,0x10,0x12,0x00,0x10,0x80,0x42,0x00,0x18,0x08,0x12,0x00,0x10,0x40,0x42, + 0x00,0x00,0x04,0x02,0x00,0x20,0x40,0x42,0x00,0x00,0x04,0x02,0x00,0x00,0x20, + 0x42,0x00,0x00,0x02,0x04,0x00,0x00,0x20,0x02,0x00,0x00,0x01,0x04,0x00,0x00, + 0x20,0x02,0x00,0x00,0x01,0x08,0x00,0x00,0x20,0x04,0x00,0x80,0x00,0x10,0x00, + 0x00,0x20,0x0c,0x00,0x80,0x00,0x60,0x00,0x00,0x10,0x08,0x00,0x40,0x00,0x80, + 0xff,0xff,0x0f,0x30,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-l2.xpm b/hacks/images/noseguy/nose-l2.xpm new file mode 100644 index 00000000..f08a72eb --- /dev/null +++ b/hacks/images/noseguy/nose-l2.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_l2_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ", +" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", +" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ... ", +" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. .++.. ", +" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. .+++++.. ", +" .............................. .+++++++. ", +" ...... .+++++++++. ", +" ..++++++.. ..... .++++++++++@. ", +" .+++++++++.. .+++++. ..... .+++++++++++@. ", +" .++++++++++++. .++++++. ..+++++.. .++++++++++@@. ", +" .++++++++++++++. .++++++++. .+++++++++. .@+++++++++@. ", +" .++++..++++++++++. .+++++++++. ..+++++++++++..@++++++++@@. ", +" .+++.@@++++++++++..@++++++++++. .+++++..+++++++.@@+++++++@. ", +" .++.@+++++++++++++.@@+++++++++. ..++++.@@++++++++.@@+++++@@. ", +" .++.@++++++++++++++.@+++++++++. .++++.@+++++++++++..++++@@. ", +" .++.@++++++++++++++.@++++++++. .++++.@+++++++++++++++++@. ", +" .@++++++++++++++++++.@+++++++. .++++.@++++++++++++++++@@. ", +" .@@+++++++++++++++++++++++++. .++++.@+++++++++++++++@@. ", +" .@++++++++++++++++++++++++@. .+++++++++++++++++++++@. ", +" .@@+++++++++++++++++++++++@. .++++++++++++++++++++@@. ", +" .@@++++++++++++++++++++++@. .+++++++++++++++++++@. ", +" .@@@+++++++++++++++++++@@. ..+++++++++++++++++@@. ", +" ..@@@@@@@@@@@@@@@@@@@@@. .@@@+++@@@++++++@@@. ", +" ..................... ..@@@@@@@@@@@@@@.. ", +" .............. ", +" ", +" ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-r1.xbm b/hacks/images/noseguy/nose-r1.xbm new file mode 100644 index 00000000..72df86c2 --- /dev/null +++ b/hacks/images/noseguy/nose-r1.xbm @@ -0,0 +1,38 @@ +#define nose_r1_width 64 +#define nose_r1_height 64 +static unsigned char nose_r1_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, + 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f, + 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c, + 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00, + 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x18,0x00,0x00,0x80,0x00, + 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00, + 0x01,0x00,0x02,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x20,0x00,0x00, + 0x00,0x04,0x80,0x00,0x00,0x60,0x00,0x00,0x00,0x18,0x60,0x00,0x00,0x40,0x00, + 0x00,0x00,0xe0,0x1f,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0xc0,0xc0,0x00,0x03,0x00, + 0x00,0x00,0x04,0x80,0x30,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x19,0x00,0x10, + 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x30,0x00,0x00,0x00,0x04,0x00,0x03,0x00, + 0x43,0x00,0x00,0x00,0x04,0x00,0x01,0x00,0x42,0x00,0x00,0x00,0x04,0x80,0x00, + 0x00,0x84,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00, + 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00, + 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-r1.xpm b/hacks/images/noseguy/nose-r1.xpm new file mode 100644 index 00000000..901dd428 --- /dev/null +++ b/hacks/images/noseguy/nose-r1.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_r1_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ", +" .............................. ", +" ", +" ......... ", +" .+++++++++. ........ ", +" .++++++++++. ...++++++++... ", +" .++++++++++++.. ..++++++++++++.. ", +" .++++++++++++@. .++++++++++++++++.. ", +" .++++++++++++@@..+++++++++++..@++++. ", +" .++++++++++++@..++++++++++++++..++++. ", +" .+++++++++++@.+++++++++++++++++.@+++. ", +" .++++++++++@.+++++++++++++++++++.@+++. ", +" .++++++++++..+++++++++++++++++++.@+++. ", +" .+++++++++++++++++++++++++++++++.@+++. ", +" .@++++++++++++++++++++++++++++++++++++. ", +" .@++++++++++++++++++++++++++++++++++@.. ", +" .@+++++++++++++++++++++++++++++++++@@. ", +" .@@++++++++++++++++++++++++++++++++@@. ", +" .@++++++++++++++++++++++++++++++@@@. ", +" .@@++++@@@++++++++++++++++++++@@@.. ", +" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ", +" .............................. ", +" ", +" ", +" "}; diff --git a/hacks/images/noseguy/nose-r2.xbm b/hacks/images/noseguy/nose-r2.xbm new file mode 100644 index 00000000..eb750ca7 --- /dev/null +++ b/hacks/images/noseguy/nose-r2.xbm @@ -0,0 +1,38 @@ +#define nose_r2_width 64 +#define nose_r2_height 64 +static unsigned char nose_r2_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, + 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f, + 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c, + 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00, + 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x18,0x00,0x00,0x80,0x00, + 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x08,0x00,0x10,0x00,0x00,0x00, + 0x01,0x00,0x04,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x02,0x00,0x27,0x00,0x00, + 0x00,0x04,0x00,0x01,0xc0,0x64,0x00,0x00,0x00,0x18,0xc0,0x00,0x30,0x48,0x00, + 0x00,0x00,0xe0,0x3f,0x00,0x08,0x88,0xff,0xff,0xff,0x1f,0x00,0x00,0x04,0x10, + 0x00,0x00,0x00,0x00,0xf8,0x01,0x02,0x20,0x00,0x00,0xe0,0x03,0x06,0x06,0x02, + 0x40,0xf8,0x00,0x10,0x04,0x03,0x08,0x02,0x40,0x06,0x03,0x08,0x84,0x00,0x10, + 0x04,0x40,0x01,0x04,0x04,0x48,0x00,0x20,0x04,0xc0,0x00,0x18,0x02,0x28,0x00, + 0x43,0x08,0x40,0xc0,0x20,0x01,0x30,0x00,0x44,0x08,0x20,0x00,0x61,0x01,0x10, + 0x00,0x48,0x10,0x18,0x00,0x42,0x01,0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02, + 0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,0x04,0x00,0x40,0x40,0x00,0x00,0x42, + 0x04,0x00,0x00,0x40,0x80,0x00,0x00,0x40,0x04,0x00,0x00,0x20,0x80,0x00,0x00, + 0x40,0x04,0x00,0x00,0x20,0x00,0x01,0x00,0x20,0x04,0x00,0x00,0x10,0x00,0x01, + 0x00,0x30,0x04,0x00,0x00,0x08,0x00,0x02,0x00,0x10,0x08,0x00,0x00,0x06,0x00, + 0x0c,0x00,0x0c,0xf0,0xff,0xff,0x01,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00}; diff --git a/hacks/images/noseguy/nose-r2.xpm b/hacks/images/noseguy/nose-r2.xpm new file mode 100644 index 00000000..ddf0edaf --- /dev/null +++ b/hacks/images/noseguy/nose-r2.xpm @@ -0,0 +1,74 @@ +/* XPM */ +static char * nose_r2_xpm[] = { +"64 64 7 1", +" c black m black", +". c black m white", +"X c gray m black", +"o c yellow m black", +"O c yellow2 m black", +"+ c purple m black", +"@ c purple3 m black", +" ", +" ", +" ", +" ", +" ", +" ", +" ..................... ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", +" ........................................... ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ", +" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ", +" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ", +" ... .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ", +" ..++. ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ", +" ..+++++. .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ", +" .+++++++. .............................. ", +" .+++++++++. ...... ", +" .@++++++++++. ..... ..++++++.. ", +" .@+++++++++++. ..... .+++++. ..+++++++++. ", +" .@@++++++++++. ..+++++.. .++++++. .++++++++++++. ", +" .@+++++++++@. .+++++++++. .++++++++. .++++++++++++++. ", +" .@@++++++++@..+++++++++++.. .+++++++++. .++++++++++..++++. ", +" .@+++++++@@.+++++++..+++++. .++++++++++@..++++++++++@@.+++. ", +" .@@+++++@@.++++++++@@.++++.. .+++++++++@@.+++++++++++++@.++. ", +" .@@++++..+++++++++++@.++++. .+++++++++@.++++++++++++++@.++. ", +" .@+++++++++++++++++@.++++. .++++++++@.++++++++++++++@.++. ", +" .@@++++++++++++++++@.++++. .+++++++@.++++++++++++++++++@. ", +" .@@+++++++++++++++@.++++. .+++++++++++++++++++++++++@@. ", +" .@+++++++++++++++++++++. .@++++++++++++++++++++++++@. ", +" .@@++++++++++++++++++++. .@+++++++++++++++++++++++@@. ", +" .@+++++++++++++++++++. .@++++++++++++++++++++++@@. ", +" .@@+++++++++++++++++.. .@@+++++++++++++++++++@@@. ", +" .@@@++++++@@@+++@@@. .@@@@@@@@@@@@@@@@@@@@@.. ", +" ..@@@@@@@@@@@@@@.. ..................... ", +" .............. ", +" ", +" ", +" ", +" "}; diff --git a/hacks/images/puzzle/puzzle.xbm b/hacks/images/puzzle/puzzle.xbm new file mode 100644 index 00000000..b09d6688 --- /dev/null +++ b/hacks/images/puzzle/puzzle.xbm @@ -0,0 +1,1614 @@ +#define puzzle_width 523 +#define puzzle_height 366 +static char puzzle_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00, + 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x0c,0x00,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00, + 0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xc0,0x07, + 0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x0e,0x00,0x00, + 0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c, + 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0xc0,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c, + 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x0c,0x00,0x00, + 0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xc0,0x00,0x00,0x00,0x00, + 0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x60, + 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30, + 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff, + 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0xf8, + 0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x80,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0xf8, + 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x00,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x02,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0xf8,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x40,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8, + 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x10,0xf8,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0xf8,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9, + 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf9,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa, + 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfa,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfc,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa, + 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfa,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x08,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x10,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0xf8,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8,0x40,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x10,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8, + 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0xf8,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x02,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x02,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x08,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0xf8, + 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x80,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0xf8, + 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff, + 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x60,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0xf8, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00, + 0x18,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0xc0,0x00,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x0c,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c, + 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0xc0,0x00,0x00, + 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00, + 0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03, + 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x00,0x0e,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0xc0,0x07,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00, + 0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x00,0x00, + 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, + 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00, + 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00, + 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, + 0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x07,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8}; diff --git a/hacks/images/puzzle/puzzle_a_e_f.xbm b/hacks/images/puzzle/puzzle_a_e_f.xbm new file mode 100644 index 00000000..69601290 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_e_f.xbm @@ -0,0 +1,77 @@ +#define puzzle_a_e_f_width 88 +#define puzzle_a_e_f_height 78 +#define puzzle_a_e_f_x_hot 20 +#define puzzle_a_e_f_y_hot 6 +static unsigned char puzzle_a_e_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, + 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff, + 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, + 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, + 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7e, 0x80, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x00, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, + 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, + 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, + 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_e_h.xbm b/hacks/images/puzzle/puzzle_a_e_h.xbm new file mode 100644 index 00000000..a0de0dd8 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_e_h.xbm @@ -0,0 +1,77 @@ +#define puzzle_a_e_h_width 88 +#define puzzle_a_e_h_height 78 +#define puzzle_a_e_h_x_hot 20 +#define puzzle_a_e_h_y_hot 6 +static unsigned char puzzle_a_e_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00, + 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, + 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, + 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, + 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, + 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00, + 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, + 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, + 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, + 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x07, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7e, 0x80, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, + 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, + 0x00, 0x70, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, + 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, 0x01, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, + 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, + 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, + 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, + 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, + 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_f.xbm b/hacks/images/puzzle/puzzle_a_f.xbm new file mode 100644 index 00000000..10e92431 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_f.xbm @@ -0,0 +1,96 @@ +#define puzzle_a_f_width 108 +#define puzzle_a_f_height 78 +#define puzzle_a_f_x_hot 20 +#define puzzle_a_f_y_hot 5 +static unsigned char puzzle_a_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, + 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, + 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, + 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00, 0xc0, 0xff, + 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, + 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, + 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, + 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, + 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_h.xbm b/hacks/images/puzzle/puzzle_a_h.xbm new file mode 100644 index 00000000..dc9cc6d1 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_h.xbm @@ -0,0 +1,96 @@ +#define puzzle_a_h_width 108 +#define puzzle_a_h_height 78 +#define puzzle_a_h_x_hot 20 +#define puzzle_a_h_y_hot 5 +static unsigned char puzzle_a_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, + 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, + 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, + 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, + 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, + 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, + 0xf0, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00, 0xc0, 0xff, + 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, 0x3f, 0x00, + 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, + 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x3e, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00, 0xe0, 0x80, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, 0x70, 0x00, + 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8, + 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00, + 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, + 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, + 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, + 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, + 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, + 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_n_f.xbm b/hacks/images/puzzle/puzzle_a_n_f.xbm new file mode 100644 index 00000000..989fefb8 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_n_f.xbm @@ -0,0 +1,91 @@ +#define puzzle_a_n_f_width 108 +#define puzzle_a_n_f_height 73 +#define puzzle_a_n_f_x_hot 21 +#define puzzle_a_n_f_y_hot 1 +static unsigned char puzzle_a_n_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e, + 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, + 0x3f, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, + 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, + 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, + 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_n_h.xbm b/hacks/images/puzzle/puzzle_a_n_h.xbm new file mode 100644 index 00000000..3c6ef130 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_n_h.xbm @@ -0,0 +1,91 @@ +#define puzzle_a_n_h_width 108 +#define puzzle_a_n_h_height 73 +#define puzzle_a_n_h_x_hot 21 +#define puzzle_a_n_h_y_hot 1 +static unsigned char puzzle_a_n_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e, + 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00, + 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, + 0x3f, 0x00, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf0, 0x3f, 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, + 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00, + 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, + 0x70, 0x00, 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, + 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, + 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, + 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, + 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, + 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_ne_f.xbm b/hacks/images/puzzle/puzzle_a_ne_f.xbm new file mode 100644 index 00000000..5ed25170 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_ne_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_a_ne_f_width 89 +#define puzzle_a_ne_f_height 74 +#define puzzle_a_ne_f_x_hot 21 +#define puzzle_a_ne_f_y_hot 1 +static unsigned char puzzle_a_ne_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xfe, 0x7f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_ne_h.xbm b/hacks/images/puzzle/puzzle_a_ne_h.xbm new file mode 100644 index 00000000..6b0b3532 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_ne_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_a_ne_h_width 89 +#define puzzle_a_ne_h_height 74 +#define puzzle_a_ne_h_x_hot 21 +#define puzzle_a_ne_h_y_hot 1 +static unsigned char puzzle_a_ne_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x0f, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x3e, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x78, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0xe0, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xf8, 0x00, + 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0x80, 0x01, 0x80, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x00, 0x03, 0xf8, 0x07, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0x86, 0x7f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_nw_f.xbm b/hacks/images/puzzle/puzzle_a_nw_f.xbm new file mode 100644 index 00000000..9af2ee06 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_nw_f.xbm @@ -0,0 +1,73 @@ +#define puzzle_a_nw_f_width 88 +#define puzzle_a_nw_f_height 74 +#define puzzle_a_nw_f_x_hot 1 +#define puzzle_a_nw_f_y_hot 1 +static unsigned char puzzle_a_nw_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, + 0x00, 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, + 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, + 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, + 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, + 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, + 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, + 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, + 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, + 0xff, 0x07, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, + 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_nw_h.xbm b/hacks/images/puzzle/puzzle_a_nw_h.xbm new file mode 100644 index 00000000..20cf8604 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_nw_h.xbm @@ -0,0 +1,73 @@ +#define puzzle_a_nw_h_width 88 +#define puzzle_a_nw_h_height 74 +#define puzzle_a_nw_h_x_hot 1 +#define puzzle_a_nw_h_y_hot 1 +static unsigned char puzzle_a_nw_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, + 0x00, 0x0c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, + 0x1c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, + 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, + 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, + 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, + 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, + 0xc0, 0x07, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc, + 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_s_f.xbm b/hacks/images/puzzle/puzzle_a_s_f.xbm new file mode 100644 index 00000000..687750f0 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_s_f.xbm @@ -0,0 +1,91 @@ +#define puzzle_a_s_f_width 108 +#define puzzle_a_s_f_height 73 +#define puzzle_a_s_f_x_hot 20 +#define puzzle_a_s_f_y_hot 5 +static unsigned char puzzle_a_s_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, + 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, + 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, + 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, + 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0xc0, 0xff, + 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, + 0x3f, 0x00, 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x1f, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_s_h.xbm b/hacks/images/puzzle/puzzle_a_s_h.xbm new file mode 100644 index 00000000..78c0d3ea --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_s_h.xbm @@ -0,0 +1,91 @@ +#define puzzle_a_s_h_width 108 +#define puzzle_a_s_h_height 73 +#define puzzle_a_s_h_x_hot 20 +#define puzzle_a_s_h_y_hot 5 +static unsigned char puzzle_a_s_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, + 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, + 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, + 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, + 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, + 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, + 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0xc0, 0xff, + 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8, 0x3f, 0x00, + 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, + 0x70, 0x00, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x7e, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0xe0, 0xc1, + 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x78, 0x00, + 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, + 0x3f, 0x00, 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x1c, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_se_f.xbm b/hacks/images/puzzle/puzzle_a_se_f.xbm new file mode 100644 index 00000000..dbc5d0f5 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_se_f.xbm @@ -0,0 +1,73 @@ +#define puzzle_a_se_f_width 88 +#define puzzle_a_se_f_height 74 +#define puzzle_a_se_f_x_hot 20 +#define puzzle_a_se_f_y_hot 6 +static unsigned char puzzle_a_se_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, + 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, + 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, + 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, + 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff, + 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, + 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, + 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7f, 0x80, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, + 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_se_h.xbm b/hacks/images/puzzle/puzzle_a_se_h.xbm new file mode 100644 index 00000000..3dbe22ac --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_se_h.xbm @@ -0,0 +1,73 @@ +#define puzzle_a_se_h_width 88 +#define puzzle_a_se_h_height 74 +#define puzzle_a_se_h_x_hot 20 +#define puzzle_a_se_h_y_hot 6 +static unsigned char puzzle_a_se_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00, + 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, + 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, + 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, + 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60, + 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, + 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00, + 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, + 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, + 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, + 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7f, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_sw_f.xbm b/hacks/images/puzzle/puzzle_a_sw_f.xbm new file mode 100644 index 00000000..5a000bf1 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_sw_f.xbm @@ -0,0 +1,73 @@ +#define puzzle_a_sw_f_width 88 +#define puzzle_a_sw_f_height 74 +#define puzzle_a_sw_f_x_hot 1 +#define puzzle_a_sw_f_y_hot 6 +static unsigned char puzzle_a_sw_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, + 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, + 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, + 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, + 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, + 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, + 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, + 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, + 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, + 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, + 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_sw_h.xbm b/hacks/images/puzzle/puzzle_a_sw_h.xbm new file mode 100644 index 00000000..9b34a486 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_sw_h.xbm @@ -0,0 +1,73 @@ +#define puzzle_a_sw_h_width 88 +#define puzzle_a_sw_h_height 74 +#define puzzle_a_sw_h_x_hot 1 +#define puzzle_a_sw_h_y_hot 6 +static unsigned char puzzle_a_sw_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3, + 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, + 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, + 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, + 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, + 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, + 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, + 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00, + 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_w_f.xbm b/hacks/images/puzzle/puzzle_a_w_f.xbm new file mode 100644 index 00000000..f85ef759 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_w_f.xbm @@ -0,0 +1,77 @@ +#define puzzle_a_w_f_width 88 +#define puzzle_a_w_f_height 78 +#define puzzle_a_w_f_x_hot 1 +#define puzzle_a_w_f_y_hot 6 +static unsigned char puzzle_a_w_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, + 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, + 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, + 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, + 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, + 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, + 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, + 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, + 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, + 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, + 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x3f, 0xc0, + 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, + 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, + 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, + 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, + 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, + 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, + 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, + 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f, + 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00, + 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_a_w_h.xbm b/hacks/images/puzzle/puzzle_a_w_h.xbm new file mode 100644 index 00000000..a82478f5 --- /dev/null +++ b/hacks/images/puzzle/puzzle_a_w_h.xbm @@ -0,0 +1,77 @@ +#define puzzle_a_w_h_width 88 +#define puzzle_a_w_h_height 78 +#define puzzle_a_w_h_x_hot 1 +#define puzzle_a_w_h_y_hot 6 +static unsigned char puzzle_a_w_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3, + 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, + 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, + 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, + 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, + 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, + 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, + 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x0f, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x00, + 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x01, 0x07, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xf8, + 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x3c, 0xc0, + 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, + 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, + 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, + 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, + 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, + 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, + 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, + 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, + 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0xc0, 0x07, 0x00, 0x00, + 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0xc0, + 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f, + 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00, + 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_e_f.xbm b/hacks/images/puzzle/puzzle_b_e_f.xbm new file mode 100644 index 00000000..a49e771b --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_e_f.xbm @@ -0,0 +1,95 @@ +#define puzzle_b_e_f_width 74 +#define puzzle_b_e_f_height 108 +#define puzzle_b_e_f_x_hot 6 +#define puzzle_b_e_f_y_hot 21 +static unsigned char puzzle_b_e_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, + 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, + 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, + 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_e_h.xbm b/hacks/images/puzzle/puzzle_b_e_h.xbm new file mode 100644 index 00000000..daa13c16 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_e_h.xbm @@ -0,0 +1,95 @@ +#define puzzle_b_e_h_width 74 +#define puzzle_b_e_h_height 108 +#define puzzle_b_e_h_x_hot 6 +#define puzzle_b_e_h_y_hot 21 +static unsigned char puzzle_b_e_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, + 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, + 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00, + 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, + 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, + 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, 0x00, 0x00, + 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, + 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, + 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f, + 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_f.xbm b/hacks/images/puzzle/puzzle_b_f.xbm new file mode 100644 index 00000000..895abf9c --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_f.xbm @@ -0,0 +1,95 @@ +#define puzzle_b_f_width 78 +#define puzzle_b_f_height 108 +#define puzzle_b_f_x_hot 5 +#define puzzle_b_f_y_hot 20 +static unsigned char puzzle_b_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, + 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07, + 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, + 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_h.xbm b/hacks/images/puzzle/puzzle_b_h.xbm new file mode 100644 index 00000000..0ecc2048 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_h.xbm @@ -0,0 +1,95 @@ +#define puzzle_b_h_width 78 +#define puzzle_b_h_height 108 +#define puzzle_b_h_x_hot 5 +#define puzzle_b_h_y_hot 20 +static unsigned char puzzle_b_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, + 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00, + 0xff, 0x01, 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01, + 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01, 0x60, 0x00, + 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x07, + 0x00, 0x00, 0xfc, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, + 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, + 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07, + 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00, + 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0xc0, 0x07, 0x00, 0x00, + 0xfc, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f, + 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01, + 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f, + 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x01, 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_n_f.xbm b/hacks/images/puzzle/puzzle_b_n_f.xbm new file mode 100644 index 00000000..e7a84b13 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_n_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_n_f_width 78 +#define puzzle_b_n_f_height 88 +#define puzzle_b_n_f_x_hot 6 +#define puzzle_b_n_f_y_hot 1 +static unsigned char puzzle_b_n_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, + 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0x00, 0x00, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, + 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, + 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, + 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, + 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_n_h.xbm b/hacks/images/puzzle/puzzle_b_n_h.xbm new file mode 100644 index 00000000..aae63330 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_n_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_n_h_width 78 +#define puzzle_b_n_h_height 88 +#define puzzle_b_n_h_x_hot 6 +#define puzzle_b_n_h_y_hot 1 +static unsigned char puzzle_b_n_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, + 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, + 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, + 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, + 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, + 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, + 0x00, 0x00, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, + 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, + 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x1f, + 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, + 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, + 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, + 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_ne_f.xbm b/hacks/images/puzzle/puzzle_b_ne_f.xbm new file mode 100644 index 00000000..1a56171c --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_ne_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_ne_f_width 74 +#define puzzle_b_ne_f_height 88 +#define puzzle_b_ne_f_x_hot 6 +#define puzzle_b_ne_f_y_hot 1 +static unsigned char puzzle_b_ne_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, + 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, + 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, + 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_ne_h.xbm b/hacks/images/puzzle/puzzle_b_ne_h.xbm new file mode 100644 index 00000000..72464994 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_ne_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_ne_h_width 74 +#define puzzle_b_ne_h_height 88 +#define puzzle_b_ne_h_x_hot 6 +#define puzzle_b_ne_h_y_hot 1 +static unsigned char puzzle_b_ne_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, + 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, + 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, + 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f, + 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, + 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, + 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, + 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_nw_f.xbm b/hacks/images/puzzle/puzzle_b_nw_f.xbm new file mode 100644 index 00000000..393e0b6d --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_nw_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_nw_f_width 74 +#define puzzle_b_nw_f_height 88 +#define puzzle_b_nw_f_x_hot 1 +#define puzzle_b_nw_f_y_hot 1 +static unsigned char puzzle_b_nw_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, + 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, + 0x1f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00, + 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_nw_h.xbm b/hacks/images/puzzle/puzzle_b_nw_h.xbm new file mode 100644 index 00000000..7b330308 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_nw_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_nw_h_width 74 +#define puzzle_b_nw_h_height 88 +#define puzzle_b_nw_h_x_hot 1 +#define puzzle_b_nw_h_y_hot 1 +static unsigned char puzzle_b_nw_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, + 0x7c, 0x00, 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00, + 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, + 0xf0, 0x0f, 0x18, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, + 0x18, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00, + 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, + 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_s_f.xbm b/hacks/images/puzzle/puzzle_b_s_f.xbm new file mode 100644 index 00000000..f72d7394 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_s_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_s_f_width 78 +#define puzzle_b_s_f_height 88 +#define puzzle_b_s_f_x_hot 5 +#define puzzle_b_s_f_y_hot 20 +static unsigned char puzzle_b_s_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, + 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07, + 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_s_h.xbm b/hacks/images/puzzle/puzzle_b_s_h.xbm new file mode 100644 index 00000000..5f906707 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_s_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_s_h_width 78 +#define puzzle_b_s_h_height 88 +#define puzzle_b_s_h_x_hot 5 +#define puzzle_b_s_h_y_hot 20 +static unsigned char puzzle_b_s_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, + 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, + 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00, + 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, + 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, + 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, + 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07, + 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00, + 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_se_f.xbm b/hacks/images/puzzle/puzzle_b_se_f.xbm new file mode 100644 index 00000000..537725ef --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_se_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_se_f_width 74 +#define puzzle_b_se_f_height 88 +#define puzzle_b_se_f_x_hot 6 +#define puzzle_b_se_f_y_hot 20 +static unsigned char puzzle_b_se_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, + 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, + 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, + 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, + 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_se_h.xbm b/hacks/images/puzzle/puzzle_b_se_h.xbm new file mode 100644 index 00000000..df99f701 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_se_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_se_h_width 74 +#define puzzle_b_se_h_height 88 +#define puzzle_b_se_h_x_hot 6 +#define puzzle_b_se_h_y_hot 20 +static unsigned char puzzle_b_se_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, + 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, + 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, + 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, + 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, + 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, + 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00, + 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, + 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, + 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, + 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_sw_f.xbm b/hacks/images/puzzle/puzzle_b_sw_f.xbm new file mode 100644 index 00000000..f183b52a --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_sw_f.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_sw_f_width 74 +#define puzzle_b_sw_f_height 88 +#define puzzle_b_sw_f_x_hot 1 +#define puzzle_b_sw_f_y_hot 21 +static unsigned char puzzle_b_sw_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, + 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, + 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, + 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, + 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_sw_h.xbm b/hacks/images/puzzle/puzzle_b_sw_h.xbm new file mode 100644 index 00000000..917853bd --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_sw_h.xbm @@ -0,0 +1,79 @@ +#define puzzle_b_sw_h_width 74 +#define puzzle_b_sw_h_height 88 +#define puzzle_b_sw_h_x_hot 1 +#define puzzle_b_sw_h_y_hot 21 +static unsigned char puzzle_b_sw_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, + 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, + 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, + 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0, + 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00, + 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, + 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, + 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_w_f.xbm b/hacks/images/puzzle/puzzle_b_w_f.xbm new file mode 100644 index 00000000..0b5b8d53 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_w_f.xbm @@ -0,0 +1,95 @@ +#define puzzle_b_w_f_width 74 +#define puzzle_b_w_f_height 108 +#define puzzle_b_w_f_x_hot 1 +#define puzzle_b_w_f_y_hot 21 +static unsigned char puzzle_b_w_f_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, + 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, + 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, + 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, + 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, + 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, + 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, + 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, + 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, 0xfe, 0x03, + 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0xfc, + 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, + 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, + 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/puzzle/puzzle_b_w_h.xbm b/hacks/images/puzzle/puzzle_b_w_h.xbm new file mode 100644 index 00000000..2c105c16 --- /dev/null +++ b/hacks/images/puzzle/puzzle_b_w_h.xbm @@ -0,0 +1,95 @@ +#define puzzle_b_w_h_width 74 +#define puzzle_b_w_h_height 108 +#define puzzle_b_w_h_x_hot 1 +#define puzzle_b_w_h_y_hot 21 +static unsigned char puzzle_b_w_h_bits[] = { + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, + 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, + 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, + 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, + 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, + 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0, + 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00, + 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, + 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, + 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, + 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, + 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, + 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x7c, 0x00, 0x00, 0xc0, + 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, + 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, + 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, 0xfe, 0x03, + 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0x0c, + 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, + 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, + 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/images/som.xbm b/hacks/images/som.xbm new file mode 100644 index 00000000..cd24fd01 --- /dev/null +++ b/hacks/images/som.xbm @@ -0,0 +1,1685 @@ +#define som_width 464 +#define som_height 435 +static unsigned char som_bits[] = { + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x60, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x60,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff, + 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfc,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe, + 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff, + 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x7f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff, + 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff, + 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfc,0xff,0xdf,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe, + 0xff,0xdf,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x8f, + 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0xff,0xff, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0xff,0xff,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0xff,0xff,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xff,0xff,0x07,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0xff,0xff,0x07,0xfe,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0xff,0x03,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff, + 0x03,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0xfc, + 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xe0,0xff,0xff,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x07,0x00,0x00, + 0x80,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff, + 0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x03,0x00,0x00,0xe0,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfc,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff, + 0x7f,0xfe,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x01,0xfe, + 0x01,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x01,0xfe,0x01,0x00, + 0x00,0x00,0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x07,0x00,0xce,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfe,0x7f,0x00,0x00,0x87,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0xff,0x07,0x00,0x80,0x03,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, + 0x3f,0x00,0x00,0x80,0x03,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x3f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x3f,0x00, + 0x00,0x80,0x03,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x07,0x00,0x00,0xc0, + 0x01,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,0xc0,0xfb,0xff, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x07,0x00,0xc0,0xff,0xff,0x3f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0xff,0xc0,0xff,0x7f,0x00,0xe0,0xff,0xff,0x7f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0xff,0xc0,0xff,0x7f,0x00,0xe0,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x1f, + 0x00,0xf8,0xff,0x0f,0xf0,0x0f,0xc0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00, + 0xff,0x7f,0xf0,0x01,0x00,0xf8,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x80,0xff, + 0x7b,0x00,0x00,0xe0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xfc,0x3f,0x00, + 0x00,0x80,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xfc,0x3f,0x00,0x00,0x80, + 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0xe0,0x7f,0x00,0x00,0x00,0x7e,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0xff,0x03,0x00,0x00,0x70,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f, + 0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfc,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf8,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x3f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0x00,0x00,0x00,0xfe,0x03,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00, + 0x00,0xfe,0x03,0x00,0x00,0x00,0xf0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x00,0x00,0xf0,0xff, + 0x1f,0x00,0x00,0x00,0x80,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3f,0x00,0x00,0xfc,0xff,0x7f,0x00, + 0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0x1f,0x00,0x00,0xff,0x47,0x7f,0x00,0x00,0x00, + 0x00,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0x00,0x00,0x00,0x00,0xc0, + 0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0x00,0x00,0x00,0x00,0xc0,0xff,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, + 0x03,0xc0,0xff,0xfe,0xff,0x7d,0x00,0x00,0x00,0x00,0x80,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,0x40, + 0x00,0x00,0xfe,0x7f,0x00,0x00,0x00,0x00,0x80,0xff,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x3f,0x00,0x00,0x80,0x03, + 0xf8,0x3f,0x00,0x00,0x00,0x00,0x80,0xe7,0x1f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0xf0,0xff,0xff,0x1f, + 0x00,0x00,0x00,0x00,0x80,0xc7,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0xf0,0xff,0xff,0x1f,0x00,0x00, + 0x00,0x00,0x80,0xc7,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0xf0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00, + 0xc0,0x0f,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0x7f,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x0f, + 0xfc,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0xf0,0x0f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x1f,0x80,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1c,0x00,0xfe,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0x1c,0x00,0xfe,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfe,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x70,0x1c,0x00,0xf0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x70,0x38,0x00,0xc0,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70, + 0x78,0x00,0x00,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x70,0x00, + 0x00,0xfc,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x70,0x00,0x00,0xfc, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x70,0x00,0x00,0xfe,0x03,0xfe, + 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x38,0xf0,0x00,0x00,0xfe,0x0f,0xff,0xff,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x18,0xe0,0x00,0x80,0x9f,0xff,0x3f,0xfe,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x1c,0xe0,0x00,0x80,0x0f,0xff,0x07,0xc0,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x1c,0xe0,0x00,0x80,0x0f,0xff,0x07,0xc0,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xf1, + 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,0xe0, + 0x00,0xc0,0x07,0xfc,0x01,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xe1,0xff,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,0xe0,0x01,0xe0, + 0x03,0x60,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xc3,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0xc0,0x01,0xf0,0x01,0x00, + 0xe0,0x03,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0xf0,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0xc0,0x03,0xf8,0x00,0x00,0xf8,0x1f, + 0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0x07,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x07,0xc0,0x03,0xf8,0x00,0x00,0xf8,0x1f,0xe0,0x00, + 0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x0f,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x07,0x80,0x03,0x78,0x00,0x00,0xf8,0x7f,0xe0,0x01,0x00,0x00, + 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x0f,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x03,0x80,0x03,0x3e,0x00,0x00,0x78,0x7e,0xc0,0x03,0x00,0x00,0x00,0x00, + 0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x1e,0x1c,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf3, + 0x9f,0x03,0x1f,0x00,0x00,0x00,0xf0,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0x70, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0xfe, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07, + 0x0f,0x00,0x00,0x00,0xe0,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0xfe,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x0f,0x00, + 0x00,0x00,0xe0,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0xfc,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x87,0x07,0x00,0x00,0x00, + 0xe0,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0xf8,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0x3f,0xf4,0xc7,0x07,0x00,0x00,0x00,0xe0,0x00, + 0x07,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0x03,0x80,0xe7,0x01,0x00,0x00,0x00,0xe0,0x00,0x07,0x00, + 0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0x00,0x00,0xff,0x01,0x00,0x00,0x00,0xe0,0x80,0x07,0x00,0x00,0x00, + 0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xff,0x00,0x00,0x00,0x00,0xf8,0x80,0x03,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xff,0x00,0x00,0x00,0x00,0xf8,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0xe0,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7e,0x00, + 0x00,0x00,0x00,0x7c,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00,0x80,0x07, + 0xe0,0x3f,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0xc0,0xff,0xff,0x0f, + 0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xe0,0xff,0xff,0x03,0xe0,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xe0,0xff,0xff,0x03,0xe0,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0x3f,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x07,0x00,0x80,0xff,0x7f,0x00,0xf8,0x01,0x00,0x00,0x00,0x00, + 0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0x03,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0xfc,0x07,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x1e, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x03, + 0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00, + 0x00,0x00,0x80,0xcf,0x3f,0x00,0x00,0xfe,0x01,0x00,0xc0,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00, + 0x80,0xcf,0x3f,0x00,0x00,0xfe,0x01,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0xe0,0xe7, + 0xff,0x00,0x00,0xfe,0x0f,0x00,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0x03,0x00,0xfc,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0x03,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0xf0,0xff,0xf9,0xff,0x01, + 0x00,0xe0,0x1f,0x00,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0x03,0x00,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0x03,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x7e,0x00,0x00,0x00,0xc0,0xff,0x7f,0xfe,0xe1,0x07,0x00,0xc0, + 0xff,0x00,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0x01,0x00,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0x03,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x1e,0x00,0x00,0x00,0xfc,0xff,0x1f,0xff,0x81,0x0f,0x00,0x80,0xf1,0x03, + 0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00, + 0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e, + 0x00,0x00,0x00,0xfc,0xff,0x1f,0xff,0x81,0x0f,0x00,0x80,0xf1,0x03,0xc0,0xe1, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,0xc0,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x81,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00, + 0x00,0xff,0x3f,0x80,0xff,0x00,0x1f,0x00,0x80,0xc1,0x07,0xc0,0xe1,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xc1,0xff,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x03,0xc0,0x3f, + 0x00,0xe0,0x7f,0x00,0x7e,0x00,0x80,0x01,0x1f,0xe0,0xe1,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x80,0x07,0xf0,0x07,0x00,0xf0, + 0x3f,0x00,0xf8,0x00,0x80,0x01,0x3c,0xe0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x80,0xff,0xff,0x01,0x00,0xfc,0x1f,0x00, + 0xf0,0x01,0xc0,0x01,0x38,0xe0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0x7f,0xf0,0x00,0xf8,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0x03,0x00,0xfe,0x1f,0x00,0x80,0xbf,0x07,0x00,0x80,0x07, + 0xc0,0x01,0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f, + 0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0x7f,0xf0,0x00,0xf8,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0x03,0x00,0xfe,0x1f,0x00,0x80,0xbf,0x07,0x00,0x80,0x07,0xc0,0x01, + 0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, + 0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f, + 0xf0,0x00,0x00,0xfe,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0, + 0x01,0x00,0xf8,0x03,0x00,0xc0,0xcf,0x03,0x00,0x80,0x1f,0xf0,0x01,0xe0,0x71, + 0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0xf0,0x00, + 0x00,0xe0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00, + 0x00,0x00,0x00,0xe0,0xe7,0x03,0x00,0x00,0x7e,0xff,0x00,0xc0,0x73,0xf0,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0xfc, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0xf0,0x00,0x00,0x00, + 0xfc,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00, + 0x00,0xf8,0xf3,0x00,0x00,0x00,0xfc,0x7f,0x00,0x00,0x7f,0xf0,0xff,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff, + 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0xe0,0xff, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x7c, + 0xf8,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff, + 0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x1f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0xe0,0xff,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x7c,0xf8,0x00, + 0x00,0x00,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff, + 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x80,0xff,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0x7f,0x7c,0x00,0x00,0x00, + 0xe0,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0xfe,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0xc0,0x1f,0x3e,0x00,0x00,0x00,0xc0,0xff, + 0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x7c,0x00,0x00,0x00,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00, + 0x0f,0x00,0x00,0x00,0x00,0xe0,0x07,0x1f,0x00,0x00,0x00,0x80,0x0f,0x00,0x00, + 0x3c,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x3c, + 0x00,0x00,0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00, + 0x00,0x00,0x00,0xfc,0x83,0x0f,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x38,0xf0, + 0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfc,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00, + 0x00,0x00,0x00,0xfe,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00, + 0x00,0xfc,0x83,0x0f,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x38,0xf0,0xff,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0, + 0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0xf8, + 0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0xff, + 0x80,0x07,0x00,0x00,0x00,0x00,0x3e,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00, + 0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff, + 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0xff,0xff,0xff, + 0xff,0x03,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0xe0,0x1f,0xe0,0x03, + 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0xe0,0xff,0xff, + 0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff, + 0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0x00,0x00,0xff,0x3f,0xe0,0xff,0x0f, + 0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0xf8,0x07,0xf0,0x01,0x00,0x00, + 0x00,0x00,0xf0,0x01,0x00,0x1e,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x03,0x00, + 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0xe0,0xff,0x01,0xfe,0x3f,0x00,0x00, + 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0xfe,0x01,0xf8,0x00,0x00,0x00,0x00,0x00, + 0xc0,0x03,0x00,0x0e,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x03,0x00,0x00,0x00, + 0x00,0x80,0x07,0x00,0x00,0x00,0xe0,0xff,0x01,0xfe,0x3f,0x00,0x00,0x00,0x00, + 0xf0,0x00,0x00,0x00,0x00,0xfe,0x01,0xf8,0x00,0x00,0x00,0x00,0x00,0xc0,0x03, + 0x00,0x0e,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x80, + 0x07,0x00,0x00,0x00,0x00,0xf8,0x07,0xc0,0xff,0x01,0x00,0x00,0x00,0xf8,0x00, + 0x00,0x00,0x80,0x7f,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0x0e, + 0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0xc0,0xe3,0xff, + 0xff,0x00,0x00,0xc0,0x1f,0x80,0xff,0x03,0x00,0x00,0x00,0x3c,0x00,0x00,0x00, + 0xe0,0x1f,0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x07,0x00,0x00, + 0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0xc0,0xfb,0xff,0xff,0x0f, + 0x00,0x00,0x3e,0x80,0xf3,0x1f,0x00,0x00,0x00,0x3e,0x00,0x00,0x00,0xf8,0x07, + 0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x07,0x00,0x00,0x00,0xe0, + 0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0x00,0x00, + 0x7c,0xc0,0x81,0xff,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0xff,0x01,0x00,0x0f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x80,0x07,0x00,0x00,0x00,0xf0,0xff,0xff, + 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff, + 0xff,0xff,0x03,0x00,0x00,0x00,0xc0,0x7f,0x00,0xe0,0xff,0x3f,0x00,0xf0,0xc0, + 0x01,0xfe,0x03,0x00,0x00,0x0f,0x00,0x00,0xc0,0x7f,0x00,0xc0,0x07,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0xc0,0x03,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff, + 0x03,0x00,0x00,0x00,0xc0,0x7f,0x00,0xe0,0xff,0x3f,0x00,0xf0,0xc0,0x01,0xfe, + 0x03,0x00,0x00,0x0f,0x00,0x00,0xc0,0x7f,0x00,0xc0,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xc0,0x03,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x07,0x00, + 0x00,0x00,0xc0,0x0f,0x00,0x00,0xfc,0xff,0x03,0xc0,0xe3,0x01,0xf0,0x07,0x00, + 0x80,0x07,0x00,0x00,0xf0,0x1f,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0xc1,0x01,0x00,0x00,0x00,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x1f,0x00,0x00,0x00, + 0xc0,0x07,0x00,0x00,0x00,0xfc,0xff,0x00,0xf7,0x00,0x00,0x3f,0x00,0xc0,0x03, + 0x00,0x00,0xff,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xe3, + 0x01,0x00,0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0xc0,0x01, + 0x00,0x00,0x00,0xc0,0xff,0x07,0x7f,0x00,0x00,0xfc,0x00,0xe0,0x03,0x00,0xe0, + 0x3f,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x00,0x00, + 0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x00,0x00,0x00,0xc0,0x01,0x00,0x00, + 0x00,0x00,0xfe,0x7f,0x7f,0x00,0x00,0xf8,0x01,0xe0,0x01,0x00,0xfc,0x07,0x00, + 0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x00,0x00,0x00,0xfc, + 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfe,0xff,0xff,0xff,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00, + 0xfe,0x7f,0x7f,0x00,0x00,0xf8,0x01,0xe0,0x01,0x00,0xfc,0x07,0x00,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x00,0x00,0x00,0xfc,0xff,0xff, + 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0xff,0xff,0x03,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0xe0,0xff, + 0x3f,0x00,0x00,0xf0,0x07,0xf0,0x00,0x00,0xff,0x03,0x00,0x00,0x7c,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x7e,0x00,0x00,0x00,0xff,0xff,0xff,0x7f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff, + 0xff,0xff,0x0f,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0xfe,0x3f,0x00, + 0x00,0xc0,0x3f,0xf8,0x00,0xf8,0x3f,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff, + 0x3f,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x0f,0x00,0x00, + 0x7f,0x7c,0x00,0xfe,0x07,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x1e,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00, + 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x7f,0x00,0x00,0xfc,0x3e, + 0xe0,0x7f,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x1f,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x80, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x7f,0x00,0x00,0xfc,0x3e,0xe0,0x7f, + 0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00, + 0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x80,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x1f,0x00,0xf0,0x1f,0xfe,0x0f,0x00,0x00, + 0x00,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0x00,0x00,0xfc, + 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfc,0xff,0x3f,0xc0,0xff,0xff,0x00,0x00,0x00,0x00,0xc0, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x03,0x00,0x00,0xff,0xff,0xff, + 0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xff,0xff,0xff,0x0f,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0xe0,0x03,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x03,0x00,0xc0,0xff,0xff,0xff,0x1f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff, + 0xff,0xff,0x7f,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff, + 0xff,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0xff,0x1f,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x7c,0x00,0x00,0xfc,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x03, + 0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x7f, + 0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00, + 0x00,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0xe0, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0xfe,0x00,0x00, + 0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x1f,0x00,0xc0,0xff, + 0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x1f,0x00,0xc0,0x03,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0xf8,0x03,0x00,0x00,0x00, + 0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x00,0xe0,0xff,0xff,0xff, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x80,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0xe0,0x0f,0x00,0x00,0x00,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0xf8,0xff,0xff,0xff,0x03,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x70,0xe0,0x0f,0x00,0x00,0x00,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0xf8,0xff,0xff,0xff,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xff,0xff,0xff,0xff,0x00,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x70,0x00,0x3f,0x00,0x00,0x80,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x01,0x00,0xfe,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, + 0xff,0xff,0xff,0x03,0x00,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x70,0x00,0xfe,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x7e,0x00,0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff, + 0xff,0x0f,0x00,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70, + 0x00,0xf8,0x01,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00, + 0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x3f, + 0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x80, + 0x0f,0x00,0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0xf8,0xff, + 0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,0x00,0xf8, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x80,0x0f,0x00, + 0xf0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0x00,0xf8,0xff,0xff,0xff, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff,0x00,0xe0,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x3e,0x00,0xf0,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x07,0x00,0xfe,0xff,0xff,0xff,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x03,0xc0,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0xfc,0x00,0x78,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0x01,0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x0f,0xc0,0x07,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0xe0,0x03,0x3c,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x7c,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0xff,0xff,0x1f,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x7c,0x00,0x00,0xc0,0x1f,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x3e,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0xff,0xff,0x1f,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x7c,0x00,0x00,0xc0,0x1f,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3e,0x00, + 0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff, + 0xff,0x7f,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00, + 0x00,0x00,0x3f,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00,0xfc,0xff, + 0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff, + 0x01,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00, + 0xfc,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x07,0x00,0xff,0xff,0xff,0x3f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x03,0x78, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0xf8,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0xc0,0xff,0xff,0xff,0x1f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0xfc,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0xfc,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0x00,0xf0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x1f,0xe0,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x7e,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xff,0xff,0xff,0xff,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x1e,0x00,0x00,0x00,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00, + 0xfe,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0xff,0xff,0x01,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e, + 0x00,0x00,0x80,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0x80,0xff,0xff, + 0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff, + 0xff,0xff,0x07,0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0e,0x00,0x00, + 0xc0,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0xe0,0xff,0xff,0xff,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff, + 0x0f,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0xe0,0x3f, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x7c, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0xe0,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,0xf0,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x7e,0x00,0xfc,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x7f,0xe0,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfc,0x1f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x3e,0x00,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xe0,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0x07,0x00,0x00,0xfc,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0xc0, + 0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xff,0xff,0xff,0xc1,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x03,0x00,0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0xf0,0xff,0xff, + 0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf0,0xff,0xff,0xff,0xc1,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00, + 0x00,0xfe,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0x0f,0xf0,0xff,0xff,0xff,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff, + 0xff,0xff,0x83,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xff, + 0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0x07,0xf8,0xff,0xff,0xff,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff, + 0x0f,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0xc0,0xef,0x03,0x00, + 0x00,0x00,0x00,0x00,0xe0,0x01,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x0f,0x1c, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0xe0,0xf3,0x01,0x00,0x00,0x00, + 0x00,0x00,0xf0,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x1f,0x38,0x00,0x00, + 0x00,0x00,0x00,0x00,0x70,0x00,0x00,0xf0,0xf9,0x00,0x00,0x00,0x00,0x00,0x00, + 0x78,0xe0,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x1f,0x38,0x00,0x00,0x00,0x00, + 0x00,0x00,0x70,0x00,0x00,0xf0,0xf9,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0xe0, + 0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x7f,0xf0,0x00,0x00,0x00,0x00,0x00,0x00, + 0x78,0x00,0x00,0x78,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xf0,0xff,0xff, + 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0xff,0xff,0xff,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00, + 0x00,0x7e,0x7c,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xf8,0xff,0xff,0xff,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xff,0xff,0xff,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x3e, + 0x3e,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0xfe,0xff,0xff,0x7f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe, + 0xff,0xff,0xc1,0x03,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x0f,0x1e,0x00, + 0x00,0x00,0x00,0x00,0x00,0x0f,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff, + 0xc1,0x03,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x0f,0x1e,0x00,0x00,0x00, + 0x00,0x00,0x00,0x0f,0xfe,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x83,0x07, + 0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0xc0,0x07,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x80,0x07,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x07,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x0f,0x00,0xe0,0x83,0x0f,0x00,0x00,0x00,0x00,0x00,0x80,0xc7, + 0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x0f,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x07,0x00,0xf0,0x81,0x07,0x00,0x00,0x00,0x00,0x00,0xc0,0xc3,0xff,0xff, + 0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x1f,0x1c,0x00,0x00,0x00,0x00,0x80,0x03, + 0x00,0x7c,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0xe0,0xe1,0xff,0xff,0x7f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0x3f,0x3c,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x3f, + 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0xe0,0xe0,0xff,0xff,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0x3f,0x3c,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x3f,0xe0,0x01, + 0x00,0x00,0x00,0x00,0x00,0xe0,0xe0,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, + 0xff,0x3f,0x3c,0x00,0x00,0x00,0x00,0xe0,0x01,0x80,0x1f,0xe0,0x01,0x00,0x00, + 0x00,0x00,0x00,0xf0,0xe0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f, + 0x38,0x00,0x00,0x00,0x00,0xe0,0x00,0xe0,0x07,0xf0,0x00,0x00,0x00,0x00,0x00, + 0x00,0x78,0xf8,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00, + 0x00,0x00,0x00,0xf0,0x00,0xf0,0x03,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x78, + 0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,0x00,0x00, + 0x00,0x70,0x00,0xfe,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xfc,0xff, + 0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,0x00,0x00,0x00,0x70, + 0x00,0xfe,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0xfc,0xff,0x3f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x38,0x00,0x00,0x00,0x00,0x38,0x80,0x3f, + 0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0xfc,0xff,0x3f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0xff,0x3f,0x38,0x00,0x00,0x00,0x00,0x1c,0xc0,0x0f,0x00,0x1c, + 0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0x1f,0x38,0x00,0x00,0x00,0x00,0x1e,0xf0,0x03,0x00,0x1e,0x00,0x00, + 0x00,0x00,0x00,0x00,0x1e,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff, + 0x1f,0x38,0x00,0x00,0x00,0x00,0x0f,0x7f,0x00,0x00,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x0f,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x1f,0x38, + 0x00,0x00,0x00,0x00,0x0f,0x7f,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x0f,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x1f,0x38,0x00,0x00, + 0x00,0x00,0xe7,0x3f,0x00,0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0xfc, + 0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x0f,0x38,0x00,0x00,0x00,0x80, + 0xfb,0x0f,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x07,0xfc,0xff,0x7f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0x38,0x00,0x00,0x00,0xc0,0xff,0x01, + 0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0xf8,0xff,0xff,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xff,0xff,0x07,0x38,0x00,0x00,0x00,0xe0,0x3f,0x00,0x00,0xc0, + 0x01,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0xf8,0xff,0xff,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xff,0xff,0x07,0x38,0x00,0x00,0x00,0xe0,0x3f,0x00,0x00,0xc0,0x01,0x00, + 0x00,0x00,0x00,0x00,0xc0,0x03,0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff, + 0xff,0x07,0x38,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,0xe0,0x00,0x00,0x00,0x00, + 0x00,0x00,0xc0,0x03,0xf8,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03, + 0x38,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x01,0xf8,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0x38,0x00, + 0x00,0x00,0x70,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01, + 0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x38,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0xf0,0xff, + 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0xf0,0xff,0xff,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x38,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0xf0,0xff,0xff,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0xe0,0xff,0xff,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, + 0xff,0xff,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00, + 0x00,0x00,0x00,0x78,0x00,0xe0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f, + 0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00, + 0x00,0x78,0x00,0xc0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x18, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x3c, + 0x00,0xc0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x18,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0xc0, + 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x7f,0x00,0x1c,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x80,0xff,0xff, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x80,0xff,0xff,0x1f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0xff,0x1f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x80,0xff,0xff,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0x1f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff, + 0x1f,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x1f,0x00,0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00, + 0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x0f,0x00,0x00,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x1c,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00, + 0x00,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x07,0x00,0x1c,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfe, + 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0x00,0x1e,0x00,0x00,0x00,0x00,0x00, + 0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfe,0xff,0x7f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xff,0xff,0x07,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x70, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfe,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xff,0xff,0x07,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0xfc,0xff,0x7f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff, + 0xff,0x03,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0x03,0x00,0x00,0xfc,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03, + 0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00, + 0xc0,0x03,0x00,0x00,0xfc,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0x00,0x1e, + 0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03, + 0x00,0x00,0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x03,0x00,0x1e,0x00,0x00, + 0x00,0x00,0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00, + 0xf8,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,0x1e,0x00,0x00,0x00,0x00, + 0x00,0x00,0x1e,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0xf8,0xff, + 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0xff,0xff,0x01,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x00, + 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xf0,0xff,0xff,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0xff,0xff,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xf0,0xff,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, + 0xff,0xff,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xf0,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f, + 0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0x01,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00, + 0x3c,0x00,0x00,0x00,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x01,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,0x38,0x00, + 0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00, + 0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x00,0x00,0x38,0x00,0x00,0x00, + 0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xe0, + 0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0xff,0x3f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00, + 0xe0,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0xff,0xff, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfc,0xff,0x1f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0xe0,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0xff,0xff,0x07,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0x1f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff, + 0x1f,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xc0,0x01,0x00,0x00,0x80,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00, + 0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xc0,0x03,0x00,0x00,0x80,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x38, + 0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x03, + 0x00,0x00,0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x3c,0x00,0x00, + 0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00, + 0x00,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x3c,0x00,0x00,0x00,0x00, + 0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0xff, + 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xff,0x07,0x00,0x00,0xfc,0x3f,0x00,0x00,0x00,0x00,0x00,0x3e, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0xfe,0xff,0x1f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x0f,0x00,0xe0,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x1e,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff, + 0xff,0x0f,0x3c,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x0e,0x00,0x00,0x00,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f, + 0x3c,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x0e,0x00,0x00,0x00,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x01,0x00,0x38,0x00, + 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1e,0x00, + 0x00,0x00,0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x38,0x00,0x00,0x00, + 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00, + 0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xff,0xff,0x03,0x00,0x00,0x00,0x38,0x00,0x00,0x00,0x00,0xc0, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0xf8,0xff, + 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0x1f,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0xc0,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0xf8,0xff,0xff,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff, + 0x01,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00, + 0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0xe0,0x01,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0x01,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07,0x00,0xfe,0x00,0x00, + 0x00,0x70,0x00,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xe0,0x03,0x00,0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x1f,0x00,0xf8,0xff,0x00,0x00,0x00,0x70, + 0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x03,0x00,0x00,0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0x7f,0x00,0xe0,0xff,0x7f,0x00,0x00,0x00,0x70,0x00,0x00, + 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0x00, + 0x00,0xf0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xe0,0xff,0x03,0x00,0xf0,0xff,0x3f,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00, + 0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0xe0, + 0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff, + 0x03,0x00,0xf0,0xff,0x3f,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x78,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0x00,0xe0,0xff,0xff, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x7f,0x00,0x00, + 0xf8,0xff,0x3f,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0xe0,0xff,0xff,0x03,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x07,0x00,0x00,0xf8,0xff, + 0x1f,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0x01,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00, + 0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0x07,0x00,0xc0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xc0,0x1f,0x00,0x00,0x00,0xfe,0xff,0x1f,0x00,0x00,0x00, + 0xe0,0x00,0x00,0x00,0x00,0x3c,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0x3f,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xc0,0x1f,0x00,0x00,0x00,0xfe,0xff,0x1f,0x00,0x00,0x00,0xe0,0x00, + 0x00,0x00,0x00,0x3c,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x3f,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x80,0x03,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,0xe0,0x00,0x00,0x00, + 0x00,0x3e,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x01, + 0x80,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x3f, + 0x00,0x00,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x3f,0x80,0xff, + 0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xff,0xff,0x07,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0xff,0x00,0x00, + 0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x00,0xfc,0xff,0x0f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff, + 0xff,0x07,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0xf7,0x03,0x00,0x3c,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,0xc0,0xff,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x07, + 0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0xf7,0x03,0x00,0x3c,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x0f,0xc0,0xff,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0x00, + 0x00,0xc0,0x01,0x00,0x00,0x80,0xe3,0x0f,0x00,0x3f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0x7f,0x00,0xf8,0x1f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0x00,0x00,0xc0, + 0x01,0x00,0x00,0x80,0xe3,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x80,0xff,0x03,0x80,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0x00,0x00,0xc0,0x01,0x00, + 0x00,0x80,0xc3,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0, + 0x01,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, + 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0x01,0xfe, + 0x7f,0x38,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x1f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0xff,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00,0xc0,0x01,0xfe,0x7f,0x38, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x1f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff, + 0x00,0x00,0x00,0x00,0xc1,0x01,0x00,0x00,0xe0,0x00,0x3e,0x00,0x38,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x01,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x00,0x00, + 0x00,0x80,0xc3,0x01,0x00,0x00,0xe0,0x00,0x7c,0x00,0x3c,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0x7f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0x00,0x00,0x00,0xf0, + 0xc3,0x01,0x00,0x00,0xf0,0x00,0xf0,0x00,0x3c,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x7f,0x00,0x00,0x00,0xf8,0xc3,0x01, + 0x00,0x00,0xf0,0x00,0xe0,0x01,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf8,0xff,0x7f,0x00,0x00,0x00,0xf8,0xc3,0x01,0x00,0x00, + 0xf0,0x00,0xe0,0x01,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0xff,0x7f,0x00,0x00,0x00,0xff,0xc3,0x03,0x00,0x00,0x70,0x00, + 0xc0,0x03,0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x80,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf8,0xff,0x3f,0x00,0x00,0x80,0xff,0xc3,0x03,0x00,0x00,0x70,0x00,0xc0,0x03, + 0x3c,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00, + 0xf0,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff, + 0x1f,0x00,0x00,0xe0,0xff,0xc3,0x03,0x00,0x00,0x78,0x00,0x80,0x07,0x3c,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x7f,0x00,0x00,0x00, + 0xfc,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00, + 0x00,0xf8,0xff,0xc3,0x03,0x00,0x00,0x78,0x00,0x00,0x0f,0x3c,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x1f,0x00,0x00,0xf8, + 0xff,0xc3,0x03,0x00,0x00,0x78,0x00,0x00,0x0f,0x3c,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0x0f,0x00,0x00,0xfe,0xff,0x83, + 0x03,0x00,0x00,0x3c,0x00,0x00,0x1e,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfc,0xff,0x01,0xe0,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x80,0xff,0xff,0x87,0x03,0x00, + 0x00,0x3c,0x00,0x00,0x3c,0x1c,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff, + 0xff,0xff,0xe1,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0xc0,0xff,0xff,0x87,0x03,0x00,0x00,0x3c, + 0x00,0x00,0x78,0x1c,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0xff, + 0xe1,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xff,0xff,0x07,0x00,0xf8,0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00, + 0xe0,0x1c,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0xc0,0xff, + 0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff, + 0xff,0x07,0x00,0xf8,0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,0xe0,0x1c, + 0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0xc0,0xff,0xff,0x03, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x03, + 0x00,0xfe,0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,0xe0,0x1f,0x00,0x00, + 0x00,0xf0,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x07,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0x00,0xff, + 0xff,0xff,0xc7,0x03,0x00,0x00,0x1c,0x00,0x00,0x80,0x1f,0x00,0x00,0x00,0xff, + 0xff,0x03,0x00,0x00,0x00,0xfc,0x03,0x80,0xff,0xff,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x03,0xc0,0xff,0xff,0xff, + 0xc7,0x03,0x00,0x00,0x1e,0x00,0x00,0x00,0x1f,0x00,0x00,0xf8,0xff,0x0f,0x00, + 0x80,0xff,0xff,0xff,0x1f,0x00,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x01,0xf0,0xff,0xff,0xff,0xc3,0x03, + 0x00,0x00,0xfe,0xff,0x00,0x00,0x1f,0x00,0xe0,0xff,0x3f,0x00,0x00,0x80,0xff, + 0xff,0xff,0x3f,0x00,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0x00,0x00, + 0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x80,0xff,0xff,0xff, + 0x7f,0x00,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0x00,0x00,0xfe,0xff, + 0xff,0xff,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00, + 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0, + 0xff,0xff,0x01,0xff,0xff,0xff,0xff,0x80,0x03,0x00,0x00,0xfe,0xff,0xff,0xff, + 0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0xfe,0xff, + 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff, + 0x80,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x7c,0x00,0x00,0xf5,0xff,0xff, + 0x3f,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x07,0xfe,0xff,0x1f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0x7f,0xf0,0xff, + 0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x1f,0xfe,0xff,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff, + 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,0x03,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff, + 0xff,0xff,0xff,0xfc,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff, + 0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf8,0xff,0xff,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0xff, + 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff, + 0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff, + 0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0xff, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x7f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfc,0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0, + 0xff,0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff, + 0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe, + 0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0xff, + 0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff, + 0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0xff,0x01, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x3f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0xff,0x01,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xf0,0xff,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0xff,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0xff,0xff,0xff,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff, + 0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff, + 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0xff,0xff, + 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x0f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0x0f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0xff,0xff,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xe0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf8,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xf8,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff, + 0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff, + 0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x07, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x3f, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0xff,0xff,0x03,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x3f,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x3f,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xfe,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x80,0xff,0xff,0x3f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xfe,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff, + 0xff,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xfc,0xff,0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0xff, + 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x3f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x7f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x1f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0xff,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0xc0,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0xc0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, + 0x7f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xf0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x1f,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0xc0,0xff,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x1f,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff, + 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x0f,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xff,0x01,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0x03,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x03,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0xf0,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0xc0,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, + 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00}; diff --git a/hacks/maze.c b/hacks/maze.c index ed593451..9150bb29 100644 --- a/hacks/maze.c +++ b/hacks/maze.c @@ -1339,8 +1339,6 @@ char *defaults[] = { #ifdef XROGER "*logoColor: red3", #endif - "*eraseSpeed: 400", - "*eraseMode: -1", 0 }; diff --git a/hacks/moire2.c b/hacks/moire2.c new file mode 100644 index 00000000..463478c6 --- /dev/null +++ b/hacks/moire2.c @@ -0,0 +1,278 @@ +/* xscreensaver, Copyright (c) 1997 Jamie Zawinski + * + * Permission to use, copy, modify, distribute, and sell this software and its + * documentation for any purpose is hereby granted without fee, provided that + * the above copyright notice appear in all copies and that both that + * copyright notice and this permission notice appear in supporting + * documentation. No representations are made about the suitability of this + * software for any purpose. It is provided "as is" without express or + * implied warranty. + */ + +#include "screenhack.h" +#include +#include + +static int ncolors, color_shift; +static XColor *colors = 0; +static int fg_pixel, bg_pixel; +static Pixmap p0 = 0, p1 = 0, p2 = 0, p3 = 0; +static GC copy_gc = 0, erase_gc = 0, window_gc = 0; +static int width, height, size; +static int x1, x2, y1, y2, x3, y3; +static int dx1, dx2, dx3, dy1, dy2, dy3; +static int othickness, thickness; +static Bool do_three; + +static void +init_moire2 (Display *dpy, Window window) +{ + XWindowAttributes xgwa; + XGetWindowAttributes (dpy, window, &xgwa); + + othickness = get_integer_resource("thickness", "Thickness"); + + if (mono_p) + ncolors = 2; + else + ncolors = get_integer_resource ("colors", "Colors"); + if (ncolors < 2) ncolors = 2; + if (ncolors <= 2) mono_p = True; + + if (mono_p) + colors = 0; + else + colors = (XColor *) malloc(sizeof(*colors) * (ncolors+1)); + + if (mono_p) + ; + else + make_smooth_colormap (dpy, xgwa.visual, xgwa.colormap, colors, &ncolors, + True, 0, True); + + bg_pixel = get_pixel_resource("background", "Background", dpy, + xgwa.colormap); + fg_pixel = get_pixel_resource("foreground", "Foreground", dpy, + xgwa.colormap); +} + + +static void +reset_moire2 (Display *dpy, Window window) +{ + GC gc; + XWindowAttributes xgwa; + XGCValues gcv; + Bool xor; + XGetWindowAttributes (dpy, window, &xgwa); + + do_three = (0 == (random() % 3)); + + width = xgwa.width; + height = xgwa.height; + size = width > height ? width : height; + + if (p0) XFreePixmap(dpy, p0); + if (p1) XFreePixmap(dpy, p1); + if (p2) XFreePixmap(dpy, p2); + if (p3) XFreePixmap(dpy, p3); + + p0 = XCreatePixmap(dpy, window, width, height, 1); + p1 = XCreatePixmap(dpy, window, width*2, height*2, 1); + p2 = XCreatePixmap(dpy, window, width*2, height*2, 1); + if (do_three) + p3 = XCreatePixmap(dpy, window, width*2, height*2, 1); + else + p3 = 0; + + thickness = (othickness > 0 ? othickness : (1 + (random() % 4))); + + gcv.foreground = 0; + gcv.line_width = (thickness == 1 ? 0 : thickness); + gc = XCreateGC (dpy, p1, GCForeground|GCLineWidth, &gcv); + + XFillRectangle(dpy, p1, gc, 0, 0, width*2, height*2); + XFillRectangle(dpy, p2, gc, 0, 0, width*2, height*2); + if (do_three) + XFillRectangle(dpy, p3, gc, 0, 0, width*2, height*2); + + XSetForeground(dpy, gc, 1); + + xor = (do_three || (thickness == 1) || (random() & 1)); + + { + int i, ii, maxx, maxy; + +#define FROB(P) do { \ + maxx = (size*4); \ + maxy = (size*4); \ + if (0 == (random() % 5)) { \ + float f = 1.0 + frand(0.05); \ + if (random() & 1) maxx *= f; \ + else maxy *= f; \ + } \ + ii = (thickness + 1 + (xor ? 0 : 1) + (random() % (4 * thickness))); \ + for (i = 0; i < (size*2); i += ii) \ + XDrawArc(dpy, (P), gc, i-size, i-size, maxx-i-i, maxy-i-i, 0, 360*64); \ + if (0 == (random() % 5)) \ + { \ + XSetFunction(dpy, gc, GXxor); \ + XFillRectangle(dpy, (P), gc, 0, 0, width*2, height*2); \ + XSetFunction(dpy, gc, GXcopy); \ + } \ + } while(0) + + FROB(p1); + FROB(p2); + if (do_three) + FROB(p3); +#undef FROB + } + + XFreeGC(dpy, gc); + + if (copy_gc) XFreeGC(dpy, copy_gc); + gcv.function = (xor ? GXxor : GXor); + gcv.foreground = 1; + gcv.background = 0; + + copy_gc = XCreateGC (dpy, p0, GCFunction|GCForeground|GCBackground, &gcv); + + gcv.foreground = 0; + if (erase_gc) XFreeGC(dpy, erase_gc); + erase_gc = XCreateGC (dpy, p0, GCForeground, &gcv); + + gcv.foreground = fg_pixel; + gcv.background = bg_pixel; + if (window_gc) XFreeGC(dpy, window_gc); + window_gc = XCreateGC (dpy, window, GCForeground|GCBackground, &gcv); + +#define FROB(N,DN,MAX) \ + N = (MAX/2) + (random() % MAX); \ + DN = ((1 + (random() % (7*thickness))) * ((random() & 1) ? 1 : -1)) + + FROB(x1,dx1,width); + FROB(x2,dx2,width); + FROB(x3,dx3,width); + FROB(y1,dy1,height); + FROB(y2,dy2,height); + FROB(y3,dy3,height); +#undef FROB +} + + + +static void +moire2 (Display *dpy, Window window) +{ +#define FROB(N,DN,MAX) \ + N += DN; \ + if (N <= 0) N = 0, DN = -DN; \ + else if (N >= MAX) N = MAX, DN = -DN; \ + else if (0 == (random() % 100)) DN = -DN; \ + else if (0 == (random() % 50)) \ + DN += (DN <= -20 ? 1 : (DN >= 20 ? -1 : ((random() & 1) ? 1 : -1))) + + FROB(x1,dx1,width); + FROB(x2,dx2,width); + FROB(x3,dx3,width); + FROB(y1,dy1,height); + FROB(y2,dy2,height); + FROB(y3,dy3,height); +#undef FROB + + XFillRectangle(dpy, p0, erase_gc, 0, 0, width, height); + XCopyArea(dpy, p1, p0, copy_gc, x1, y1, width, height, 0, 0); + XCopyArea(dpy, p2, p0, copy_gc, x2, y2, width, height, 0, 0); + if (do_three) + XCopyArea(dpy, p3, p0, copy_gc, x3, y3, width, height, 0, 0); + + XSync(dpy, False); + XCopyPlane(dpy, p0, window, window_gc, 0, 0, width, height, 0, 0, 1L); + XSync(dpy, False); + +#if 0 + XCopyPlane(dpy, p1, window, window_gc, (width*2)/3, (height*2)/3, + width/2, height/2, + 0, height/2, 1L); + XCopyPlane(dpy, p2, window, window_gc, (width*2)/3, (height*2)/3, + width/2, height/2, + width/2, height/2, 1L); +#endif +} + + + + +char *progclass = "Moire2"; + +char *defaults [] = { + "Moire2.background: black", /* to placate SGI */ + "Moire2.foreground: white", + "*delay: 50000", + "*thickness: 0", + "*colors: 150", + "*colorShift: 5", + 0 +}; + +XrmOptionDescRec options [] = { + { "-delay", ".delay", XrmoptionSepArg, 0 }, + { "-ncolors", ".colors", XrmoptionSepArg, 0 }, + { "-thickness", ".thickness", XrmoptionSepArg, 0 }, + { 0, 0, 0, 0 } +}; + +void +screenhack (Display *dpy, Window window) +{ + int delay = get_integer_resource ("delay", "Integer"); + int color_shift = get_integer_resource ("colorShift", "Integer"); + int pix = 0; + Bool flip_a, flip_b; + + if (color_shift <= 0) color_shift = 1; + init_moire2 (dpy, window); + while (1) + { + int iterations = 30 + (random() % 70) + (random() % 70); + reset_moire2 (dpy, window); + + flip_a = mono_p ? False : (random() & 1); + flip_b = mono_p ? False : (random() & 1); + + if (flip_b) + { + XSetForeground(dpy, window_gc, bg_pixel); + XSetBackground(dpy, window_gc, fg_pixel); + } + else + { + XSetForeground(dpy, window_gc, fg_pixel); + XSetBackground(dpy, window_gc, bg_pixel); + } + + while (--iterations > 0) + { + int i; + + if (!mono_p) + { + pix++; + pix = pix % ncolors; + + if (flip_a) + XSetBackground(dpy, window_gc, colors[pix].pixel); + else + XSetForeground(dpy, window_gc, colors[pix].pixel); + } + + for (i = 0; i < color_shift; i++) + { + moire2 (dpy, window); + if (delay) + usleep(delay); + } + } + } +} diff --git a/hacks/mountain.c b/hacks/mountain.c index 0b44442b..1853b937 100644 --- a/hacks/mountain.c +++ b/hacks/mountain.c @@ -199,12 +199,7 @@ draw_mountain(ModeInfo * mi) drawamountain(mi); break; case 1: -#ifdef STANDALONE - XSync(MI_DISPLAY(mi), False); - usleep(2000000); -#else MI_PAUSE(mi) = 2000000; -#endif /*if (++mp->time > MI_CYCLES(mi)); */ mp->stage++; break; diff --git a/hacks/noseguy.c b/hacks/noseguy.c index a84ee6b6..aa0f1c6c 100644 --- a/hacks/noseguy.c +++ b/hacks/noseguy.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1992, 1996, 1997 +/* xscreensaver, Copyright (c) 1992, 1996, 1997, 1998 * Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its @@ -58,23 +58,23 @@ static void (*next_fn) (void); #ifdef HAVE_XPM # include -# include "noses/nose-f1.xpm" -# include "noses/nose-f2.xpm" -# include "noses/nose-f3.xpm" -# include "noses/nose-f4.xpm" -# include "noses/nose-l1.xpm" -# include "noses/nose-l2.xpm" -# include "noses/nose-r1.xpm" -# include "noses/nose-r2.xpm" +# include "images/noseguy/nose-f1.xpm" +# include "images/noseguy/nose-f2.xpm" +# include "images/noseguy/nose-f3.xpm" +# include "images/noseguy/nose-f4.xpm" +# include "images/noseguy/nose-l1.xpm" +# include "images/noseguy/nose-l2.xpm" +# include "images/noseguy/nose-r1.xpm" +# include "images/noseguy/nose-r2.xpm" #else -# include "noses/nose-f1.xbm" -# include "noses/nose-f2.xbm" -# include "noses/nose-f3.xbm" -# include "noses/nose-f4.xbm" -# include "noses/nose-l1.xbm" -# include "noses/nose-l2.xbm" -# include "noses/nose-r1.xbm" -# include "noses/nose-r2.xbm" +# include "images/noseguy/nose-f1.xbm" +# include "images/noseguy/nose-f2.xbm" +# include "images/noseguy/nose-f3.xbm" +# include "images/noseguy/nose-f4.xbm" +# include "images/noseguy/nose-l1.xbm" +# include "images/noseguy/nose-l2.xbm" +# include "images/noseguy/nose-r1.xbm" +# include "images/noseguy/nose-r2.xbm" #endif static void diff --git a/hacks/noses/nose-f1.xbm b/hacks/noses/nose-f1.xbm deleted file mode 100644 index 543af3e4..00000000 --- a/hacks/noses/nose-f1.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_f1_width 64 -#define nose_f1_height 64 -static unsigned char nose_f1_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, - 0x08,0x00,0xc0,0x1f,0x00,0x20,0x00,0x00,0x08,0x00,0x30,0x60,0x00,0x20,0x00, - 0x00,0xf8,0xff,0x0f,0x80,0xff,0x3f,0x00,0x00,0x00,0x02,0x02,0x00,0x82,0x00, - 0x00,0x00,0x00,0x03,0x01,0x00,0x84,0x01,0x00,0x00,0x00,0x81,0x00,0x00,0x08, - 0x01,0x00,0x00,0x80,0x80,0x00,0x00,0x08,0x02,0x00,0x00,0x80,0x40,0x00,0x00, - 0x10,0x02,0x00,0x00,0x40,0x40,0x00,0x00,0x10,0x04,0x00,0x00,0x40,0x20,0x00, - 0x00,0x20,0x04,0x00,0x00,0x60,0x20,0x00,0x00,0x20,0x0c,0x00,0x00,0x20,0x20, - 0x00,0x00,0x20,0x08,0x00,0x00,0x20,0x20,0x00,0x00,0x20,0x08,0x00,0x00,0x10, - 0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00, - 0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00, - 0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10, - 0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,0x00,0x00,0x30,0x00,0x01,0x00,0x04, - 0x18,0x00,0x00,0x20,0x00,0x02,0x00,0x02,0x08,0x00,0x00,0x20,0x00,0x0c,0x80, - 0x01,0x08,0x00,0x00,0x60,0x00,0x30,0x60,0x00,0x0c,0x00,0x00,0x40,0x00,0xc0, - 0x1f,0x00,0x04,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0xc0,0x0f,0x00,0x00,0x00, - 0x00,0x40,0x10,0x20,0x10,0x00,0x00,0x00,0x00,0x20,0x60,0x30,0x20,0x00,0x00, - 0x00,0x00,0x20,0xc0,0x18,0x20,0x00,0x00,0xc0,0x7f,0x10,0x80,0x0d,0x40,0xe0, - 0x01,0x70,0xc0,0x18,0x00,0x05,0x40,0x1c,0x06,0x10,0x00,0x0f,0x00,0x05,0x80, - 0x07,0x08,0x08,0x00,0x06,0x00,0x05,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x05, - 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80, - 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00, - 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00, - 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84, - 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08, - 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff, - 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-f1.xpm b/hacks/noses/nose-f1.xpm deleted file mode 100644 index a6e03bfb..00000000 --- a/hacks/noses/nose-f1.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_f1_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXX. ", -" .................ooooooooooo............... ", -" .OOOOOOO.ooooooooooooooo.OOOOO. ", -" ..OOOOOO.ooooooooooooooooo.OOOO.. ", -" .OOOOOO.ooooooooooooooooooo.OOOO. ", -" .OOOOOOO.ooooooooooooooooooo.OOOOO. ", -" .OOOOOO.ooooooooooooooooooooo.OOOO. ", -" .OOOOOOO.ooooooooooooooooooooo.OOOOO. ", -" .OOOOOO.ooooooooooooooooooooooo.OOOO. ", -" ..OOOOOO.ooooooooooooooooooooooo.OOOO.. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooooo.OOOOOO. ", -" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOOOO.ooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ", -" .OOOOOOOOOO.ooooooooooooooooooo.OOOOOOOO. ", -" ..OOOOOOOOOO.ooooooooooooooooo.OOOOOOOO.. ", -" .OOOOOOOOOOO.ooooooooooooooo.OOOOOOOOO. ", -" .OOOOOOOOOOOO..ooooooooooo..OOOOOOOOOO. ", -" ..OOOOOOOOOOOOO..ooooooo..OOOOOOOOOOO.. ", -" .OOOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" ................................ ", -" ", -" ..... ...... ", -" .+++++. .++++++. ", -" .+++++++.. ..+++++++. ", -" .++++++++.. ..++++++++. ", -" ......... .++++++++++.. ..++++++++++. .... ", -" ...+++++++.. ..+++++++++++. .+++++++++++. ...++++.. ", -" .+++++++++++....@+++++++++++. .+++++++++++@....++++++++. ", -" .+++++++++++++..@@+++++++++++. .++++++++++@@..++++++++++. ", -" .+++++++++++++++..@++++++++++. .+++++++++@@..++++++++++++. ", -" .+++++++++++++++++..@+++++++++. .++++++++@..++++++++++++++. ", -" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ", -" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ", -" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ", -" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ", -" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.@++. ", -" .+@@.+++++++++++++++++++++++. .+++++++++++++++++++.@@+. ", -" .++@@..+++++++++++++++++++++.. ..+++++++++++++++++..@@++. ", -" .++@@++++++++++++++++++++++@. .@++++++++++++++++++@@++. ", -" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ", -" ........................... ....................... ", -" ", -" "}; diff --git a/hacks/noses/nose-f2.xbm b/hacks/noses/nose-f2.xbm deleted file mode 100644 index 6851b201..00000000 --- a/hacks/noses/nose-f2.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_f2_width 64 -#define nose_f2_height 64 -static unsigned char nose_f2_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, - 0x08,0x00,0xe0,0x0f,0x00,0x20,0x00,0x00,0x08,0x00,0x18,0x30,0x00,0x20,0x00, - 0x00,0xf8,0xff,0x07,0xc0,0xff,0x3f,0x00,0x00,0x00,0x02,0x01,0x00,0x81,0x00, - 0x00,0x00,0x00,0x83,0x00,0x00,0x82,0x01,0x00,0x00,0x00,0x41,0x00,0x00,0x04, - 0x01,0x00,0x00,0x80,0x40,0x00,0x00,0x04,0x02,0x00,0x00,0x80,0x20,0x00,0x00, - 0x08,0x02,0x00,0x00,0x40,0x20,0x00,0x00,0x08,0x04,0x00,0x00,0x40,0x10,0x00, - 0x00,0x10,0x04,0x00,0x00,0x60,0x10,0x00,0x00,0x10,0x0c,0x00,0x00,0x20,0x10, - 0x00,0x00,0x10,0x08,0x00,0x00,0x30,0x10,0x00,0x00,0x10,0x08,0x00,0x00,0x10, - 0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00, - 0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00, - 0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x04,0x10, - 0x00,0x00,0x30,0x40,0x00,0x00,0x04,0x10,0x00,0x00,0x20,0x80,0x00,0x00,0x02, - 0x18,0x00,0x00,0x20,0x00,0x01,0x00,0x01,0x08,0x00,0x00,0x60,0x00,0x06,0xc0, - 0x00,0x08,0x00,0x00,0x80,0x00,0x18,0x30,0x00,0x0c,0x00,0x00,0x80,0x00,0xe0, - 0x0f,0x00,0x04,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00, - 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xe0,0x00,0x07,0x02,0x10,0x00,0x00, - 0x00,0x30,0x00,0x8c,0x01,0x20,0x00,0x00,0x00,0x0c,0x00,0x90,0x00,0x20,0x00, - 0x00,0x00,0x04,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20, - 0x00,0x00,0x00,0x42,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x02, - 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x06,0x20,0x00,0x00,0x00,0x21,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x03,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00, - 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-f2.xpm b/hacks/noses/nose-f2.xpm deleted file mode 100644 index 3763b58d..00000000 --- a/hacks/noses/nose-f2.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_f2_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ", -" ................ooooooooooo................ ", -" .OOOOOO.ooooooooooooooo.OOOOOO. ", -" ..OOOOO.ooooooooooooooooo.OOOOO.. ", -" .OOOOO.ooooooooooooooooooo.OOOOO. ", -" .OOOOOO.ooooooooooooooooooo.OOOOOO. ", -" .OOOOO.ooooooooooooooooooooo.OOOOO. ", -" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ", -" .OOOOO.ooooooooooooooooooooooo.OOOOO. ", -" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ", -" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ", -" ..OOOOOO.ooooooooooooooooooooooo.OOOOOO. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", -" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ", -" ..OOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ", -" .OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO.. ", -" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ", -" ..OOOOOOOOOO..ooooooooooo..OOOOOOOOOOO. ", -" .OOOOOOOOOOO..ooooooo..OOOOOOOOOOOO.. ", -" .OOOOOOOOOOOOO.......OOOOOOOOOOOOOO. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" ................................ ", -" ", -" ......... ", -" ........ .+++++++++. ", -" ...++++++++... .++++++++++. ", -" ..++++++++++++.. ..++++++++++++. ", -" ..++++++++++++++++. .@++++++++++++. ", -" .++++@..+++++++++++..@@++++++++++++. ", -" .++++..++++++++++++++..@++++++++++++. ", -" .+++@.+++++++++++++++++.@+++++++++++. ", -" .+++@.+++++++++++++++++++.@++++++++++. ", -" .+++@.+++++++++++++++++++..++++++++++. ", -" .+++@.+++++++++++++++++++++++++++++++. ", -" .++++++++++++++++++++++++++++++++++++@. ", -" ..@++++++++++++++++++++++++++++++++++@. ", -" .@@+++++++++++++++++++++++++++++++++@. ", -" .@@++++++++++++++++++++++++++++++++@@. ", -" .@@@++++++++++++++++++++++++++++++@. ", -" ..@@@++++++++++++++++++++@@@++++@@. ", -" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ", -" .............................. ", -" ", -" ", -" "}; diff --git a/hacks/noses/nose-f3.xbm b/hacks/noses/nose-f3.xbm deleted file mode 100644 index e70f2293..00000000 --- a/hacks/noses/nose-f3.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_f3_width 64 -#define nose_f3_height 64 -static unsigned char nose_f3_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, - 0x04,0x00,0xf0,0x07,0x00,0x10,0x00,0x00,0x04,0x00,0x0c,0x18,0x00,0x10,0x00, - 0x00,0xfc,0xff,0x03,0xe0,0xff,0x1f,0x00,0x00,0x00,0x81,0x00,0x80,0x40,0x00, - 0x00,0x00,0x80,0x41,0x00,0x00,0xc1,0x00,0x00,0x00,0x80,0x20,0x00,0x00,0x82, - 0x00,0x00,0x00,0x40,0x20,0x00,0x00,0x02,0x01,0x00,0x00,0x40,0x10,0x00,0x00, - 0x04,0x01,0x00,0x00,0x20,0x10,0x00,0x00,0x04,0x02,0x00,0x00,0x20,0x08,0x00, - 0x00,0x08,0x02,0x00,0x00,0x30,0x08,0x00,0x00,0x08,0x06,0x00,0x00,0x10,0x08, - 0x00,0x00,0x08,0x04,0x00,0x00,0x10,0x08,0x00,0x00,0x08,0x0c,0x00,0x00,0x08, - 0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00, - 0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00, - 0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x08, - 0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x0c,0x00,0x00,0x18,0x40,0x00,0x00,0x01, - 0x04,0x00,0x00,0x10,0x80,0x00,0x80,0x00,0x04,0x00,0x00,0x10,0x00,0x03,0x60, - 0x00,0x06,0x00,0x00,0x30,0x00,0x0c,0x18,0x00,0x01,0x00,0x00,0x20,0x00,0xf0, - 0x07,0x00,0x01,0x00,0x00,0x60,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x40,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0x40,0xe0,0x00,0x07,0x00, - 0x00,0x00,0x04,0x80,0x31,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x09,0x00,0x30, - 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x20,0x00,0x00,0x00,0x04,0x00,0x03,0x00, - 0x43,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x42,0x00,0x00,0x00,0x04,0x40,0x00, - 0x00,0x84,0x00,0x00,0x00,0x04,0x60,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00, - 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0xc0,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00, - 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-f3.xpm b/hacks/noses/nose-f3.xpm deleted file mode 100644 index c60c5f37..00000000 --- a/hacks/noses/nose-f3.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_f3_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXX.......XXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXX..ooooooo..XXXXXXXXXXXXXXX. ", -" ................ooooooooooo................ ", -" .OOOOOO.ooooooooooooooo.OOOOOO. ", -" ..OOOOO.ooooooooooooooooo.OOOOO.. ", -" .OOOOO.ooooooooooooooooooo.OOOOO. ", -" .OOOOOO.ooooooooooooooooooo.OOOOOO. ", -" .OOOOO.ooooooooooooooooooooo.OOOOO. ", -" .OOOOOO.ooooooooooooooooooooo.OOOOOO. ", -" .OOOOO.ooooooooooooooooooooooo.OOOOO. ", -" ..OOOOO.ooooooooooooooooooooooo.OOOOO.. ", -" .OOOOOO.ooooooooooooooooooooooo.OOOOOO. ", -" .OOOOOO.ooooooooooooooooooooooo.OOOOOO.. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOO.ooooooooooooooooooooooo.OOOOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", -" .OOOOOOOO.ooooooooooooooooooooo.OOOOOOOO. ", -" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOOO. ", -" .OOOOOOOOO.ooooooooooooooooooo.OOOOOOOO.. ", -" ..OOOOOOOOO.ooooooooooooooooo.OOOOOOOOO. ", -" .OOOOOOOOOO.ooooooooooooooo.OOOOOOOOOO. ", -" .OOOOOOOOOOO..ooooooooooo..OOOOOOOOOO.. ", -" ..OOOOOOOOOOOO..ooooooo..OOOOOOOOOOO. ", -" .OOOOOOOOOOOOOO.......OOOOOOOOOOOOO. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" ................................ ", -" ", -" ......... ", -" .+++++++++. ........ ", -" .++++++++++. ...++++++++... ", -" .++++++++++++.. ..++++++++++++.. ", -" .++++++++++++@. .++++++++++++++++.. ", -" .++++++++++++@@..+++++++++++..@++++. ", -" .++++++++++++@..++++++++++++++..++++. ", -" .+++++++++++@.+++++++++++++++++.@+++. ", -" .++++++++++@.+++++++++++++++++++.@+++. ", -" .++++++++++..+++++++++++++++++++.@+++. ", -" .+++++++++++++++++++++++++++++++.@+++. ", -" .@++++++++++++++++++++++++++++++++++++. ", -" .@++++++++++++++++++++++++++++++++++@.. ", -" .@+++++++++++++++++++++++++++++++++@@. ", -" .@@++++++++++++++++++++++++++++++++@@. ", -" .@++++++++++++++++++++++++++++++@@@. ", -" .@@++++@@@++++++++++++++++++++@@@.. ", -" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ", -" .............................. ", -" ", -" ", -" "}; diff --git a/hacks/noses/nose-f4.xbm b/hacks/noses/nose-f4.xbm deleted file mode 100644 index 024eead8..00000000 --- a/hacks/noses/nose-f4.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_f4_width 64 -#define nose_f4_height 64 -static unsigned char nose_f4_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x1e,0x00, - 0x00,0x00,0x00,0x38,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00, - 0x03,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x04,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x08,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x10,0x00,0x80, - 0x1f,0x00,0x40,0x00,0x00,0x08,0x00,0x60,0x60,0x00,0x80,0x00,0x00,0x08,0x00, - 0x10,0x80,0x00,0x80,0x00,0x00,0x04,0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x04, - 0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x02,0x00,0x18,0x80,0x01,0x00,0x02,0x00, - 0x02,0x00,0x68,0x60,0x01,0x00,0x02,0x00,0x02,0x00,0x88,0x1f,0x01,0x00,0x02, - 0x00,0x02,0x00,0x08,0x00,0x01,0x00,0x02,0x00,0x02,0x00,0x10,0x80,0x00,0x00, - 0x03,0x00,0x06,0x00,0x60,0x60,0x00,0x80,0x02,0x00,0x0c,0x00,0x80,0x1f,0x00, - 0x40,0x01,0x00,0x14,0x00,0x00,0x00,0x00,0x20,0x01,0x00,0x28,0x00,0x00,0x00, - 0x00,0x90,0x00,0x00,0x50,0x00,0x00,0x00,0x00,0x48,0x00,0x00,0xa0,0x01,0x00, - 0x00,0x00,0x26,0x00,0x00,0x40,0x1e,0x00,0x00,0xc0,0x11,0x00,0x00,0x80,0xe1, - 0x03,0x00,0x3c,0x0c,0x00,0x00,0x00,0x0e,0xfc,0xff,0x83,0x03,0x00,0x00,0x00, - 0xf0,0x01,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00, - 0x00,0x80,0x03,0x00,0x0c,0x00,0x00,0x00,0x00,0x80,0x02,0x00,0x14,0x00,0x00, - 0x00,0x00,0x60,0x04,0x00,0x12,0x00,0x00,0xc0,0x7f,0x10,0x04,0x00,0x22,0xe0, - 0x01,0x70,0xc0,0x18,0x08,0x00,0x61,0x1c,0x06,0x10,0x00,0x0f,0x30,0xc0,0x80, - 0x07,0x08,0x08,0x00,0x06,0xc0,0x3f,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x02, - 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80, - 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00, - 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00, - 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84, - 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08, - 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff, - 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-f4.xpm b/hacks/noses/nose-f4.xpm deleted file mode 100644 index faa52e03..00000000 --- a/hacks/noses/nose-f4.xpm +++ /dev/null @@ -1,73 +0,0 @@ -/* XPM */ -static char * nose_f4_xpm[] = { -"64 64 6 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ", -" ............... ", -" ....XXXXXXXXXXXXXXX.... ", -" ...XXXXXXXXXXXXXXXXXXXXXXX... ", -" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ", -" ..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. ", -" .XXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXX..XXXXXXXXXX..XXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXX.X..XXXXXX..X.XXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXX.XXX......XXX.XXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXX.XXXXXXXXXXXX.XXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXX.XXXXXXXXXX.XXXXXXXXXXXXXXXX.. ", -" ..XXXXXXXXXXXXXXXXXX..XXXXXX..XXXXXXXXXXXXXXXX. . ", -" ..XXXXXXXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX.X. ", -" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ", -" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ", -" .X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX. ", -" .X..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX..XX. ", -" .XX....XXXXXXXXXXXXXXXXXXXXXXXXX...XXX. ", -" ..XXXX.....XXXXXXXXXXXXXXXX....XXXX.. ", -" ...XXXXXX................XXXXX... ", -" .....XXXXXXXXXXXXXXXXXX.... ", -" ................... ", -" ...oooooooooooooooo.. ", -" .+.oooooooooooooooo.+. ", -" ..+++.oooooooooooooo.++. ", -" ......... .+++++.oooooooooooooo.+++. .... ", -" ...+++++++.. ..++++++.oooooooooooo.++++.. ...++++.. ", -" .+++++++++++....@+++++++..oooooooo..++++++@....++++++++. ", -" .+++++++++++++..@@+++++++++........+++++++@@..++++++++++. ", -" .+++++++++++++++..@+++++++++++.++++++++++@@..++++++++++++. ", -" .+++++++++++++++++..++++++++++. .+++++++++..++++++++++++++. ", -" .++++++++++++++++++++++++++++. .+++++++..++++++++++++++++. ", -" .++++++++++++++++++++++++++++. .+++++++++++++++++++++++++. ", -" .+++++++++++++++++++++++++++. .++++++++++++++++++++++++. ", -" .+@.++++++++++++++++++++++++. .++++++++++++++++++++.+++. ", -" .++.++++++++++++++++++++++++. .++++++++++++++++++++.@+@. ", -" .@+@.+++++++++++++++++++++++. .+++++++++++++++++++.@+@. ", -" .@@+@..++++++++++++++++++++@.. ..@++++++++++++++++..@++@. ", -" .@@+++++++++++++++++++++++@@. .@@+++++++++++++++++++@@. ", -" ..@@@@@@@@@@@@@@@@@@@@@@@@@. .@@@@@@@@@@@@@@@@@@@@@@. ", -" ........................... ....................... ", -" ", -" "}; diff --git a/hacks/noses/nose-l1.xbm b/hacks/noses/nose-l1.xbm deleted file mode 100644 index e3cb7030..00000000 --- a/hacks/noses/nose-l1.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_l1_width 64 -#define nose_l1_height 64 -static unsigned char nose_l1_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00, - 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00, - 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00, - 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00, - 0x18,0x00,0x20,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x40,0x00,0x80,0x00,0x00, - 0x00,0x08,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x00,0x01,0x20,0x00, - 0x00,0x00,0x04,0x00,0x00,0x06,0x18,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x07, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00, - 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xc0,0x00,0x03,0x03,0x10,0x00,0x00, - 0x00,0x30,0x00,0x0c,0x01,0x20,0x00,0x00,0x00,0x08,0x00,0x98,0x00,0x20,0x00, - 0x00,0x00,0x0c,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20, - 0x00,0x00,0x00,0x42,0x00,0x80,0x00,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01, - 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x01,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00, - 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-l1.xpm b/hacks/noses/nose-l1.xpm deleted file mode 100644 index 205d18be..00000000 --- a/hacks/noses/nose-l1.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_l1_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .............................. ", -" ", -" ......... ", -" ........ .+++++++++. ", -" ...++++++++... .++++++++++. ", -" ..++++++++++++.. ..++++++++++++. ", -" ..++++++++++++++++. .@++++++++++++. ", -" .++++@..+++++++++++..@@++++++++++++. ", -" .++++..++++++++++++++..@++++++++++++. ", -" .+++@.+++++++++++++++++.@+++++++++++. ", -" .+++@.+++++++++++++++++++.@++++++++++. ", -" .+++@.+++++++++++++++++++..++++++++++. ", -" .+++@.+++++++++++++++++++++++++++++++. ", -" .++++++++++++++++++++++++++++++++++++@. ", -" ..@++++++++++++++++++++++++++++++++++@. ", -" .@@+++++++++++++++++++++++++++++++++@. ", -" .@@++++++++++++++++++++++++++++++++@@. ", -" .@@@++++++++++++++++++++++++++++++@. ", -" ..@@@++++++++++++++++++++@@@++++@@. ", -" ...@@@@@@@@@@@@@@@@@@@@@@@@@@@@@. ", -" .............................. ", -" ", -" ", -" "}; diff --git a/hacks/noses/nose-l2.xbm b/hacks/noses/nose-l2.xbm deleted file mode 100644 index fa39343b..00000000 --- a/hacks/noses/nose-l2.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_l2_width 64 -#define nose_l2_height 64 -static unsigned char nose_l2_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00, - 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00, - 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00, - 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00, - 0x18,0x00,0x10,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x20,0x00,0x80,0x00,0x00, - 0x00,0x08,0x00,0x40,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x80,0x00,0x20,0x00, - 0x00,0x00,0xe4,0x00,0x00,0x03,0x18,0x00,0x00,0x00,0x26,0x03,0x00,0xfc,0x07, - 0x00,0x00,0x00,0x12,0x0c,0x00,0x00,0xf8,0xff,0xff,0xff,0x11,0x10,0x80,0x1f, - 0x00,0x00,0x00,0x00,0x08,0x20,0x60,0x60,0xc0,0x07,0x00,0x00,0x04,0x40,0x10, - 0xc0,0x20,0x08,0x00,0x1f,0x02,0x40,0x08,0x00,0x21,0x10,0xc0,0x60,0x02,0x40, - 0x04,0x00,0x12,0x20,0x20,0x80,0x02,0x20,0xc2,0x00,0x14,0x40,0x18,0x00,0x03, - 0x20,0x22,0x00,0x0c,0x80,0x04,0x03,0x02,0x10,0x12,0x00,0x08,0x80,0x86,0x00, - 0x04,0x10,0x12,0x00,0x10,0x80,0x42,0x00,0x18,0x08,0x12,0x00,0x10,0x40,0x42, - 0x00,0x00,0x04,0x02,0x00,0x20,0x40,0x42,0x00,0x00,0x04,0x02,0x00,0x00,0x20, - 0x42,0x00,0x00,0x02,0x04,0x00,0x00,0x20,0x02,0x00,0x00,0x01,0x04,0x00,0x00, - 0x20,0x02,0x00,0x00,0x01,0x08,0x00,0x00,0x20,0x04,0x00,0x80,0x00,0x10,0x00, - 0x00,0x20,0x0c,0x00,0x80,0x00,0x60,0x00,0x00,0x10,0x08,0x00,0x40,0x00,0x80, - 0xff,0xff,0x0f,0x30,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x0f,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-l2.xpm b/hacks/noses/nose-l2.xpm deleted file mode 100644 index f08a72eb..00000000 --- a/hacks/noses/nose-l2.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_l2_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" ......OOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" ...ooOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" ..oooOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOO..OOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .ooooOOOOOOOOOOOOOOo.OOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .ooooOOOOOOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooooooOOOOOoooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO. ", -" .oooooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOO.. ", -" .oooooooooooo.OOOOOOOOOOOOOOOOOOOOOOOOOOOO. ... ", -" ..oooooooo..OOOOOOOOOOOOOOOOOOOOOOOOOOOO.. .++.. ", -" ........OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO. .+++++.. ", -" .............................. .+++++++. ", -" ...... .+++++++++. ", -" ..++++++.. ..... .++++++++++@. ", -" .+++++++++.. .+++++. ..... .+++++++++++@. ", -" .++++++++++++. .++++++. ..+++++.. .++++++++++@@. ", -" .++++++++++++++. .++++++++. .+++++++++. .@+++++++++@. ", -" .++++..++++++++++. .+++++++++. ..+++++++++++..@++++++++@@. ", -" .+++.@@++++++++++..@++++++++++. .+++++..+++++++.@@+++++++@. ", -" .++.@+++++++++++++.@@+++++++++. ..++++.@@++++++++.@@+++++@@. ", -" .++.@++++++++++++++.@+++++++++. .++++.@+++++++++++..++++@@. ", -" .++.@++++++++++++++.@++++++++. .++++.@+++++++++++++++++@. ", -" .@++++++++++++++++++.@+++++++. .++++.@++++++++++++++++@@. ", -" .@@+++++++++++++++++++++++++. .++++.@+++++++++++++++@@. ", -" .@++++++++++++++++++++++++@. .+++++++++++++++++++++@. ", -" .@@+++++++++++++++++++++++@. .++++++++++++++++++++@@. ", -" .@@++++++++++++++++++++++@. .+++++++++++++++++++@. ", -" .@@@+++++++++++++++++++@@. ..+++++++++++++++++@@. ", -" ..@@@@@@@@@@@@@@@@@@@@@. .@@@+++@@@++++++@@@. ", -" ..................... ..@@@@@@@@@@@@@@.. ", -" .............. ", -" ", -" ", -" ", -" "}; diff --git a/hacks/noses/nose-r1.xbm b/hacks/noses/nose-r1.xbm deleted file mode 100644 index 72df86c2..00000000 --- a/hacks/noses/nose-r1.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_r1_width 64 -#define nose_r1_height 64 -static unsigned char nose_r1_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, - 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f, - 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c, - 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00, - 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x18,0x00,0x00,0x80,0x00, - 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00, - 0x01,0x00,0x02,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x20,0x00,0x00, - 0x00,0x04,0x80,0x00,0x00,0x60,0x00,0x00,0x00,0x18,0x60,0x00,0x00,0x40,0x00, - 0x00,0x00,0xe0,0x1f,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0xc0,0xc0,0x00,0x03,0x00, - 0x00,0x00,0x04,0x80,0x30,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x19,0x00,0x10, - 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x30,0x00,0x00,0x00,0x04,0x00,0x03,0x00, - 0x43,0x00,0x00,0x00,0x04,0x00,0x01,0x00,0x42,0x00,0x00,0x00,0x04,0x80,0x00, - 0x00,0x84,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00, - 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00, - 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-r1.xpm b/hacks/noses/nose-r1.xpm deleted file mode 100644 index 901dd428..00000000 --- a/hacks/noses/nose-r1.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_r1_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ", -" .............................. ", -" ", -" ......... ", -" .+++++++++. ........ ", -" .++++++++++. ...++++++++... ", -" .++++++++++++.. ..++++++++++++.. ", -" .++++++++++++@. .++++++++++++++++.. ", -" .++++++++++++@@..+++++++++++..@++++. ", -" .++++++++++++@..++++++++++++++..++++. ", -" .+++++++++++@.+++++++++++++++++.@+++. ", -" .++++++++++@.+++++++++++++++++++.@+++. ", -" .++++++++++..+++++++++++++++++++.@+++. ", -" .+++++++++++++++++++++++++++++++.@+++. ", -" .@++++++++++++++++++++++++++++++++++++. ", -" .@++++++++++++++++++++++++++++++++++@.. ", -" .@+++++++++++++++++++++++++++++++++@@. ", -" .@@++++++++++++++++++++++++++++++++@@. ", -" .@++++++++++++++++++++++++++++++@@@. ", -" .@@++++@@@++++++++++++++++++++@@@.. ", -" .@@@@@@@@@@@@@@@@@@@@@@@@@@@@@... ", -" .............................. ", -" ", -" ", -" "}; diff --git a/hacks/noses/nose-r2.xbm b/hacks/noses/nose-r2.xbm deleted file mode 100644 index eb750ca7..00000000 --- a/hacks/noses/nose-r2.xbm +++ /dev/null @@ -1,38 +0,0 @@ -#define nose_r2_width 64 -#define nose_r2_height 64 -static unsigned char nose_r2_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00, - 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f, - 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c, - 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00, - 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x18,0x00,0x00,0x80,0x00, - 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x08,0x00,0x10,0x00,0x00,0x00, - 0x01,0x00,0x04,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x02,0x00,0x27,0x00,0x00, - 0x00,0x04,0x00,0x01,0xc0,0x64,0x00,0x00,0x00,0x18,0xc0,0x00,0x30,0x48,0x00, - 0x00,0x00,0xe0,0x3f,0x00,0x08,0x88,0xff,0xff,0xff,0x1f,0x00,0x00,0x04,0x10, - 0x00,0x00,0x00,0x00,0xf8,0x01,0x02,0x20,0x00,0x00,0xe0,0x03,0x06,0x06,0x02, - 0x40,0xf8,0x00,0x10,0x04,0x03,0x08,0x02,0x40,0x06,0x03,0x08,0x84,0x00,0x10, - 0x04,0x40,0x01,0x04,0x04,0x48,0x00,0x20,0x04,0xc0,0x00,0x18,0x02,0x28,0x00, - 0x43,0x08,0x40,0xc0,0x20,0x01,0x30,0x00,0x44,0x08,0x20,0x00,0x61,0x01,0x10, - 0x00,0x48,0x10,0x18,0x00,0x42,0x01,0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02, - 0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,0x04,0x00,0x40,0x40,0x00,0x00,0x42, - 0x04,0x00,0x00,0x40,0x80,0x00,0x00,0x40,0x04,0x00,0x00,0x20,0x80,0x00,0x00, - 0x40,0x04,0x00,0x00,0x20,0x00,0x01,0x00,0x20,0x04,0x00,0x00,0x10,0x00,0x01, - 0x00,0x30,0x04,0x00,0x00,0x08,0x00,0x02,0x00,0x10,0x08,0x00,0x00,0x06,0x00, - 0x0c,0x00,0x0c,0xf0,0xff,0xff,0x01,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00}; diff --git a/hacks/noses/nose-r2.xpm b/hacks/noses/nose-r2.xpm deleted file mode 100644 index ddf0edaf..00000000 --- a/hacks/noses/nose-r2.xpm +++ /dev/null @@ -1,74 +0,0 @@ -/* XPM */ -static char * nose_r2_xpm[] = { -"64 64 7 1", -" c black m black", -". c black m white", -"X c gray m black", -"o c yellow m black", -"O c yellow2 m black", -"+ c purple m black", -"@ c purple3 m black", -" ", -" ", -" ", -" ", -" ", -" ", -" ..................... ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" .XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. ", -" ........................................... ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOO...... ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOoo... ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOooo.. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOO..OOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO.OOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOoo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOO.oOOOOOOOOOOOOOOoooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOOOOOOoooo. ", -" .OOOOOOOOOOOOOOOOOOOOOOOOOOO.ooooOOOOOooooooo. ", -" ..OOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooooo. ", -" ... .OOOOOOOOOOOOOOOOOOOOOOOOOOOO.oooooooooooo. ", -" ..++. ..OOOOOOOOOOOOOOOOOOOOOOOOOOOO..oooooooo.. ", -" ..+++++. .OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO........ ", -" .+++++++. .............................. ", -" .+++++++++. ...... ", -" .@++++++++++. ..... ..++++++.. ", -" .@+++++++++++. ..... .+++++. ..+++++++++. ", -" .@@++++++++++. ..+++++.. .++++++. .++++++++++++. ", -" .@+++++++++@. .+++++++++. .++++++++. .++++++++++++++. ", -" .@@++++++++@..+++++++++++.. .+++++++++. .++++++++++..++++. ", -" .@+++++++@@.+++++++..+++++. .++++++++++@..++++++++++@@.+++. ", -" .@@+++++@@.++++++++@@.++++.. .+++++++++@@.+++++++++++++@.++. ", -" .@@++++..+++++++++++@.++++. .+++++++++@.++++++++++++++@.++. ", -" .@+++++++++++++++++@.++++. .++++++++@.++++++++++++++@.++. ", -" .@@++++++++++++++++@.++++. .+++++++@.++++++++++++++++++@. ", -" .@@+++++++++++++++@.++++. .+++++++++++++++++++++++++@@. ", -" .@+++++++++++++++++++++. .@++++++++++++++++++++++++@. ", -" .@@++++++++++++++++++++. .@+++++++++++++++++++++++@@. ", -" .@+++++++++++++++++++. .@++++++++++++++++++++++@@. ", -" .@@+++++++++++++++++.. .@@+++++++++++++++++++@@@. ", -" .@@@++++++@@@+++@@@. .@@@@@@@@@@@@@@@@@@@@@.. ", -" ..@@@@@@@@@@@@@@.. ..................... ", -" .............. ", -" ", -" ", -" ", -" "}; diff --git a/hacks/pieces/puzzle.xbm b/hacks/pieces/puzzle.xbm deleted file mode 100644 index b09d6688..00000000 --- a/hacks/pieces/puzzle.xbm +++ /dev/null @@ -1,1614 +0,0 @@ -#define puzzle_width 523 -#define puzzle_height 366 -static char puzzle_bits[] = { - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00, - 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x0c,0x00,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, - 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1c,0x00,0x00, - 0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0xe0,0x00,0x00,0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0xc0,0x07, - 0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x0e,0x00,0x00, - 0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c, - 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0xc0,0x01,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0xc0,0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c, - 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x0c,0x00,0x00, - 0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xc0,0x00,0x00,0x00,0x00, - 0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x60, - 0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30, - 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff, - 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0xf8, - 0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x80,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0xf8, - 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x00,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x02,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0xf8,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x40,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8, - 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x10,0xf8,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x80,0xf8,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9, - 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf9,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa, - 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xfa,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfc, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xfc,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa,0x02,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfa, - 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xfa,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf9,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf9,0x08,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0xf8,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0xf8,0x10,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0xf8,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0xf8,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0xf8, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0xf8,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0xf8,0x40,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x10,0xf8,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8,0x80,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0xf8, - 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0xf8,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0xf8,0x00,0x02,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x02,0xf8,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0xf8,0x00,0x08,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0xf8, - 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0xf8,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0xf8,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0xf8,0x00,0x80,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0xf8, - 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x04,0x00,0xf8,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0xf8,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x00,0x00,0xf8,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xff,0xff, - 0x1f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0xf8,0x00,0x00,0x60,0x00,0x00,0x00, - 0x00,0x00,0x00,0xc0,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x18,0x00,0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0xf8, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0xf8,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x00, - 0x18,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0xc0,0x00,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x0c,0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x00,0x80,0x01, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x0c, - 0x00,0x00,0x00,0x00,0x60,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0xc0,0x00,0x00, - 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x01,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x07,0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0xc0,0x01,0x00,0x00, - 0x00,0x07,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x38,0x00,0x00,0x80,0x03, - 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x00,0x0e,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0xc0,0x07,0x00,0x7c,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0xf0,0x01,0x00,0x1f,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0x03,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0xfe,0xff,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0xe0,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x1f,0x00,0xf0,0x01,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xe0,0x00,0x00, - 0x00,0x0e,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x1c,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x03,0x00,0x00,0x00,0x80,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xc0, - 0x00,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x00,0x00, - 0x00,0x00,0x60,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80, - 0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x01,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x01,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x78,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x00,0x00,0x01, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x04,0x00,0x00, - 0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00, - 0x00,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00, - 0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00, - 0x00,0x20,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x20,0x00,0x00,0x00,0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x80,0x07,0x00,0x00,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x00,0x0f,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x78,0x00,0x00,0x00,0x08,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x00,0x00, - 0x00,0xf0,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x80,0x07,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x01,0x00,0x00,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0xff,0xff,0x03,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0xff,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00, - 0x00,0x00,0x00,0x00,0x00,0xf8}; diff --git a/hacks/pieces/puzzle_a_e_f.xbm b/hacks/pieces/puzzle_a_e_f.xbm deleted file mode 100644 index 69601290..00000000 --- a/hacks/pieces/puzzle_a_e_f.xbm +++ /dev/null @@ -1,77 +0,0 @@ -#define puzzle_a_e_f_width 88 -#define puzzle_a_e_f_height 78 -#define puzzle_a_e_f_x_hot 20 -#define puzzle_a_e_f_y_hot 6 -static unsigned char puzzle_a_e_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, - 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff, - 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, - 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, - 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7e, 0x80, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x00, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, - 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, - 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, - 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_e_h.xbm b/hacks/pieces/puzzle_a_e_h.xbm deleted file mode 100644 index a0de0dd8..00000000 --- a/hacks/pieces/puzzle_a_e_h.xbm +++ /dev/null @@ -1,77 +0,0 @@ -#define puzzle_a_e_h_width 88 -#define puzzle_a_e_h_height 78 -#define puzzle_a_e_h_x_hot 20 -#define puzzle_a_e_h_y_hot 6 -static unsigned char puzzle_a_e_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00, - 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, - 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, - 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, - 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, - 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00, - 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, - 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, - 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, - 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x07, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7e, 0x80, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, - 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, - 0x00, 0x70, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, - 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, 0x01, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, - 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, - 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, - 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, - 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, - 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_f.xbm b/hacks/pieces/puzzle_a_f.xbm deleted file mode 100644 index 10e92431..00000000 --- a/hacks/pieces/puzzle_a_f.xbm +++ /dev/null @@ -1,96 +0,0 @@ -#define puzzle_a_f_width 108 -#define puzzle_a_f_height 78 -#define puzzle_a_f_x_hot 20 -#define puzzle_a_f_y_hot 5 -static unsigned char puzzle_a_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, - 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, - 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, - 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00, 0xc0, 0xff, - 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, - 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, - 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, - 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, - 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_h.xbm b/hacks/pieces/puzzle_a_h.xbm deleted file mode 100644 index dc9cc6d1..00000000 --- a/hacks/pieces/puzzle_a_h.xbm +++ /dev/null @@ -1,96 +0,0 @@ -#define puzzle_a_h_width 108 -#define puzzle_a_h_height 78 -#define puzzle_a_h_x_hot 20 -#define puzzle_a_h_y_hot 5 -static unsigned char puzzle_a_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, - 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, - 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, - 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, - 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, - 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, - 0xf0, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x80, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00, 0xc0, 0xff, - 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, 0x3f, 0x00, - 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, - 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x3e, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00, 0xe0, 0x80, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, 0x70, 0x00, - 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8, - 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x00, - 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, - 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, - 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, - 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, - 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, - 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_n_f.xbm b/hacks/pieces/puzzle_a_n_f.xbm deleted file mode 100644 index 989fefb8..00000000 --- a/hacks/pieces/puzzle_a_n_f.xbm +++ /dev/null @@ -1,91 +0,0 @@ -#define puzzle_a_n_f_width 108 -#define puzzle_a_n_f_height 73 -#define puzzle_a_n_f_x_hot 21 -#define puzzle_a_n_f_y_hot 1 -static unsigned char puzzle_a_n_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7e, - 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x07, 0x00, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, - 0x3f, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, - 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, - 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x80, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, - 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_n_h.xbm b/hacks/pieces/puzzle_a_n_h.xbm deleted file mode 100644 index 3c6ef130..00000000 --- a/hacks/pieces/puzzle_a_n_h.xbm +++ /dev/null @@ -1,91 +0,0 @@ -#define puzzle_a_n_h_width 108 -#define puzzle_a_n_h_height 73 -#define puzzle_a_n_h_x_hot 21 -#define puzzle_a_n_h_y_hot 1 -static unsigned char puzzle_a_n_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x7e, - 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1c, 0xe0, 0x07, 0x00, - 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, - 0x3f, 0x00, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf0, 0x3f, 0x78, 0x00, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x1c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, - 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x07, 0xe0, 0x00, - 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, - 0x70, 0x00, 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, - 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, - 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, - 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x80, - 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, - 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_ne_f.xbm b/hacks/pieces/puzzle_a_ne_f.xbm deleted file mode 100644 index 5ed25170..00000000 --- a/hacks/pieces/puzzle_a_ne_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_a_ne_f_width 89 -#define puzzle_a_ne_f_height 74 -#define puzzle_a_ne_f_x_hot 21 -#define puzzle_a_ne_f_y_hot 1 -static unsigned char puzzle_a_ne_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x7f, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xc0, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0x1f, 0x00, 0x00, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xfe, 0x7f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_ne_h.xbm b/hacks/pieces/puzzle_a_ne_h.xbm deleted file mode 100644 index 6b0b3532..00000000 --- a/hacks/pieces/puzzle_a_ne_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_a_ne_h_width 89 -#define puzzle_a_ne_h_height 74 -#define puzzle_a_ne_h_x_hot 21 -#define puzzle_a_ne_h_y_hot 1 -static unsigned char puzzle_a_ne_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0xc0, 0xff, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x7f, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x0f, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x3e, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x78, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0xe0, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0x80, 0x03, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x80, 0x01, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0xc0, 0x00, 0x00, 0xf8, 0x00, - 0x00, 0x00, 0xc0, 0x3f, 0x00, 0x30, 0x00, 0x80, 0x01, 0x80, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0x03, 0x18, 0x00, 0x00, 0x03, 0xf8, 0x07, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0x86, 0x7f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x78, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_nw_f.xbm b/hacks/pieces/puzzle_a_nw_f.xbm deleted file mode 100644 index 9af2ee06..00000000 --- a/hacks/pieces/puzzle_a_nw_f.xbm +++ /dev/null @@ -1,73 +0,0 @@ -#define puzzle_a_nw_f_width 88 -#define puzzle_a_nw_f_height 74 -#define puzzle_a_nw_f_x_hot 1 -#define puzzle_a_nw_f_y_hot 1 -static unsigned char puzzle_a_nw_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, - 0x00, 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, - 0xfc, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, - 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, - 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, - 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, - 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, - 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, - 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, - 0xff, 0x07, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, - 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_nw_h.xbm b/hacks/pieces/puzzle_a_nw_h.xbm deleted file mode 100644 index 20cf8604..00000000 --- a/hacks/pieces/puzzle_a_nw_h.xbm +++ /dev/null @@ -1,73 +0,0 @@ -#define puzzle_a_nw_h_width 88 -#define puzzle_a_nw_h_height 74 -#define puzzle_a_nw_h_x_hot 1 -#define puzzle_a_nw_h_y_hot 1 -static unsigned char puzzle_a_nw_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, - 0x00, 0x0c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, - 0x1c, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, - 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, - 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, - 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, - 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, - 0xc0, 0x07, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc, - 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_s_f.xbm b/hacks/pieces/puzzle_a_s_f.xbm deleted file mode 100644 index 687750f0..00000000 --- a/hacks/pieces/puzzle_a_s_f.xbm +++ /dev/null @@ -1,91 +0,0 @@ -#define puzzle_a_s_f_width 108 -#define puzzle_a_s_f_height 73 -#define puzzle_a_s_f_x_hot 20 -#define puzzle_a_s_f_y_hot 5 -static unsigned char puzzle_a_s_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, - 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0x0f, - 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0x1f, - 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x0f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, - 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0xc0, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xe0, 0x0f, 0x00, 0xc0, 0xff, - 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, 0x3f, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x00, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xf8, - 0x3f, 0x00, 0x00, 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x1f, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_s_h.xbm b/hacks/pieces/puzzle_a_s_h.xbm deleted file mode 100644 index 78c0d3ea..00000000 --- a/hacks/pieces/puzzle_a_s_h.xbm +++ /dev/null @@ -1,91 +0,0 @@ -#define puzzle_a_s_h_width 108 -#define puzzle_a_s_h_height 73 -#define puzzle_a_s_h_x_hot 20 -#define puzzle_a_s_h_y_hot 5 -static unsigned char puzzle_a_s_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, - 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x0c, - 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x3f, 0x00, 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, - 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, - 0x01, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, - 0x00, 0xc0, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, - 0xf0, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x7f, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0xe0, 0x0f, 0x00, 0xc0, 0xff, - 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0xf8, 0x3f, 0x00, - 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x1f, - 0x70, 0x00, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x07, 0xe0, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x7e, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x07, 0xe0, 0x00, 0xe0, 0xc1, - 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x3f, 0x78, 0x00, - 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x38, 0xf8, - 0x3f, 0x00, 0x00, 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x1c, 0xe0, 0x07, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_se_f.xbm b/hacks/pieces/puzzle_a_se_f.xbm deleted file mode 100644 index dbc5d0f5..00000000 --- a/hacks/pieces/puzzle_a_se_f.xbm +++ /dev/null @@ -1,73 +0,0 @@ -#define puzzle_a_se_f_width 88 -#define puzzle_a_se_f_height 74 -#define puzzle_a_se_f_x_hot 20 -#define puzzle_a_se_f_y_hot 6 -static unsigned char puzzle_a_se_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0xff, 0x0f, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, - 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, - 0xe0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x80, 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, - 0xff, 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, - 0xff, 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, 0xff, 0xff, - 0x1f, 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, - 0x00, 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, 0x00, - 0x80, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xc0, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0xe0, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x00, 0xf0, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0xfc, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x7f, 0x80, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xc0, 0xff, 0xc1, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xc0, 0xff, 0xc1, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x7e, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, - 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x80, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_se_h.xbm b/hacks/pieces/puzzle_a_se_h.xbm deleted file mode 100644 index 3dbe22ac..00000000 --- a/hacks/pieces/puzzle_a_se_h.xbm +++ /dev/null @@ -1,73 +0,0 @@ -#define puzzle_a_se_h_width 88 -#define puzzle_a_se_h_height 74 -#define puzzle_a_se_h_x_hot 20 -#define puzzle_a_se_h_y_hot 6 -static unsigned char puzzle_a_se_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x3c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfc, 0x07, 0x00, 0x00, 0xfe, 0x03, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x3f, 0x0c, 0x00, 0x00, 0xc3, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0x03, 0x18, 0x00, 0x80, 0x01, 0xfc, 0x03, 0x00, 0x00, 0xc0, 0x3f, 0x00, - 0x30, 0x00, 0xc0, 0x00, 0xc0, 0x3f, 0x00, 0x00, 0xe0, 0x03, 0x00, 0x60, - 0x00, 0x60, 0x00, 0x00, 0x7c, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, - 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, - 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x30, 0x00, 0xc0, 0x00, 0x00, 0x60, - 0x00, 0x00, 0xc0, 0x00, 0x00, 0x38, 0x00, 0xc0, 0x01, 0x00, 0x60, 0x00, - 0x00, 0xc0, 0x00, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x80, 0x01, 0x00, - 0x18, 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, - 0x00, 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, 0x00, - 0x80, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, 0x00, 0xc0, - 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0xc0, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x60, 0x00, 0x60, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0xe0, 0x00, 0x70, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x00, 0x06, 0x00, 0xc0, 0x03, 0x3c, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x80, 0x0f, 0x1f, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0xfe, 0x07, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x03, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x60, 0x00, 0x7f, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xc0, 0xff, 0xc1, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0xe0, 0x80, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x70, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x70, 0x00, 0x7e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0xe0, 0xc1, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0xc0, 0xff, 0xc1, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x7e, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x00, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0x00, 0x00, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_sw_f.xbm b/hacks/pieces/puzzle_a_sw_f.xbm deleted file mode 100644 index 5a000bf1..00000000 --- a/hacks/pieces/puzzle_a_sw_f.xbm +++ /dev/null @@ -1,73 +0,0 @@ -#define puzzle_a_sw_f_width 88 -#define puzzle_a_sw_f_height 74 -#define puzzle_a_sw_f_x_hot 1 -#define puzzle_a_sw_f_y_hot 6 -static unsigned char puzzle_a_sw_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, - 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, - 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, - 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, - 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, - 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, - 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, - 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, - 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, - 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, - 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_sw_h.xbm b/hacks/pieces/puzzle_a_sw_h.xbm deleted file mode 100644 index 9b34a486..00000000 --- a/hacks/pieces/puzzle_a_sw_h.xbm +++ /dev/null @@ -1,73 +0,0 @@ -#define puzzle_a_sw_h_width 88 -#define puzzle_a_sw_h_height 74 -#define puzzle_a_sw_h_x_hot 1 -#define puzzle_a_sw_h_y_hot 6 -static unsigned char puzzle_a_sw_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3, - 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, - 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, - 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, - 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, - 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, - 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, - 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0x01, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x7c, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x00, - 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x83, 0x07, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_w_f.xbm b/hacks/pieces/puzzle_a_w_f.xbm deleted file mode 100644 index f85ef759..00000000 --- a/hacks/pieces/puzzle_a_w_f.xbm +++ /dev/null @@ -1,77 +0,0 @@ -#define puzzle_a_w_f_width 88 -#define puzzle_a_w_f_height 78 -#define puzzle_a_w_f_x_hot 1 -#define puzzle_a_w_f_y_hot 6 -static unsigned char puzzle_a_w_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, - 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x01, - 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, - 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, - 0xff, 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, - 0xff, 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, - 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, - 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, - 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, - 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, - 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0x3f, 0xc0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x01, 0x7e, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x07, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x83, 0xff, 0x03, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xf0, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x3f, 0xc0, - 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x0f, 0x00, 0xff, - 0xff, 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x01, 0x00, 0xf8, 0xff, 0xff, 0x01, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x01, - 0x00, 0xf8, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, - 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x03, 0x00, 0xfc, - 0xff, 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, - 0xff, 0x03, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, - 0x07, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0xfe, 0xff, 0xff, 0x07, 0x00, 0x00, - 0xfc, 0xff, 0xff, 0x03, 0x00, 0xfc, 0xff, 0xff, 0x03, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x01, 0x00, 0xf8, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f, - 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00, - 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_a_w_h.xbm b/hacks/pieces/puzzle_a_w_h.xbm deleted file mode 100644 index a82478f5..00000000 --- a/hacks/pieces/puzzle_a_w_h.xbm +++ /dev/null @@ -1,77 +0,0 @@ -#define puzzle_a_w_h_width 88 -#define puzzle_a_w_h_height 78 -#define puzzle_a_w_h_x_hot 1 -#define puzzle_a_w_h_y_hot 6 -static unsigned char puzzle_a_w_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x3c, 0x00, 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x7f, 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xc3, - 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0xc0, 0x3f, 0x80, 0x01, - 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0xfc, 0x03, 0x00, 0x03, 0x00, - 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, - 0x00, 0xc0, 0x07, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0x00, 0x03, 0x00, 0x00, - 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, - 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, - 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x60, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, 0x00, 0x60, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x3c, 0xc0, 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0xf8, 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x0f, 0x00, 0x00, 0xe0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x01, 0x7e, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x83, 0xff, 0x03, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xff, 0x83, 0x07, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x7e, 0x00, 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x38, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x30, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x00, - 0x0e, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x01, 0x07, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x83, 0xff, 0x03, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xfe, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x0f, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0xe0, 0x7f, 0x00, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0xf8, - 0xf0, 0x01, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x3c, 0xc0, - 0x03, 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x0e, 0x00, 0x07, - 0x00, 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, - 0x60, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, 0x1c, 0x00, 0xc0, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0xc0, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, - 0x00, 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, - 0x80, 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, - 0x01, 0x00, 0x18, 0x00, 0x80, 0x01, 0x00, 0x00, 0x06, 0x00, 0x80, 0x01, - 0x00, 0x18, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x80, 0x03, 0x00, - 0x1c, 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x03, 0x00, 0x0c, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, - 0x00, 0x03, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x3e, 0x00, 0x00, 0x06, 0x00, 0x06, 0x00, 0xc0, 0x07, 0x00, 0x00, - 0xfc, 0x03, 0x00, 0x03, 0x00, 0x0c, 0x00, 0xfc, 0x03, 0x00, 0x00, 0xc0, - 0x3f, 0x80, 0x01, 0x00, 0x18, 0xc0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xc3, 0x00, 0x00, 0x30, 0xfc, 0x03, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x7f, - 0x00, 0x00, 0xe0, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0x00, - 0x00, 0xc0, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_e_f.xbm b/hacks/pieces/puzzle_b_e_f.xbm deleted file mode 100644 index a49e771b..00000000 --- a/hacks/pieces/puzzle_b_e_f.xbm +++ /dev/null @@ -1,95 +0,0 @@ -#define puzzle_b_e_f_width 74 -#define puzzle_b_e_f_height 108 -#define puzzle_b_e_f_x_hot 6 -#define puzzle_b_e_f_y_hot 21 -static unsigned char puzzle_b_e_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, - 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, - 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, - 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_e_h.xbm b/hacks/pieces/puzzle_b_e_h.xbm deleted file mode 100644 index daa13c16..00000000 --- a/hacks/pieces/puzzle_b_e_h.xbm +++ /dev/null @@ -1,95 +0,0 @@ -#define puzzle_b_e_h_width 74 -#define puzzle_b_e_h_height 108 -#define puzzle_b_e_h_x_hot 6 -#define puzzle_b_e_h_y_hot 21 -static unsigned char puzzle_b_e_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, - 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, - 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00, - 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, - 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, - 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, 0x00, 0x00, - 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, - 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, - 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f, - 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_f.xbm b/hacks/pieces/puzzle_b_f.xbm deleted file mode 100644 index 895abf9c..00000000 --- a/hacks/pieces/puzzle_b_f.xbm +++ /dev/null @@ -1,95 +0,0 @@ -#define puzzle_b_f_width 78 -#define puzzle_b_f_height 108 -#define puzzle_b_f_x_hot 5 -#define puzzle_b_f_y_hot 20 -static unsigned char puzzle_b_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, - 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07, - 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, - 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, 0xe0, 0x3f, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_h.xbm b/hacks/pieces/puzzle_b_h.xbm deleted file mode 100644 index 0ecc2048..00000000 --- a/hacks/pieces/puzzle_b_h.xbm +++ /dev/null @@ -1,95 +0,0 @@ -#define puzzle_b_h_width 78 -#define puzzle_b_h_height 108 -#define puzzle_b_h_x_hot 5 -#define puzzle_b_h_y_hot 20 -static unsigned char puzzle_b_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x70, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, - 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00, - 0xff, 0x01, 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01, - 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01, 0x60, 0x00, - 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x07, - 0x00, 0x00, 0xfc, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, - 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, - 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07, - 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00, - 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0xc0, 0x07, 0x00, 0x00, - 0xfc, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x0f, 0x00, 0x00, 0xfe, 0x0f, - 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x18, 0x00, 0x00, 0x07, 0xff, 0x80, 0x01, - 0x60, 0xfc, 0x03, 0x30, 0x00, 0x80, 0x03, 0xf0, 0x8f, 0x01, 0xe0, 0x3f, - 0x00, 0x60, 0x00, 0xc0, 0x01, 0x00, 0xff, 0x01, 0xc0, 0x03, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x01, 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_n_f.xbm b/hacks/pieces/puzzle_b_n_f.xbm deleted file mode 100644 index e7a84b13..00000000 --- a/hacks/pieces/puzzle_b_n_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_n_f_width 78 -#define puzzle_b_n_f_height 88 -#define puzzle_b_n_f_x_hot 6 -#define puzzle_b_n_f_y_hot 1 -static unsigned char puzzle_b_n_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, - 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0x00, 0x00, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, - 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, - 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, - 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, - 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_n_h.xbm b/hacks/pieces/puzzle_b_n_h.xbm deleted file mode 100644 index aae63330..00000000 --- a/hacks/pieces/puzzle_b_n_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_n_h_width 78 -#define puzzle_b_n_h_height 88 -#define puzzle_b_n_h_x_hot 6 -#define puzzle_b_n_h_y_hot 1 -static unsigned char puzzle_b_n_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, - 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, - 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, - 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, - 0x70, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, - 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, - 0x00, 0x00, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, - 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, - 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x60, 0x00, 0xfc, 0x1f, - 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, - 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, - 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, - 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_ne_f.xbm b/hacks/pieces/puzzle_b_ne_f.xbm deleted file mode 100644 index 1a56171c..00000000 --- a/hacks/pieces/puzzle_b_ne_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_ne_f_width 74 -#define puzzle_b_ne_f_height 88 -#define puzzle_b_ne_f_x_hot 6 -#define puzzle_b_ne_f_y_hot 1 -static unsigned char puzzle_b_ne_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, - 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, - 0xff, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0xff, 0x01, - 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_ne_h.xbm b/hacks/pieces/puzzle_b_ne_h.xbm deleted file mode 100644 index 72464994..00000000 --- a/hacks/pieces/puzzle_b_ne_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_ne_h_width 74 -#define puzzle_b_ne_h_height 88 -#define puzzle_b_ne_h_x_hot 6 -#define puzzle_b_ne_h_y_hot 1 -static unsigned char puzzle_b_ne_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, - 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, - 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, - 0xc0, 0x0f, 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x60, 0x00, 0xfc, 0x1f, - 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, - 0x06, 0xff, 0x80, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, - 0x8f, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, 0xff, 0x01, - 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0xf0, 0x01, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x70, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_nw_f.xbm b/hacks/pieces/puzzle_b_nw_f.xbm deleted file mode 100644 index 393e0b6d..00000000 --- a/hacks/pieces/puzzle_b_nw_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_nw_f_width 74 -#define puzzle_b_nw_f_height 88 -#define puzzle_b_nw_f_x_hot 1 -#define puzzle_b_nw_f_y_hot 1 -static unsigned char puzzle_b_nw_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, - 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, - 0x1f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00, - 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_nw_h.xbm b/hacks/pieces/puzzle_b_nw_h.xbm deleted file mode 100644 index 7b330308..00000000 --- a/hacks/pieces/puzzle_b_nw_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_nw_h_width 74 -#define puzzle_b_nw_h_height 88 -#define puzzle_b_nw_h_x_hot 1 -#define puzzle_b_nw_h_y_hot 1 -static unsigned char puzzle_b_nw_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, - 0x7c, 0x00, 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00, - 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, - 0xf0, 0x0f, 0x18, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, - 0x18, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00, - 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, - 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_s_f.xbm b/hacks/pieces/puzzle_b_s_f.xbm deleted file mode 100644 index f72d7394..00000000 --- a/hacks/pieces/puzzle_b_s_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_s_f_width 78 -#define puzzle_b_s_f_height 88 -#define puzzle_b_s_f_x_hot 5 -#define puzzle_b_s_f_y_hot 20 -static unsigned char puzzle_b_s_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, - 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xf8, 0x00, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0x7f, 0x00, 0x00, 0x00, 0xc0, 0x07, - 0xc0, 0xff, 0xff, 0xff, 0xff, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xfe, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x1f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x0f, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x07, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x03, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_s_h.xbm b/hacks/pieces/puzzle_b_s_h.xbm deleted file mode 100644 index 5f906707..00000000 --- a/hacks/pieces/puzzle_b_s_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_s_h_width 78 -#define puzzle_b_s_h_height 88 -#define puzzle_b_s_h_x_hot 5 -#define puzzle_b_s_h_y_hot 20 -static unsigned char puzzle_b_s_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0xf0, 0x00, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, - 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, - 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00, - 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, - 0x00, 0x00, 0xf8, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0xf0, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, 0x03, 0x06, 0x30, 0xf8, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0xff, 0x07, 0x03, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, - 0xc0, 0x03, 0xfe, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, - 0xf8, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x38, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x70, 0x00, 0x00, 0x00, 0xc0, 0x07, - 0xc0, 0x01, 0x00, 0x00, 0xe0, 0x00, 0xf8, 0x00, 0xe0, 0x1f, 0xf0, 0x00, - 0x00, 0x00, 0xc0, 0x03, 0xfe, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0xff, 0x07, 0x03, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0x03, 0x06, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x18, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_se_f.xbm b/hacks/pieces/puzzle_b_se_f.xbm deleted file mode 100644 index 537725ef..00000000 --- a/hacks/pieces/puzzle_b_se_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_se_f_width 74 -#define puzzle_b_se_f_height 88 -#define puzzle_b_se_f_x_hot 6 -#define puzzle_b_se_f_y_hot 20 -static unsigned char puzzle_b_se_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0xff, 0x7f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0xff, 0xff, - 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0xff, 0xff, 0x01, 0x00, - 0xff, 0x01, 0xe0, 0xff, 0x03, 0xf0, 0xff, 0xff, 0x03, 0xf0, 0xff, 0x01, - 0xe0, 0xff, 0x3f, 0xf8, 0xff, 0xff, 0x07, 0xff, 0xff, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0x00, 0x00, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0x00, 0x00, 0x80, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0x07, - 0xc0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0x1f, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfc, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfc, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xf8, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xf0, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xe0, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_se_h.xbm b/hacks/pieces/puzzle_b_se_h.xbm deleted file mode 100644 index df99f701..00000000 --- a/hacks/pieces/puzzle_b_se_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_se_h_width 74 -#define puzzle_b_se_h_height 88 -#define puzzle_b_se_h_x_hot 6 -#define puzzle_b_se_h_y_hot 20 -static unsigned char puzzle_b_se_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf8, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x38, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x60, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe0, 0x00, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x30, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, - 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x80, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xc0, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, - 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x03, 0x00, 0xc0, 0x00, 0xc0, - 0x00, 0x00, 0xf0, 0x01, 0xe0, 0x3f, 0x00, 0xe0, 0x00, 0x80, 0x01, 0x00, - 0xff, 0x01, 0x60, 0xfc, 0x03, 0x70, 0x00, 0x00, 0x03, 0xf0, 0x8f, 0x01, - 0x60, 0xc0, 0x3f, 0x38, 0x00, 0x00, 0x06, 0xff, 0x80, 0x01, 0x60, 0x00, - 0xfc, 0x1f, 0x00, 0x00, 0xfc, 0x0f, 0x80, 0x01, 0x30, 0x00, 0xc0, 0x0f, - 0x00, 0x00, 0xf8, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, - 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xc0, 0x07, - 0xc0, 0x01, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0x1f, 0xf0, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0xf8, 0x3f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x18, 0xf0, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x0c, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x60, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0xe0, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xc0, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_sw_f.xbm b/hacks/pieces/puzzle_b_sw_f.xbm deleted file mode 100644 index f183b52a..00000000 --- a/hacks/pieces/puzzle_b_sw_f.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_sw_f_width 74 -#define puzzle_b_sw_f_height 88 -#define puzzle_b_sw_f_x_hot 1 -#define puzzle_b_sw_f_y_hot 21 -static unsigned char puzzle_b_sw_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, - 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, - 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, - 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, - 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_sw_h.xbm b/hacks/pieces/puzzle_b_sw_h.xbm deleted file mode 100644 index 917853bd..00000000 --- a/hacks/pieces/puzzle_b_sw_h.xbm +++ /dev/null @@ -1,79 +0,0 @@ -#define puzzle_b_sw_h_width 74 -#define puzzle_b_sw_h_height 88 -#define puzzle_b_sw_h_x_hot 1 -#define puzzle_b_sw_h_y_hot 21 -static unsigned char puzzle_b_sw_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, - 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, - 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, - 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0, - 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00, - 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, - 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, - 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x18, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_w_f.xbm b/hacks/pieces/puzzle_b_w_f.xbm deleted file mode 100644 index 0b5b8d53..00000000 --- a/hacks/pieces/puzzle_b_w_f.xbm +++ /dev/null @@ -1,95 +0,0 @@ -#define puzzle_b_w_f_width 74 -#define puzzle_b_w_f_height 108 -#define puzzle_b_w_f_x_hot 1 -#define puzzle_b_w_f_y_hot 21 -static unsigned char puzzle_b_w_f_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xff, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, - 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0xfc, 0xff, 0x0f, - 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, - 0x1f, 0x00, 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, - 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, - 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x01, 0x00, 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, - 0x00, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x03, 0x00, 0x00, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0x07, 0x00, 0x00, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x0f, 0x80, 0x0f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0xe0, 0x1f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0x01, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x7f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x00, - 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0x3f, 0x00, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0x1f, 0x00, 0xfe, 0xff, 0x83, 0xff, 0xff, 0x7f, 0xf0, 0xff, 0x1f, 0x00, - 0xfe, 0x3f, 0x00, 0xff, 0xff, 0x3f, 0x00, 0xff, 0x1f, 0x00, 0xfe, 0x03, - 0x00, 0xfe, 0xff, 0x1f, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0xfc, - 0xff, 0x0f, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, - 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xff, 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff, 0x1f, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0xfe, 0xff, 0x1f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xfc, 0xff, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xf8, 0xff, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xf0, - 0xff, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/pieces/puzzle_b_w_h.xbm b/hacks/pieces/puzzle_b_w_h.xbm deleted file mode 100644 index 2c105c16..00000000 --- a/hacks/pieces/puzzle_b_w_h.xbm +++ /dev/null @@ -1,95 +0,0 @@ -#define puzzle_b_w_h_width 74 -#define puzzle_b_w_h_height 108 -#define puzzle_b_w_h_x_hot 1 -#define puzzle_b_w_h_y_hot 21 -static unsigned char puzzle_b_w_h_bits[] = { - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, - 0xff, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, 0x80, 0x03, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x38, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, - 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x00, 0x0c, 0x00, 0x0c, - 0x00, 0x00, 0x0f, 0x00, 0xfe, 0x03, 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, - 0x1f, 0x00, 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, - 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, 0x06, 0xc0, - 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, 0x18, 0x00, 0x06, 0x00, 0x7c, 0x00, - 0x00, 0xc0, 0x0f, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, - 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x80, 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, - 0x01, 0x00, 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x80, 0x03, 0x00, - 0x00, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x00, 0x00, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x0e, 0x80, 0x0f, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3c, 0xe0, 0x1f, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xf0, 0x7f, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x3f, - 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x80, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x60, 0x00, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x60, 0x00, - 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x06, 0x00, 0x7c, 0x00, 0x00, 0xc0, - 0x0f, 0x00, 0x30, 0x00, 0x06, 0xc0, 0xff, 0x00, 0x00, 0xe0, 0xff, 0x00, - 0x18, 0x00, 0x06, 0xfc, 0x83, 0x01, 0x00, 0x70, 0xf0, 0x0f, 0x18, 0x00, - 0xc6, 0x3f, 0x00, 0x03, 0x00, 0x38, 0x00, 0xff, 0x18, 0x00, 0xfe, 0x03, - 0x00, 0x06, 0x00, 0x1c, 0x00, 0xf0, 0x1f, 0x00, 0x3e, 0x00, 0x00, 0x0c, - 0x00, 0x0c, 0x00, 0x00, 0x0f, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, - 0x00, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x38, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x03, 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x00, 0x30, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x00, 0x18, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x00, 0x18, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x1c, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x0c, 0x00, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x18, 0x00, 0x07, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, - 0x80, 0x03, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xe0, 0xff, 0x01, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x7f, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; diff --git a/hacks/puzzle.c b/hacks/puzzle.c index f16ccaa2..f3647c4b 100644 --- a/hacks/puzzle.c +++ b/hacks/puzzle.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1997 Jamie Zawinski +/* xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -35,45 +35,45 @@ #define DEBUG -#include "pieces/puzzle_a_h.xbm" -#include "pieces/puzzle_a_n_h.xbm" -#include "pieces/puzzle_a_ne_h.xbm" -#include "pieces/puzzle_a_e_h.xbm" -#include "pieces/puzzle_a_se_h.xbm" -#include "pieces/puzzle_a_s_h.xbm" -#include "pieces/puzzle_a_sw_h.xbm" -#include "pieces/puzzle_a_w_h.xbm" -#include "pieces/puzzle_a_nw_h.xbm" - -#include "pieces/puzzle_b_h.xbm" -#include "pieces/puzzle_b_n_h.xbm" -#include "pieces/puzzle_b_ne_h.xbm" -#include "pieces/puzzle_b_e_h.xbm" -#include "pieces/puzzle_b_se_h.xbm" -#include "pieces/puzzle_b_s_h.xbm" -#include "pieces/puzzle_b_sw_h.xbm" -#include "pieces/puzzle_b_w_h.xbm" -#include "pieces/puzzle_b_nw_h.xbm" - -#include "pieces/puzzle_a_f.xbm" -#include "pieces/puzzle_a_n_f.xbm" -#include "pieces/puzzle_a_ne_f.xbm" -#include "pieces/puzzle_a_e_f.xbm" -#include "pieces/puzzle_a_se_f.xbm" -#include "pieces/puzzle_a_s_f.xbm" -#include "pieces/puzzle_a_sw_f.xbm" -#include "pieces/puzzle_a_w_f.xbm" -#include "pieces/puzzle_a_nw_f.xbm" - -#include "pieces/puzzle_b_f.xbm" -#include "pieces/puzzle_b_n_f.xbm" -#include "pieces/puzzle_b_ne_f.xbm" -#include "pieces/puzzle_b_e_f.xbm" -#include "pieces/puzzle_b_se_f.xbm" -#include "pieces/puzzle_b_s_f.xbm" -#include "pieces/puzzle_b_sw_f.xbm" -#include "pieces/puzzle_b_w_f.xbm" -#include "pieces/puzzle_b_nw_f.xbm" +#include "images/puzzle/puzzle_a_h.xbm" +#include "images/puzzle/puzzle_a_n_h.xbm" +#include "images/puzzle/puzzle_a_ne_h.xbm" +#include "images/puzzle/puzzle_a_e_h.xbm" +#include "images/puzzle/puzzle_a_se_h.xbm" +#include "images/puzzle/puzzle_a_s_h.xbm" +#include "images/puzzle/puzzle_a_sw_h.xbm" +#include "images/puzzle/puzzle_a_w_h.xbm" +#include "images/puzzle/puzzle_a_nw_h.xbm" + +#include "images/puzzle/puzzle_b_h.xbm" +#include "images/puzzle/puzzle_b_n_h.xbm" +#include "images/puzzle/puzzle_b_ne_h.xbm" +#include "images/puzzle/puzzle_b_e_h.xbm" +#include "images/puzzle/puzzle_b_se_h.xbm" +#include "images/puzzle/puzzle_b_s_h.xbm" +#include "images/puzzle/puzzle_b_sw_h.xbm" +#include "images/puzzle/puzzle_b_w_h.xbm" +#include "images/puzzle/puzzle_b_nw_h.xbm" + +#include "images/puzzle/puzzle_a_f.xbm" +#include "images/puzzle/puzzle_a_n_f.xbm" +#include "images/puzzle/puzzle_a_ne_f.xbm" +#include "images/puzzle/puzzle_a_e_f.xbm" +#include "images/puzzle/puzzle_a_se_f.xbm" +#include "images/puzzle/puzzle_a_s_f.xbm" +#include "images/puzzle/puzzle_a_sw_f.xbm" +#include "images/puzzle/puzzle_a_w_f.xbm" +#include "images/puzzle/puzzle_a_nw_f.xbm" + +#include "images/puzzle/puzzle_b_f.xbm" +#include "images/puzzle/puzzle_b_n_f.xbm" +#include "images/puzzle/puzzle_b_ne_f.xbm" +#include "images/puzzle/puzzle_b_e_f.xbm" +#include "images/puzzle/puzzle_b_se_f.xbm" +#include "images/puzzle/puzzle_b_s_f.xbm" +#include "images/puzzle/puzzle_b_sw_f.xbm" +#include "images/puzzle/puzzle_b_w_f.xbm" +#include "images/puzzle/puzzle_b_nw_f.xbm" #define GRID_WIDTH 66 #define GRID_HEIGHT 66 diff --git a/hacks/rd-bomb.c b/hacks/rd-bomb.c index 9dfe8d38..0a7cee75 100644 --- a/hacks/rd-bomb.c +++ b/hacks/rd-bomb.c @@ -22,17 +22,261 @@ #include "screenhack.h" -/* why doesn't this work??? */ -#ifdef HAVE_XSHM_EXTENSION -#include -#include -#include +/* costs ~6% speed */ +#define dither_when_mapped 1 + +int verbose; +int ncolors = 0; +XColor *colors = 0; +Display *display; +Visual *visual; +#if dither_when_mapped +unsigned char *mc = 0; #endif +Colormap cmap = 0; +Window window; +int mapped; +int pdepth; +void random_colors(void); + +/* ----------------------------------------------------------- + pixel hack, 8-bit pixel grid, first/next frame interface + + pixack_init(int *size_h, int *size_v) + pixack_frame(char *pix_buf) + */ + + +#define bps 16 +#define mx ((1<<16)-1) + +/* you can replace integer mults wish shift/adds with these, + but it doesn't help on my 586 */ +#define x5(n) ((n<<2)+n) +#define x7(n) ((n<<3)-n) + +/* why strip bit? */ +#define R (ya_random()&((1<<30)-1)) + +int frame = 0, epoch_time; +ushort *r1, *r2, *r1b, *r2b; +int width, height, npix; +int radius; +int reaction = 0; +int diffusion = 0; + +/* returns number of pixels that the pixack produces. called once. */ +void +pixack_init(int *size_h, int *size_v) { + int sz_base; + width = get_integer_resource ("width", "Integer"); + height = get_integer_resource ("height", "Integer"); + sz_base = 80 + (R%40); + if (width <= 0) width = (R%20) ? sz_base : (28 + R%10); + if (height <= 0) height = (R%20) ? sz_base : (28 + R%10); + /* don't go there */ + if (width < 10) width = 10; + if (height < 10) height = 10; + epoch_time = get_integer_resource ("epoch", "Integer"); + npix = (width + 2) * (height + 2); + r1 = (ushort *) malloc(sizeof(ushort) * npix); + r2 = (ushort *) malloc(sizeof(ushort) * npix); + r1b = (ushort *) malloc(sizeof(ushort) * npix); + r2b = (ushort *) malloc(sizeof(ushort) * npix); + + if (!r1 || !r2 || !r1b || !r2b) { + fprintf(stderr, "not enough memory for %d pixels.\n", npix); + exit(1); + } + + *size_h = width; + *size_v = height; +} #define test_pattern_hyper 0 -/* costs ~6% speed */ -#define dither_when_mapped 1 + +/* returns the pixels. called many times. */ +void +pixack_frame(char *pix_buf) { + int i, j; + int w2 = width + 2; + ushort *t; +#if test_pattern_hyper + if (frame&0x100) + sleep(1); +#endif + if (verbose) { + double tm = 0; + struct timeval tp; + if (!(frame%100)) { + double tm2; +#ifdef GETTIMEOFDAY_TWO_ARGS + struct timezone tzp; + gettimeofday(&tp, &tzp); +#else + gettimeofday(&tp); +#endif + tm2 = tp.tv_sec + tp.tv_usec * 1e-6; + if (frame > 0) + printf("fps = %2.4g\n", 100.0 / (tm2 - tm)); + tm = tm2; + } + } + if (!(frame%epoch_time)) { + int s; + if (0 != frame) { + int t = epoch_time / 500; + if (t > 15) + t = 15; + sleep(t); + } + + for (i = 0; i < npix; i++) { + /* equilibrium */ + r1[i] = 65500; + r2[i] = 11; + } + + random_colors(); + + XSetWindowBackground(display, window, colors[255 % ncolors].pixel); + XClearWindow(display, window); + + s = w2 * (height/2) + width/2; + radius = get_integer_resource ("radius", "Integer"); + { + int maxr = width/2-2; + int maxr2 = height/2-2; + if (maxr2 < maxr) maxr = maxr2; + + if (radius < 0) + radius = 1 + ((R%10) ? (R%5) : (R % maxr)); + if (radius > maxr) radius = maxr; + } + for (i = -radius; i < (radius+1); i++) + for (j = -radius; j < (radius+1); j++) + r2[s + i + j*w2] = mx - (R&63); + reaction = get_integer_resource ("reaction", "Integer"); + if (reaction < 0 || reaction > 2) reaction = R&1; + diffusion = get_integer_resource ("diffusion", "Integer"); + if (diffusion < 0 || diffusion > 2) + diffusion = (R%5) ? ((R%3)?0:1) : 2; + if (2 == reaction && 2 == diffusion) + reaction = diffusion = 0; + + if (verbose) + printf("reaction = %d\ndiffusion = %d\nradius = %d\n", + reaction, diffusion, radius); + } + for (i = 0; i <= width+1; i++) { + r1[i] = r1[i + w2 * height]; + r2[i] = r2[i + w2 * height]; + r1[i + w2 * (height + 1)] = r1[i + w2]; + r2[i + w2 * (height + 1)] = r2[i + w2]; + } + for (i = 0; i <= height+1; i++) { + r1[w2 * i] = r1[width + w2 * i]; + r2[w2 * i] = r2[width + w2 * i]; + r1[w2 * i + width + 1] = r1[w2 * i + 1]; + r2[w2 * i + width + 1] = r2[w2 * i + 1]; + } + for (i = 0; i < height; i++) { + int ii = i + 1; + char *q = pix_buf + width * i; + short *qq = ((short *) pix_buf) + width * i; + long *qqq = ((long *) pix_buf) + width * i; + ushort *i1 = r1 + 1 + w2 * ii; + ushort *i2 = r2 + 1 + w2 * ii; + ushort *o1 = r1b + 1 + w2 * ii; + ushort *o2 = r2b + 1 + w2 * ii; + for (j = 0; j < width; j++) { +#if test_pattern_hyper + int r1 = (i * j + (frame&127)*frame)&65535; +#else + int uvv, r1 = 0, r2 = 0; + switch (diffusion) { + case 0: + r1 = i1[j] + i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2]; + r1 = r1 / 5; + r2 = (i2[j]<<3) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2]; + r2 = r2 / 12; + break; + case 1: + r1 = i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2]; + r1 = r1 >> 2; + r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2]; + r2 = r2 >> 3; + break; + case 2: + r1 = (i1[j]<<1) + (i1[j+1]<<1) + (i1[j-1]<<1) + i1[j+w2] + i1[j-w2]; + r1 = r1 >> 3; + r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2]; + r2 = r2 >> 3; + break; + } + + /* John E. Pearson "Complex Patterns in a Simple System" + Science, July 1993 */ + + uvv = (((r1 * r2) >> bps) * r2) >> bps; + switch (reaction) { /* costs 4% */ + case 0: + r1 += 4 * (((28 * (mx-r1)) >> 10) - uvv); + r2 += 4 * (uvv - ((80 * r2) >> 10)); + break; + case 1: + r1 += 3 * (((27 * (mx-r1)) >> 10) - uvv); + r2 += 3 * (uvv - ((80 * r2) >> 10)); + break; + case 2: + r1 += 2 * (((28 * (mx-r1)) >> 10) - uvv); + r2 += 3 * (uvv - ((80 * r2) >> 10)); + break; + } + if (r1 > mx) r1 = mx; + if (r2 > mx) r2 = mx; + if (r1 < 0) r1 = 0; + if (r2 < 0) r2 = 0; + o1[j] = r1; + o2[j] = r2; +#endif + + /* this is terrible. here i want to assume ncolors = 256. + should lose double indirection */ + + if (mapped) +#if dither_when_mapped + q[j] = colors[mc[r1] % ncolors].pixel; +#else + q[j] = colors[(r1>>8) % ncolors].pixel; +#endif + else if (pdepth == 8) + q[j] = colors[(r1>>8) % ncolors].pixel; + else if (pdepth == 16) +#if dither_when_mapped + qq[j] = colors[mc[r1] % ncolors].pixel; +#else + qq[j] = colors[(r1>>8) % ncolors].pixel; +#endif + else if (pdepth == 32) +#if dither_when_mapped + qqq[j] = colors[mc[r1] % ncolors].pixel; +#else + qqq[j] = colors[(r1>>8) % ncolors].pixel; +#endif + else + abort(); + } + } + t = r1; r1 = r1b; r1b = t; + t = r2; r2 = r2b; r2b = t; +} + + +/* ------------- xscreensaver rendering -------------- */ + + char *progclass = "RD"; @@ -40,8 +284,8 @@ char *progclass = "RD"; char *defaults [] = { "RD.background: black", /* to placate SGI */ "RD.foreground: white", - "*width: 100", - "*height: 100", + "*width: 0", /* tried to use -1 but it complained */ + "*height: 0", "*epoch: 40000", "*reaction: -1", "*diffusion: -1", @@ -49,7 +293,7 @@ char *defaults [] = { "*radius: -1", "*speed: 0.0", "*size: 0.66", - "*delay: 1000", + "*delay: 1", "*colors: -1", 0 }; @@ -69,16 +313,48 @@ XrmOptionDescRec options [] = { { 0, 0, 0, 0 } }; -#define bps 16 -#define mx ((1<<16)-1) -/* you can replace integer mults wish shift/adds with these, - but it doesn't help on my 586 */ -#define x5(n) ((n<<2)+n) -#define x7(n) ((n<<3)-n) +/* why doesn't this work??? and more importantly, do i really still have + to do this in X? */ + +#ifdef HAVE_XSHM_EXTENSION +#include +#include +#include +#endif -/* why strip bit? */ -#define R (ya_random()&((1<<30)-1)) + +void +random_colors() { + memset(colors, 0, ncolors*sizeof(*colors)); + make_smooth_colormap (display, visual, cmap, colors, &ncolors, + True, 0, True); + if (ncolors <= 2) { + mono_p = True; + ncolors = 2; + colors[0].flags = DoRed|DoGreen|DoBlue; + colors[0].red = colors[0].green = colors[0].blue = 0; + XAllocColor(display, cmap, &colors[0]); + colors[1].flags = DoRed|DoGreen|DoBlue; + colors[1].red = colors[1].green = colors[1].blue = 0xFFFF; + XAllocColor(display, cmap, &colors[1]); + } + + /* Scale it up so that there are exactly 255 colors -- that keeps the + animation speed consistent, even when there aren't many allocatable + colors, and prevents the -mono mode from looking like static. */ + if (ncolors != 255) { + int i, n = 255; + double scale = (double) ncolors / (double) (n+1); + XColor *c2 = (XColor *) malloc(sizeof(*c2) * (n+1)); + for (i = 0; i < n; i++) + c2[i] = colors[(int) (i * scale)]; + free(colors); + colors = c2; + ncolors = n; + } + +} /* should factor into RD-specfic and compute-every-pixel general */ void @@ -87,38 +363,29 @@ screenhack (Display *dpy, Window win) GC gc; XGCValues gcv; XWindowAttributes xgwa; - Colormap cmap = 0; XImage *image; - int width, height, radius; int array_width, array_height; double array_x, array_y; double array_dx, array_dy; int w2; - int frame = 0, epoch_time; char *p; - int vdepth, pdepth; - ushort *r1, *r2, *r1b, *r2b; + int vdepth; int npix; - int reaction = 0; - int diffusion = 0; - int verbose; - int mapped; int *m = 0; -#if dither_when_mapped - unsigned char *mc = 0; -#endif #ifdef HAVE_XSHM_EXTENSION int use_shm = 0; XShmSegmentInfo shm_info; #endif - int ncolors = 0; - XColor *colors = 0; - int delay = get_float_resource ("delay", "Integer"); + double delay = get_float_resource ("delay", "Float"); + + display = dpy; + window = win; + XGetWindowAttributes (dpy, win, &xgwa); - width = get_integer_resource ("width", "Integer"); - height = get_integer_resource ("height", "Integer"); + visual = xgwa.visual; + pixack_init(&width, &height); { double s = get_float_resource ("size", "Float"); double p = get_float_resource ("speed", "Float"); @@ -138,11 +405,8 @@ screenhack (Display *dpy, Window win) array_dx = p; array_dy = .31415926 * p; } - if (width < 10) width = 10; - if (height < 10) height = 10; verbose = get_boolean_resource ("verbose", "Boolean"); npix = (width + 2) * (height + 2); - epoch_time = get_integer_resource ("epoch", "Integer"); w2 = width + 2; gcv.function = GXcopy; gc = XCreateGC(dpy, win, GCFunction, &gcv); @@ -174,10 +438,7 @@ screenhack (Display *dpy, Window win) mapped = (vdepth <= 8 && has_writable_cells(xgwa.screen, xgwa.visual)); - if (!mapped) - m = (int *) malloc(sizeof(int) * (1<<16)); -#if dither_when_mapped - else { + { int i, di; mc = (unsigned char *) malloc(1<<16); for (i = 0; i < (1<<16); i++) { @@ -186,13 +447,9 @@ screenhack (Display *dpy, Window win) mc[i] = di; } } -#endif + p = malloc(npix * (pdepth == 1 ? 1 : (pdepth / 8))); - r1 = (ushort *) malloc(sizeof(ushort) * npix); - r2 = (ushort *) malloc(sizeof(ushort) * npix); - r1b = (ushort *) malloc(sizeof(ushort) * npix); - r2b = (ushort *) malloc(sizeof(ushort) * npix); - if (!p || !r1 || !r2 || !r1b || !r2b) { + if (!p) { fprintf(stderr, "not enough memory for %d pixels.\n", npix); exit(1); } @@ -221,181 +478,7 @@ screenhack (Display *dpy, Window win) while (1) { int i, j; - ushort *t; -#if test_pattern_hyper - if (frame&0x100) - sleep(1); -#endif - if (verbose) { - double tm = 0; - struct timeval tp; - if (!(frame%100)) { - double tm2; -#ifdef GETTIMEOFDAY_TWO_ARGS - struct timezone tzp; - gettimeofday(&tp, &tzp); -#else - gettimeofday(&tp); -#endif - tm2 = tp.tv_sec + tp.tv_usec * 1e-6; - if (frame > 0) - printf("fps = %2.4g\n", 100.0 / (tm2 - tm)); - tm = tm2; - } - } - if (!(frame%epoch_time)) { - int s; - if (0 != frame) { - int t = epoch_time / 500; - if (t > 15) - t = 15; - sleep(t); - } - - for (i = 0; i < npix; i++) { - /* equilibrium */ - r1[i] = 65500; - r2[i] = 11; - } - - memset(colors, 0, ncolors*sizeof(*colors)); - make_smooth_colormap (dpy, xgwa.visual, cmap, colors, &ncolors, - True, 0, True); - if (ncolors <= 2) { - mono_p = True; - ncolors = 2; - colors[0].flags = DoRed|DoGreen|DoBlue; - colors[0].red = colors[0].green = colors[0].blue = 0; - XAllocColor(dpy, cmap, &colors[0]); - colors[1].flags = DoRed|DoGreen|DoBlue; - colors[1].red = colors[1].green = colors[1].blue = 0xFFFF; - XAllocColor(dpy, cmap, &colors[1]); - } - - /* Scale it up so that there are exactly 255 colors -- that keeps the - animation speed consistent, even when there aren't many allocatable - colors, and prevents the -mono mode from looking like static. */ - if (ncolors != 255) { - int i, n = 255; - double scale = (double) ncolors / (double) (n+1); - XColor *c2 = (XColor *) malloc(sizeof(*c2) * (n+1)); - for (i = 0; i < n; i++) - c2[i] = colors[(int) (i * scale)]; - free(colors); - colors = c2; - ncolors = n; - } - - - XSetWindowBackground(dpy, win, colors[255 % ncolors].pixel); - XClearWindow(dpy, win); - - s = w2 * height/2 + width/2; - radius = get_integer_resource ("radius", "Integer"); - if (radius < 0) - radius = 1 + ((R%10) ? (R%5) : (R % (width/2-2))); - for (i = -radius; i < (radius+1); i++) - for (j = -radius; j < (radius+1); j++) - r2[s + i + j*w2] = mx - (R&63); - reaction = get_integer_resource ("reaction", "Integer"); - if (reaction < 0 || reaction > 2) reaction = R&1; - diffusion = get_integer_resource ("diffusion", "Integer"); - if (diffusion < 0 || diffusion > 2) - diffusion = (R%5) ? ((R%3)?0:1) : 2; - if (2 == reaction && 2 == diffusion) - reaction = diffusion = 0; - - if (verbose) - printf("reaction = %d\ndiffusion = %d\nradius = %d\n", - reaction, diffusion, radius); - } - for (i = 0; i <= width+1; i++) { - r1[i] = r1[i + w2 * height]; - r2[i] = r2[i + w2 * height]; - r1[i + w2 * (height + 1)] = r1[i + w2]; - r2[i + w2 * (height + 1)] = r2[i + w2]; - } - for (i = 0; i <= height+1; i++) { - r1[w2 * i] = r1[width + w2 * i]; - r2[w2 * i] = r2[width + w2 * i]; - r1[w2 * i + width + 1] = r1[w2 * i + 1]; - r2[w2 * i + width + 1] = r2[w2 * i + 1]; - } - for (i = 0; i < height; i++) { - int ii = i + 1; - char *q = p + width * i; - short *qq = ((short *) p) + width * i; - long *qqq = ((long *) p) + width * i; - ushort *i1 = r1 + 1 + w2 * ii; - ushort *i2 = r2 + 1 + w2 * ii; - ushort *o1 = r1b + 1 + w2 * ii; - ushort *o2 = r2b + 1 + w2 * ii; - for (j = 0; j < width; j++) { -#if test_pattern_hyper - int r1 = (i * j + (frame&127)*frame)&65535; -#else - int uvv, r1 = 0, r2 = 0; - switch (diffusion) { - case 0: - r1 = i1[j] + i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2]; - r1 = r1 / 5; - r2 = (i2[j]<<3) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2]; - r2 = r2 / 12; - break; - case 1: - r1 = i1[j+1] + i1[j-1] + i1[j+w2] + i1[j-w2]; - r1 = r1 >> 2; - r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2]; - r2 = r2 >> 3; - break; - case 2: - r1 = (i1[j]<<1) + (i1[j+1]<<1) + (i1[j-1]<<1) + i1[j+w2] + i1[j-w2]; - r1 = r1 >> 3; - r2 = (i2[j]<<2) + i2[j+1] + i2[j-1] + i2[j+w2] + i2[j-w2]; - r2 = r2 >> 3; - break; - } - uvv = (((r1 * r2) >> bps) * r2) >> bps; - switch (reaction) { /* costs 4% */ - case 0: - r1 += 4 * (((28 * (mx-r1)) >> 10) - uvv); - r2 += 4 * (uvv - ((80 * r2) >> 10)); - break; - case 1: - r1 += 3 * (((27 * (mx-r1)) >> 10) - uvv); - r2 += 3 * (uvv - ((80 * r2) >> 10)); - break; - case 2: - r1 += 2 * (((28 * (mx-r1)) >> 10) - uvv); - r2 += 3 * (uvv - ((80 * r2) >> 10)); - break; - } - if (r1 > mx) r1 = mx; - if (r2 > mx) r2 = mx; - if (r1 < 0) r1 = 0; - if (r2 < 0) r2 = 0; - o1[j] = r1; - o2[j] = r2; -#endif - - if (mapped) -#if dither_when_mapped - q[j] = colors[mc[r1] % ncolors].pixel; -#else - q[j] = colors[(r1>>8) % ncolors].pixel; -#endif - else if (pdepth == 8) - q[j] = colors[(r1>>8) % ncolors].pixel; - else if (pdepth == 16) - qq[j] = colors[(r1>>8) % ncolors].pixel; - else if (pdepth == 32) - qqq[j] = colors[(r1>>8) % ncolors].pixel; - else - abort(); - } - } - t = r1; r1 = r1b; r1b = t; - t = r2; r2 = r2b; r2b = t; + pixack_frame(p); for (i = 0; i < array_width; i += width) for (j = 0; j < array_height; j += height) #ifdef HAVE_XSHM_EXTENSION @@ -426,6 +509,6 @@ screenhack (Display *dpy, Window win) XSync(dpy, False); if (delay > 0) - usleep(delay); + usleep(1000 * delay); } } diff --git a/hacks/rorschach.c b/hacks/rorschach.c index 32b5aba8..627f1eb6 100644 --- a/hacks/rorschach.c +++ b/hacks/rorschach.c @@ -19,7 +19,7 @@ static GC draw_gc, erase_gc; static unsigned int default_fg_pixel; static int iterations, offset; static Bool xsym, ysym; -static int erase_speed, sleep_time, erase_mode; +static int sleep_time; static void init_rorschach (Display *dpy, Window window) @@ -115,8 +115,6 @@ char *defaults [] = { "*iterations: 4000", "*offset: 4", "*delay: 5", - "*eraseSpeed: 400", - "*eraseMode: -1", 0 }; @@ -127,16 +125,13 @@ XrmOptionDescRec options [] = { { "-ysymmetry", ".ysymmetry", XrmoptionNoArg, "true" }, { "-erase-speed", ".eraseSpeed", XrmoptionSepArg, 0 }, { "-delay", ".delay", XrmoptionSepArg, 0 }, - { "-erase-mode", ".eraseMode", XrmoptionSepArg, 0 }, { 0, 0, 0, 0 } }; void screenhack (Display *dpy, Window window) { - erase_speed = get_integer_resource("eraseSpeed", "Integer"); sleep_time = get_integer_resource("delay", "Integer"); - erase_mode = get_integer_resource("eraseMode", "Integer"); init_rorschach (dpy, window); while (1) hurm (dpy, window); diff --git a/hacks/swirl.c b/hacks/swirl.c index 7f3764f0..0d0f5abf 100644 --- a/hacks/swirl.c +++ b/hacks/swirl.c @@ -241,37 +241,18 @@ initialise_swirl(ModeInfo * mi, SWIRL_P swirl) * - swirl is the swirl data */ static void -initialise_image(Display * dpy, SWIRL_P swirl) +initialise_image(ModeInfo * mi, SWIRL_P swirl) { - unsigned int pad; - int bytes_per_line; - int image_depth = swirl->rdepth; - int data_depth = image_depth; - - /* On SGIs at least, using an XImage of depth 24 on a Visual of depth 24 - requires the XImage data to use 32 bits per pixel. I don't understand - how one is supposed to determine this -- maybe XListPixmapFormats? - But on systems that don't work this way, allocating 32 bpp instead of - 24 will be wasteful but non-fatal. -- jwz, 16-May-97. */ - if (data_depth >= 24 && data_depth < 32) - data_depth = 32; - - /* get the bitmap pad */ - pad = BitmapPad(dpy); - /* destroy the old image (destroy XImage and data) */ - if (swirl->ximage != NULL) - XDestroyImage(swirl->ximage); - - /* how many bytes per line? (bits rounded up to pad) */ - bytes_per_line = ((swirl->width * data_depth + pad - 1) / pad) * (pad / 8); - - /* allocate space for the image */ - swirl->image = (unsigned char *) calloc(bytes_per_line * swirl->height, 1); - - /* create an ximage with this */ - swirl->ximage = XCreateImage(dpy, swirl->visual, image_depth, ZPixmap, - 0, (char *) swirl->image, swirl->width, - swirl->height, pad, bytes_per_line); + Display *dpy = MI_DISPLAY(mi); + + if (swirl->ximage != NULL) + XDestroyImage(swirl->ximage); + + swirl->ximage = XCreateImage(dpy, swirl->visual, swirl->rdepth, ZPixmap, + 0, 0, swirl->width, swirl->height, + 8, 0); + swirl->ximage->data = swirl->image = + (unsigned char *) calloc(swirl->height, swirl->ximage->bytes_per_line); } /****************************************************************/ @@ -1272,7 +1253,7 @@ init_swirl(ModeInfo * mi) swirl->depth = 16; /* initialise image for speeding up drawing */ - initialise_image(display, swirl); + initialise_image(mi, swirl); /* clear the window (before setting the colourmap) */ XClearWindow(display, MI_WINDOW(mi)); diff --git a/hacks/vidwhacker b/hacks/vidwhacker new file mode 100755 index 00000000..44521963 --- /dev/null +++ b/hacks/vidwhacker @@ -0,0 +1,264 @@ +#!/bin/sh +# +# vidwhacker, for xscreensaver. Copyright (c) 1998 Jamie Zawinski. +# +# This script grabs a frame of video, then uses various pbm filters to +# munge the image in random nefarious ways, then uses xv to put it on +# the root window. This works out really nicely if you just feed some +# random TV station into it... +# +# The video grabbing part is SGI-specific -- if you want to use this on +# another system, add a new clause to the grab() procedure. + + +# Process command-line args... + +onroot=false +verbose=false +delay=3 + +if [ "$1" = "-root" ]; then + onroot=true + shift +fi + +if [ "$1" = "-verbose" ]; then + verbose=true + shift +fi + +if [ "$1" != "" ]; then + echo "usage: $0 [-root] [-verbose]" >&2 + exit 1 +fi + + +xvargs="-quick24" + +if [ "$onroot" = true ]; then + xvargs="$xvargs -root -rmode 5 -quit" +else + xvargs="$xvargs -geom +0+0" +fi + +screen_width=`xdpyinfo | sed -n 's/.* dimensions: *\([0-9]*\).*/\1/p'` + +# global vars... + +tmp=/tmp/vd$$ +tmp_rgb=$tmp-00000.rgb +tmp_ppm=$tmp.ppm +tmp_ppm2=$tmp-2.ppm +tmp_ppm3=$tmp-3.ppm + +clean() { + rm -f $tmp_rgb $tmp_ppm $tmp_ppm2 $tmp_ppm3 +} + + +# Grab a frame of video. +# +grab() { + if [ `uname` = IRIX ]; then + # + # SGI's "vidtomem" returns an SGI RGB image of the default video input, + # and has stupid non-overridable ouput-file-naming conventions. So, let + # it write its file; and then convert it to a pgm. + # + vidtomem -f $tmp + sgitopnm $tmp_rgb > $tmp_ppm + # Cut off the close-captioning blips in the NTSC overscan region. YMMV. + # | pnmcut 12 7 695 477 + + else + echo "$0: don't know how to grab video on this OS." >&2 + clean + exit 1 + fi + + + # I got this message from Marcus Herbert . + # I'm not sure of the best way to make the presence of qcam be + # auto-detected, but here's what he said, FYI... + # + # i am using a black/white Connectix Qcam on linux and its very simple + # to adept the script: + # + # # qcam: Version 0.91 + # # Options: + # # O -x width Set width + # # O y height Setheight + # # O B bpp Setbits per pixel + # # O W Auto-set white balance + # # O E "vals" Autoexposure mode, parameters required + # # O D Remove dark speckling + # # O s val Set scaling factor (1, 2, or 4) + # # + # qcam -x 320 -y 240 -B 6 -W -E 1 -D -s 1 > $tmp_ppm + # + # You dont really need the parameters for qcam as it reads out a system + # config file where you store the values for brightnes, contrast and + # white balance. But with this parameters you are independant of the + # light ratios at the place the cam is set up. + # + # Other versions of qcam (0.7, 0.96..) don't support the autoexposure and + # auto- whitebalance commandline parameters. On such systems (and on + # color-qcam systems) a simple qcam > $tmp_ppm (or cqcam > $tmp_ppm) is + # enough. + # + # I dont know about other systems but afaik fBSD uses the Qcam in this way: + # + # qcamcontrol -bla -foo -bar > picture.pgm + # +} + + +# Use perl to pick a random foreground/background color in pbm's syntax. +# +randcolor() { + perl -e 'srand; + printf("#%02x%02x%02x-#%02x%02x%02x", + int(rand()*60), + int(rand()*60), + int(rand()*60), + 120+int(rand()*135), + 120+int(rand()*135), + 120+int(rand()*135))' +} + +# Frobnicate the image in some random way. +# +frob() { + + N=`perl -e 'srand; print int(rand() * 10)'` + + if [ "$verbose" = true ]; then + echo "mode $N..." >&2 + fi + + if [ $N = 0 ]; then + ppmtopgm $tmp_ppm | pgmedge | pgmtoppm `randcolor` | ppmnorm + + elif [ $N = 1 ]; then + ppmtopgm $tmp_ppm | + pgmenhance | + pgmtoppm `randcolor` + + elif [ $N = 2 ]; then + ppmtopgm $tmp_ppm | pgmoil | pgmtoppm `randcolor` + + elif [ $N = 3 ]; then + ppmrelief $tmp_ppm | ppmtopgm | pgmedge | ppmrelief | ppmtopgm | + pgmedge | pnminvert | pgmtoppm `randcolor` + + elif [ $N = 4 ]; then + ppmspread 71 $tmp_ppm > $tmp_ppm2 + pnmarith -add $tmp_ppm $tmp_ppm2 + + elif [ $N = 5 ]; then + pnmflip -lr $tmp_ppm > $tmp_ppm2 + pnmarith -multiply $tmp_ppm $tmp_ppm2 > $tmp_ppm3 + pnmflip -tb $tmp_ppm3 | ppmnorm > $tmp_ppm2 + pnmarith -multiply $tmp_ppm $tmp_ppm2 + + elif [ $N = 6 ]; then + N2=`perl -e 'srand; print int(rand() * 3)'` + if [ $N2 = 0 ]; then + pnmflip -lr $tmp_ppm > $tmp_ppm2 + elif [ $N2 = 1 ]; then + pnmflip -tb $tmp_ppm > $tmp_ppm2 + else + pnmflip -lr $tmp_ppm > $tmp_ppm2 + pnmflip -tb $tmp_ppm2 > $tmp_ppm3 + cp $tmp_ppm3 $tmp_ppm2 + fi + + pnmarith -difference $tmp_ppm $tmp_ppm2 + + elif [ $N = 7 ]; then + + for i in 1 2 3 ; do + ppmtopgm $tmp_ppm | pgmedge > $tmp_ppm2 + pnmarith -difference $tmp_ppm $tmp_ppm2 > $tmp_ppm3 + cp $tmp_ppm3 $tmp_ppm + done + ppmnorm < $tmp_ppm + + elif [ $N = 8 ]; then + pnmflip -lr $tmp_ppm > $tmp_ppm2 + pnmarith -multiply $tmp_ppm $tmp_ppm2 | ppmrelief | ppmnorm | pnminvert + + elif [ $N = 9 ]; then + pnmflip -lr $tmp_ppm > $tmp_ppm2 + pnmarith -subtract $tmp_ppm $tmp_ppm2 | ppmrelief | ppmtopgm | pgmedge + + else cat $tmp_ppm + fi +} + + + +# Grab a frame and frob it. leave it in $tmp_ppm3. +# +whack() { + clean + + while [ ! -f $tmp_ppm ]; do + grab + done + + rm -f $tmp_rgb + frob | pnmscale -width $screen_width > $tmp_ppm3 + rm -f $tmp_ppm $tmp_ppm2 +} + + +pid="" + +if [ "$onroot" != true ]; then + trap "kill \$pid; clean; exit 1" 2 15 +fi + +while true; do + + # Loop grabbing and frobbing images. + # + # If we're running on the root, run xv in the foreground (with -exit) + # and then wait. + # + # If we're running in a window, spawn xv in the background; then when + # it's time to put up the new image, kill off the currently-running xv. + + if [ "$verbose" = true ]; then + whack + else + whack >&- 2>&- + fi + + if [ "$pid" != "" ]; then + kill $pid + pid="" + fi + + if [ ! -s $tmp_ppm3 ]; then + echo "$0: no image grabbed" >&2 + else + + pnmtosgi < $tmp_ppm3 > $tmp_ppm2 + rm -f $tmp_ppm3 + + if [ "$onroot" = true ]; then + xv $xvargs $tmp_ppm2 + else + xv $xvargs $tmp_ppm2 & + pid=$! + fi + + #xv -geom =320x220 $tmp_ppm3 & + #pid= + fi + + clean + sleep $delay + +done diff --git a/hacks/xlockmore.c b/hacks/xlockmore.c index d7185de9..a1e71aa2 100644 --- a/hacks/xlockmore.c +++ b/hacks/xlockmore.c @@ -197,6 +197,7 @@ xlockmore_screenhack (Display *dpy, Window window, XColor color; int i; time_t start, now; + int orig_pause; memset(&mi, 0, sizeof(mi)); mi.dpy = dpy; @@ -321,6 +322,7 @@ xlockmore_screenhack (Display *dpy, Window window, mi.pause = 0; else if (mi.pause > 100000000) mi.pause = 100000000; + orig_pause = mi.pause; xlockmore_read_resources (); @@ -335,6 +337,7 @@ xlockmore_screenhack (Display *dpy, Window window, XSync(dpy, False); if (mi.pause) usleep(mi.pause); + mi.pause = orig_pause; if (hack_free) { diff --git a/hacks/xlockmore.h b/hacks/xlockmore.h index 23f350e9..91790554 100644 --- a/hacks/xlockmore.h +++ b/hacks/xlockmore.h @@ -1,5 +1,5 @@ /* xlockmore.h --- xscreensaver compatibility layer for xlockmore modules. - * xscreensaver, Copyright (c) 1997 Jamie Zawinski + * xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -34,7 +34,7 @@ ERROR! Sorry, xlockmore.h requires ANSI C (gcc, for example.) #ifdef USE_GL # include - extern GLXContext init_GL (ModeInfo *); + extern GLXContext *init_GL (ModeInfo *); # define FreeAllGL(dpy) /* */ #endif @@ -74,6 +74,8 @@ ERROR! Sorry, xlockmore.h requires ANSI C (gcc, for example.) #define MI_BATCHCOUNT(MI) ((MI)->batchcount) #define MI_SIZE(MI) ((MI)->size) +#define MI_CLEARWINDOW(mi) XClearWindow(MI_DISPLAY(mi), MI_WINDOW(mi)) + /* Some other utility macros. */ #define SINF(n) ((float)sin((double)(n))) diff --git a/hacks/xroger-hack.c b/hacks/xroger-hack.c index 32e1e4b3..d8db872c 100644 --- a/hacks/xroger-hack.c +++ b/hacks/xroger-hack.c @@ -70,6 +70,8 @@ screenhack (dpy, window) x = random () % (w - ww); y = random () % (h - hh); XClearWindow (dpy, window); + + skull (dpy, window, draw_gc, erase_gc, x, y, ww, hh); XSync (dpy, True); start_time = time ((time_t *) 0); @@ -84,7 +86,7 @@ screenhack (dpy, window) rgb_to_hsv (color2.red, color2.green, color2.blue, &H, &S, &V); V += delta; if (V >= 1.0) V = 1.0, delta = -delta; - if (V <= 0.7) V = 0.7, delta = -delta; + if (V <= 0.6) V = 0.7, delta = -delta; hsv_to_rgb (H, S, V, &color2.red, &color2.green, &color2.blue); color3 = color2; if (XAllocColor (dpy, cmap, &color3)) diff --git a/setup.com b/setup.com index 881d30f9..2f4c977e 100644 --- a/setup.com +++ b/setup.com @@ -10,6 +10,7 @@ $ bouboule :== $'mydir'bouboule $ braid :== $'mydir'braid $ bubbles :== $'mydir'bubbles $ coral :== $'mydir'coral +$ cynosure :== $'mydir'cynosure $ decayscreen :== $'mydir'decayscreen $ deco :== $'mydir'deco $ drift :== $'mydir'drift @@ -36,6 +37,7 @@ $ lissie :== $'mydir'lissie $ lmorph :== $'mydir'lmorph $ maze :== $'mydir'maze $ moire :== $'mydir'moire +$ moire2 :== $'mydir'moire2 $ mountain :== $'mydir'mountain $ munch :== $'mydir'munch $ noseguy :== $'mydir'noseguy diff --git a/utils/Makefile.in b/utils/Makefile.in index 6828083c..663ba2c9 100644 --- a/utils/Makefile.in +++ b/utils/Makefile.in @@ -21,7 +21,7 @@ SHELL = /bin/sh X_CFLAGS = @X_CFLAGS@ -INCLUDES = -I$(srcdir) -I$(srcdir)/.. @INCLUDES@ +INCLUDES = -I$(srcdir) -I$(srcdir)/.. -I.. @INCLUDES@ SRCS = alpha.c colors.c fade.c grabscreen.c hsv.c overlay.c \ resources.c spline.c usleep.c visual.c xmu.c xroger.c \ @@ -56,7 +56,7 @@ clean: -rm -f *.o a.out core distclean: clean - -rm -f Makefile *~ "#"* + -rm -f config.h Makefile *~ "#"* # Adds all current dependencies to Makefile depend: @@ -78,7 +78,8 @@ distdepend:: ( \ awk '/^# .*Makefile.in ---/,/^# DO .*distdepend/' < Makefile.in ; \ sed -e 's@ \./@ @g;s@ /[^ ]*@@g;/^.*:$$/d' \ - -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' ; \ + -e 's@ \([^$$]\)@ $$(srcdir)/\1@g' \ + -e 's@ $$(srcdir)/\(.*config.h\)@ \1@g' ; \ echo '' \ ) > /tmp/distdepend.$$$$ && \ mv Makefile.in Makefile.in.bak && \ @@ -126,24 +127,24 @@ distdepend:: compile_axp.com compile_decc.com # DO NOT DELETE: updated by make distdepend alpha.o: $(srcdir)/utils.h -alpha.o: $(srcdir)/../config.h +alpha.o: ../config.h alpha.o: $(srcdir)/alpha.h alpha.o: $(srcdir)/hsv.h alpha.o: $(srcdir)/yarandom.h alpha.o: $(srcdir)/resources.h colors.o: $(srcdir)/utils.h -colors.o: $(srcdir)/../config.h +colors.o: ../config.h colors.o: $(srcdir)/hsv.h colors.o: $(srcdir)/yarandom.h colors.o: $(srcdir)/visual.h colors.o: $(srcdir)/colors.h fade.o: $(srcdir)/utils.h -fade.o: $(srcdir)/../config.h +fade.o: ../config.h fade.o: $(srcdir)/visual.h fade.o: $(srcdir)/usleep.h fade.o: $(srcdir)/fade.h grabscreen.o: $(srcdir)/utils.h -grabscreen.o: $(srcdir)/../config.h +grabscreen.o: ../config.h grabscreen.o: $(srcdir)/yarandom.h grabscreen.o: $(srcdir)/usleep.h grabscreen.o: $(srcdir)/colors.h @@ -153,35 +154,37 @@ grabscreen.o: $(srcdir)/visual.h grabscreen.o: $(srcdir)/resources.h grabscreen.o: $(srcdir)/vroot.h hsv.o: $(srcdir)/utils.h -hsv.o: $(srcdir)/../config.h +hsv.o: ../config.h hsv.o: $(srcdir)/hsv.h overlay.o: $(srcdir)/utils.h -overlay.o: $(srcdir)/../config.h +overlay.o: ../config.h overlay.o: $(srcdir)/visual.h resources.o: $(srcdir)/utils.h -resources.o: $(srcdir)/../config.h +resources.o: ../config.h resources.o: $(srcdir)/resources.h spline.o: $(srcdir)/utils.h -spline.o: $(srcdir)/../config.h +spline.o: ../config.h spline.o: $(srcdir)/spline.h -usleep.o: $(srcdir)/../config.h +usleep.o: ../config.h visual.o: $(srcdir)/utils.h -visual.o: $(srcdir)/../config.h +visual.o: ../config.h visual.o: $(srcdir)/resources.h visual.o: $(srcdir)/visual.h -xmu.o: $(srcdir)/../config.h +xmu.o: ../config.h xroger.o: $(srcdir)/utils.h -xroger.o: $(srcdir)/../config.h -yarandom.o: $(srcdir)/../config.h +xroger.o: ../config.h +xroger.o: $(srcdir)/spline.h +yarandom.o: ../config.h yarandom.o: $(srcdir)/yarandom.h erase.o: $(srcdir)/utils.h -erase.o: $(srcdir)/../config.h +erase.o: ../config.h erase.o: $(srcdir)/yarandom.h erase.o: $(srcdir)/usleep.h erase.o: $(srcdir)/resources.h sgivideo.o: $(srcdir)/utils.h -sgivideo.o: $(srcdir)/../config.h +sgivideo.o: ../config.h sgivideo.o: $(srcdir)/sgivideo.h sgivideo.o: $(srcdir)/resources.h +sgivideo.o: $(srcdir)/visual.h sgivideo.o: $(srcdir)/usleep.h diff --git a/utils/erase.c b/utils/erase.c index 72f5a87a..874ed925 100644 --- a/utils/erase.c +++ b/utils/erase.c @@ -10,182 +10,307 @@ #include "usleep.h" #include "resources.h" -#define NUM_MODES 8 +#undef countof +#define countof(x) (sizeof(x)/sizeof(*(x))) -void -erase_window(Display *dpy, Window window, GC gc, - int width, int height, int mode, int delay) +typedef void (*Eraser) (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity); + + +static void +random_lines (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) +{ + Bool horiz_p = (random() & 1); + int max = (horiz_p ? height : width); + int *lines = (int *) calloc(max, sizeof(*lines)); + int i; + + for (i = 0; i < max; i++) + lines[i] = i; + + for (i = 0; i < max; i++) + { + int t, r; + t = lines[i]; + r = random() % max; + lines[i] = lines[r]; + lines[r] = t; + } + + for (i = 0; i < max; i++) + { + if (horiz_p) + XDrawLine (dpy, window, gc, 0, lines[i], width, lines[i]); + else + XDrawLine (dpy, window, gc, lines[i], 0, lines[i], height); + + XSync (dpy, False); + if (delay > 0 && ((i % granularity) == 0)) + usleep (delay * granularity); + } + free(lines); +} + + +static void +venetian (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) +{ + Bool horiz_p = (random() & 1); + Bool flip_p = (random() & 1); + int max = (horiz_p ? height : width); + int *lines = (int *) calloc(max, sizeof(*lines)); + int i, j; + + granularity /= 6; + + j = 0; + for (i = 0; i < max*2; i++) + { + int line = ((i / 16) * 16) - ((i % 16) * 15); + if (line >= 0 && line < max) + lines[j++] = (flip_p ? max - line : line); + } + + for (i = 0; i < max; i++) + { + if (horiz_p) + XDrawLine (dpy, window, gc, 0, lines[i], width, lines[i]); + else + XDrawLine (dpy, window, gc, lines[i], 0, lines[i], height); + + XSync (dpy, False); + if (delay > 0 && ((i % granularity) == 0)) + usleep (delay * granularity); + } + free(lines); +} + + +static void +triple_wipe (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) { - int *clear_lines; - int i, j, line, num_lines=0, granularity, max_num; + Bool flip_x = random() & 1; + Bool flip_y = random() & 1; + int max = width + (height / 2); + int *lines = (int *)calloc(max, sizeof(int)); + int i; + + for(i = 0; i < width/2; i++) + lines[i] = i*2+height; + for(i = 0; i < height/2; i++) + lines[i+width/2] = i*2; + for(i = 0; i < width/2; i++) + lines[i+width/2+height/2] = width-i*2-(width%2?0:1)+height; + + granularity /= 6; - max_num = 2*height; - if(2*width>max_num) - max_num = 2*width; + for (i = 0; i < max; i++) + { + int x, y, x2, y2; + if (lines[i] < height) + x = 0, y = lines[i], x2 = width, y2 = y; + else + x = lines[i]-height, y = 0, x2 = x, y2 = height; - clear_lines = (int *)calloc(max_num, sizeof(int)); - if(clear_lines) + if (flip_x) + x = width-x, x2 = width-x2; + if (flip_y) + y = height-y, y2 = height-y2; + + XDrawLine (dpy, window, gc, x, y, x2, y2); + XSync (dpy, False); + if (delay > 0 && ((i % granularity) == 0)) + usleep (delay*granularity); + } + free(lines); +} + + +static void +quad_wipe (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) +{ + Bool flip_x = random() & 1; + Bool flip_y = random() & 1; + int max = width + height; + int *lines = (int *)calloc(max, sizeof(int)); + int i; + + granularity /= 3; + + for (i = 0; i < max/4; i++) { - if(mode<0 || mode>=NUM_MODES) - mode = random()%NUM_MODES; - granularity = 25; - switch(mode) - { - case 0: /* clear random horizontal lines */ - for(i = 0; i < height; i++) - clear_lines[i] = i; - for(i = 0; i < height; i++) - { - int t, r; - t = clear_lines[i]; - r = random()%height; - clear_lines[i] = clear_lines[r]; - clear_lines[r] = t; - } - num_lines = height; - break; - - case 1: /* clear random vertical lines */ - for(i = 0; i < width; i++) - clear_lines[i] = i+height; - for(i = 0; i < width; i++) - { - int t, r; - t = clear_lines[i]; - r = random()%width; - clear_lines[i] = clear_lines[r]; - clear_lines[r] = t; - } - num_lines = width; - break; - - case 2: /* 4 sequential wipes, - L-R, T-B, R-L, B-T. */ - for(i = 0; i < width/2; i++) - clear_lines[i] = i*2+height; - for(i = 0; i < height/2; i++) - clear_lines[i+width/2] = i*2; - for(i = 0; i < width/2; i++) - clear_lines[i+width/2+height/2] = width-i*2-(width%2?0:1)+height; - num_lines = width+height/2; - granularity = 4; - break; - - case 3: /* 4 parallel wipes, - L-R, T-B, R-L, B-T. */ - for(i = 0; i < max_num/4; i++) - { - clear_lines[i*4] = i*2; - clear_lines[i*4+1] = height-i*2-(height%2?0:1); - clear_lines[i*4+2] = height+i*2; - clear_lines[i*4+3] = height+width-i*2-(width%2?0:1); - } - num_lines = max_num; - granularity = 4; - break; - - case 4: /* flutter wipe L-R */ - j = 0; - for(i = 0; i < width*2; i++) - { - line = (i/16)*16-(i%16)*15; - if(line>=0 && line= 0; i--) - { - line = (i/16)*16-(i%16)*15; - if(line>=0 && line height ? width : height); - if (random() & 1) - inc = -inc; - for (i = (inc > 0 ? 0 : full); - (inc > 0 ? i < full : i > 0); - i += inc) { - XFillArc(dpy, window, gc, - (width/2)-rad, (height/2)-rad, rad*2, rad*2, - (i+start) % full, inc); - XFlush (dpy); - usleep (delay*granularity); - } - num_lines = 0; - } - break; - - case 7: /* three-circle wipe */ - { - int full = 360 * 64; - int q = full / 3; - int inc = full / 180; - int start = random() % q; - int rad = (width > height ? width : height); - if (random() & 1) - inc = -inc; - for (i = (inc > 0 ? 0 : q); - (inc > 0 ? i < q : i > 0); - i += inc) { - XFillArc(dpy, window, gc, - (width/2)-rad, (height/2)-rad, rad*2, rad*2, - (i+start) % full, inc); - XFillArc(dpy, window, gc, - (width/2)-rad, (height/2)-rad, rad*2, rad*2, - (i+start+q) % full, inc); - XFillArc(dpy, window, gc, - (width/2)-rad, (height/2)-rad, rad*2, rad*2, - (i+start+q+q) % full, inc); - XFlush (dpy); - usleep (delay*granularity); - } - num_lines = 0; - } - break; - - default: - abort(); - break; - } - - for (i = 0; i < num_lines; i++) - { - if(clear_lines[i] < height) - XDrawLine (dpy, window, gc, 0, clear_lines[i], width, - clear_lines[i]); - else - XDrawLine (dpy, window, gc, clear_lines[i]-height, 0, - clear_lines[i]-height, height); - XFlush (dpy); - if ((i % granularity) == 0) - { - usleep (delay*granularity); - } - } - - free(clear_lines); + lines[i*4] = i*2; + lines[i*4+1] = height-i*2-(height%2?0:1); + lines[i*4+2] = height+i*2; + lines[i*4+3] = height+width-i*2-(width%2?0:1); } + for (i = 0; i < max; i++) + { + int x, y, x2, y2; + if (lines[i] < height) + x = 0, y = lines[i], x2 = width, y2 = y; + else + x = lines[i]-height, y = 0, x2 = x, y2 = height; + + if (flip_x) + x = width-x, x2 = width-x2; + if (flip_y) + y = height-y, y2 = height-y2; + + XDrawLine (dpy, window, gc, x, y, x2, y2); + XSync (dpy, False); + if (delay > 0 && ((i % granularity) == 0)) + usleep (delay*granularity); + } + free(lines); +} + + + +static void +circle_wipe (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) +{ + int full = 360 * 64; + int inc = full / 64; + int start = random() % full; + int rad = (width > height ? width : height); + int i; + if (random() & 1) + inc = -inc; + for (i = (inc > 0 ? 0 : full); + (inc > 0 ? i < full : i > 0); + i += inc) + { + XFillArc(dpy, window, gc, + (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (i+start) % full, inc); + XFlush (dpy); + usleep (delay*granularity); + } +} + + +static void +three_circle_wipe (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) +{ + int i; + int full = 360 * 64; + int q = full / 6; + int q2 = q * 2; + int inc = full / 240; + int start = random() % q; + int rad = (width > height ? width : height); + + for (i = 0; i < q; i += inc) + { + XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (start+i) % full, inc); + XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (start-i) % full, -inc); + + XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (start+q2+i) % full, inc); + XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (start+q2-i) % full, -inc); + + XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (start+q2+q2+i) % full, inc); + XFillArc(dpy, window, gc, (width/2)-rad, (height/2)-rad, rad*2, rad*2, + (start+q2+q2-i) % full, -inc); + + XSync (dpy, False); + usleep (delay*granularity); + } +} + + +static void +squaretate (Display *dpy, Window window, GC gc, + int width, int height, int delay, int granularity) +{ + int steps = (((width > height ? width : width) * 2) / granularity); + int i; + Bool flip = random() & 1; + +#define DRAW() \ + if (flip) { \ + points[0].x = width-points[0].x; \ + points[1].x = width-points[1].x; \ + points[2].x = width-points[2].x; } \ + XFillPolygon (dpy, window, gc, points, 3, Convex, CoordModeOrigin) + + for (i = 0; i < steps; i++) + { + XPoint points [3]; + points[0].x = 0; + points[0].y = 0; + points[1].x = width; + points[1].y = 0; + points[2].x = 0; + points[2].y = points[0].y + ((i * height) / steps); + DRAW(); + + points[0].x = 0; + points[0].y = 0; + points[1].x = 0; + points[1].y = height; + points[2].x = ((i * width) / steps); + points[2].y = height; + DRAW(); + + points[0].x = width; + points[0].y = height; + points[1].x = 0; + points[1].y = height; + points[2].x = width; + points[2].y = height - ((i * height) / steps); + DRAW(); + + points[0].x = width; + points[0].y = height; + points[1].x = width; + points[1].y = 0; + points[2].x = width - ((i * width) / steps); + points[2].y = 0; + DRAW(); + + XSync (dpy, True); + if (delay > 0) + usleep (delay * granularity); + } +#undef DRAW +} + + + + +static Eraser erasers[] = { + random_lines, + venetian, + triple_wipe, + quad_wipe, + circle_wipe, + three_circle_wipe, + squaretate, +}; + + +void +erase_window(Display *dpy, Window window, GC gc, + int width, int height, int mode, int delay) +{ + int granularity = 25; + + if (mode < 0 || mode >= countof(erasers)) + mode = random() % countof(erasers); + (*(erasers[mode])) (dpy, window, gc, width, height, delay, granularity); XClearWindow (dpy, window); XSync(dpy, False); } @@ -198,8 +323,23 @@ erase_full_window(Display *dpy, Window window) XGCValues gcv; GC erase_gc; XColor black; - int erase_speed = get_integer_resource("eraseSpeed", "Integer"); - int erase_mode = get_integer_resource("eraseMode", "Integer"); + int erase_speed, erase_mode; + char *s; + + s = get_string_resource("eraseSpeed", "Integer"); + if (s && *s) + erase_speed = get_integer_resource("eraseSpeed", "Integer"); + else + erase_speed = 400; + if (s) free(s); + + s = get_string_resource("eraseMode", "Integer"); + if (s && *s) + erase_mode = get_integer_resource("eraseMode", "Integer"); + else + erase_mode = -1; + if (s) free(s); + XGetWindowAttributes (dpy, window, &xgwa); black.flags = DoRed|DoGreen|DoBlue; black.red = black.green = black.blue = 0; @@ -211,3 +351,47 @@ erase_full_window(Display *dpy, Window window) XFreeColors(dpy, xgwa.colormap, &black.pixel, 1, 0); XFreeGC(dpy, erase_gc); } + + + +#if 0 +#include "screenhack.h" + +char *progclass = "Erase"; +char *defaults [] = { + 0 +}; + +XrmOptionDescRec options [] = {0}; +int options_size = 0; + +void +screenhack (dpy, window) + Display *dpy; + Window window; +{ + int delay = 500000; + XGCValues gcv; + GC gc; + XColor white; + XWindowAttributes xgwa; + XGetWindowAttributes (dpy, window, &xgwa); + white.flags = DoRed|DoGreen|DoBlue; + white.red = white.green = white.blue = 0xFFFF; + XAllocColor(dpy, xgwa.colormap, &white); + gcv.foreground = white.pixel; + gc = XCreateGC (dpy, window, GCForeground, &gcv); + + while (1) + { + XFillRectangle(dpy, window, gc, 0, 0, 1280, 1024); + XSync (dpy, False); + usleep (delay); + erase_full_window(dpy, window); + XSync (dpy, False); + usleep (delay); + + } +} + +#endif diff --git a/utils/fade.c b/utils/fade.c index eed53221..9622c31e 100644 --- a/utils/fade.c +++ b/utils/fade.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1992-1997 Jamie Zawinski +/* xscreensaver, Copyright (c) 1992-1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -89,6 +89,24 @@ fade_screens (Display *dpy, Colormap *cmaps, Window *black_windows, int seconds, int ticks, Bool out_p, Bool clear_windows) { + int oseconds = seconds; + Bool was_in_p = !out_p; + + /* When we're asked to fade in, first fade out, then fade in. + That way all the transitions are smooth -- from what's on the + screen, to black, to the desktop. + */ + if (was_in_p) + { + clear_windows = True; + out_p = True; + seconds /= 3; + if (seconds == 0) + seconds = 1; + } + + AGAIN: + #ifdef HAVE_SGI_VC_EXTENSION /* First try to do it by fading the gamma in an SGI-specific way... */ if (0 != sgi_gamma_fade(dpy, black_windows, seconds, ticks, out_p, @@ -98,6 +116,19 @@ fade_screens (Display *dpy, Colormap *cmaps, Window *black_windows, there are TrueColor windows visible. */ fade_screens_1 (dpy, cmaps, black_windows, seconds, ticks, out_p, clear_windows); + + /* If we were supposed to be fading in, do so now (we just faded out, + so now fade back in.) + */ + if (was_in_p) + { + was_in_p = False; + out_p = False; + seconds = oseconds * 2 / 3; + if (seconds == 0) + seconds = 1; + goto AGAIN; + } } @@ -291,13 +322,15 @@ fade_screens_1 (Display *dpy, Colormap *cmaps, Window *black_windows, releasing the colormaps. */ if (out_p && black_windows) - for (i = 0; i < nscreens; i++) - { - if (clear_windows) - XClearWindow (dpy, black_windows[i]); - XMapRaised (dpy, black_windows[i]); - } - + { + for (i = 0; i < nscreens; i++) + { + if (clear_windows) + XClearWindow (dpy, black_windows[i]); + XMapRaised (dpy, black_windows[i]); + } + XSync(dpy, False); + } /* Now put the target maps back. If we're fading out, use the given cmap (or the default cmap, if none.) @@ -425,6 +458,7 @@ sgi_gamma_fade (Display *dpy, { XUnmapWindow (dpy, black_windows[screen]); XClearWindow (dpy, black_windows[screen]); + XSync(dpy, False); } } @@ -490,6 +524,12 @@ sgi_gamma_fade (Display *dpy, XSync(dpy, False); } + /* I can't explain this; without this delay, we get a flicker. + I suppose there's some lossage with stale bits being in the + hardware frame buffer or something, and this delay gives it + time to flush out. This sucks! */ + usleep(100000); /* 1/10th second */ + for (screen = 0; screen < nscreens; screen++) whack_gamma(dpy, screen, &info[screen], 1.0); XSync(dpy, False); @@ -507,6 +547,7 @@ sgi_gamma_fade (Display *dpy, if (info[screen].blue2) free (info[screen].blue2); } free(info); + return status; } @@ -515,6 +556,7 @@ whack_gamma(Display *dpy, int screen, struct screen_gamma_info *info, float ratio) { int k; + if (ratio < 0) ratio = 0; if (ratio > 1) ratio = 1; for (k = 0; k < info->gamma_size; k++) @@ -523,6 +565,7 @@ whack_gamma(Display *dpy, int screen, struct screen_gamma_info *info, info->green2[k] = info->green1[k] * ratio; info->blue2[k] = info->blue1[k] * ratio; } + XSGIvcStoreGammaColors16(dpy, screen, info->gamma_map, info->nred, XSGIVC_MComponentRed, info->red2); XSGIvcStoreGammaColors16(dpy, screen, info->gamma_map, info->ngreen, diff --git a/utils/grabscreen.c b/utils/grabscreen.c index edc6acb3..78c21163 100644 --- a/utils/grabscreen.c +++ b/utils/grabscreen.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1992, 1993, 1994, 1997 +/* xscreensaver, Copyright (c) 1992, 1993, 1994, 1997, 1998 * Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its @@ -522,13 +522,23 @@ read_display (Screen *screen, Window window, Pixmap into_pixmap, return False; } - /* Uh, this can't be right, can it? But it's necessary. X sucks. - If the visual is of depth 24, but the image came back as depth 32, - hack it to be 24 lest we get a BadMatch from XPutImage. (I presume - I'm expected to look at the server's pixmap formats or some such - nonsense... but fuck it.) + /* XReadDisplay tends to LIE about the depth of the image it read. + It is returning an XImage which has `depth' and `bits_per_pixel' + confused! + + That is, on a 24-bit display, where all visuals claim depth 24, and + where XGetImage would return an XImage with depth 24, and where + XPutImage will get a BadMatch with images that are not depth 24, + XReadDisplay is returning images with depth 32! Fuckwits! + + So if the visual is of depth 24, but the image came back as depth 32, + hack it to be 24 lest we get a BadMatch from XPutImage. + + I wonder what happens on an 8-bit SGI... Probably it still returns + an image claiming depth 32? Certainly it can't be 8. So, let's just + smash it to 32... */ - if (xgwa.depth == 24 && image->depth == 32) + if (image->depth == 32 /* && xgwa.depth == 24 */ ) image->depth = 24; /* If the visual of the window/pixmap into which we're going to draw is diff --git a/utils/resources.c b/utils/resources.c index 82748231..d13fb820 100644 --- a/utils/resources.c +++ b/utils/resources.c @@ -1,4 +1,5 @@ -/* xscreensaver, Copyright (c) 1992, 1997 Jamie Zawinski +/* xscreensaver, Copyright (c) 1992, 1997, 1998 + * Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -125,6 +126,8 @@ get_pixel_resource (char *res_name, char *res_class, for (s2 = s + strlen(s) - 1; s2 > s; s2--) if (*s2 == ' ' || *s2 == '\t') *s2 = 0; + else + break; if (! XParseColor (dpy, cmap, s, &color)) { diff --git a/utils/sgivideo.c b/utils/sgivideo.c index fa2dcdff..13fb7a3c 100644 --- a/utils/sgivideo.c +++ b/utils/sgivideo.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1997 Jamie Zawinski +/* xscreensaver, Copyright (c) 1997, 1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -33,6 +33,7 @@ #include "utils.h" #include "sgivideo.h" #include "resources.h" +#include "visual.h" #ifdef HAVE_SGI_VIDEO /* whole file */ @@ -51,6 +52,39 @@ static Bool dark_image_p(unsigned long *image, int width, int height); static Bool install_video_frame(unsigned long *image, int width, int height, Screen *screen, Visual *visual, Drawable dest); +#ifdef DEBUG +static void +describe_input(const char *prefix, VLServer server, int camera) +{ + VLDevList dl; + int i, j; + + if (camera == VL_ANY) + { + printf("%s: %s VL_ANY\n", progname, prefix); + return; + } + + vlGetDeviceList(server, &dl); + for (i = 0; i < dl.numDevices; i++) + { + VLDevice *d = &dl.devices[i]; + for (j = 0; j < d->numNodes; j++) + if (d->nodes[j].number == camera) + { + printf("%s: %s %d, \"%s\"\n", progname, prefix, + d->nodes[j].number, + d->nodes[j].name); + return; + } + } + + /* else... */ + printf("%s: %s %d (???)\n", progname, prefix, camera); +} +#endif /* DEBUG */ + + static Bool grab_frame_1(Screen *screen, Visual *visual, Drawable dest, int camera) { @@ -76,6 +110,10 @@ grab_frame_1(Screen *screen, Visual *visual, Drawable dest, int camera) goto DONE; } +#ifdef DEBUG + describe_input("trying device", server, camera); +#endif /* DEBUG */ + input = vlGetNode (server, VL_SRC, VL_VIDEO, camera); output = vlGetNode (server, VL_DRN, VL_MEM, VL_ANY); @@ -201,6 +239,10 @@ grab_frame_1(Screen *screen, Visual *visual, Drawable dest, int camera) goto DONE; } +#ifdef DEBUG + describe_input("read device", server, camera); +#endif /* DEBUG */ + if (dark_image_p(image, width, height)) goto DONE; @@ -275,14 +317,14 @@ grab_video_frame(Screen *screen, Visual *visual, Drawable dest) else { int i; + VLServer server = vlOpenVideo (NULL); for (i = 0; i < 5; i++) /* if we get all black images, retry up to five times. */ { - VLServer server = vlOpenVideo (NULL); VLDevList dl; int j; vlGetDeviceList(server, &dl); - vlCloseVideo (server); + vlCloseVideo(server); for (j = 0; j < dl.numDevices; j++) { VLDevice *d = &dl.devices[j]; @@ -292,8 +334,8 @@ grab_video_frame(Screen *screen, Visual *visual, Drawable dest) d->nodes[k].kind == VL_VIDEO) if (grab_frame_1(screen, visual, dest, d->nodes[k].number)) return True; + /* nothing yet? go around and try again... */ } - /* nothing yet? go around and try again... */ } } #ifdef DEBUG @@ -315,6 +357,7 @@ install_video_frame(unsigned long *image, int width, int height, XGCValues gcv; GC gc; XImage *ximage = 0; + int image_depth; Bool free_data = False; int vblank_kludge = 3; /* lose the closed-captioning blips... */ @@ -332,16 +375,16 @@ install_video_frame(unsigned long *image, int width, int height, gcv.foreground = BlackPixelOfScreen(screen); gc = XCreateGC (dpy, dest, GCFunction|GCForeground, &gcv); - ximage = XCreateImage (dpy, visual, 32, ZPixmap, 0, (char *) image, + image_depth = visual_depth(screen, visual); + if (image_depth < 24) + image_depth = 24; /* We'll dither */ + + ximage = XCreateImage (dpy, visual, image_depth, ZPixmap, 0, (char *) image, width, height, 8, 0); XInitImage(ximage); if (!ximage) return False; - if (ximage->depth == 32 && d == 24) - ximage->depth = d; - - if (gain > 0.0) /* Pump up the volume */ { unsigned char *end = (unsigned char *) (image + (width * height)); diff --git a/utils/version.h b/utils/version.h index cdd03fbe..5539daab 100644 --- a/utils/version.h +++ b/utils/version.h @@ -1,2 +1,2 @@ static const char screensaver_id[] = - "@(#)xscreensaver 2.14, by Jamie Zawinski (jwz@netscape.com)"; + "@(#)xscreensaver 2.16, by Jamie Zawinski (jwz@netscape.com)"; diff --git a/utils/visual.c b/utils/visual.c index 42ce36e8..c8364360 100644 --- a/utils/visual.c +++ b/utils/visual.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1993, 1994, 1995, 1996, 1997 +/* xscreensaver, Copyright (c) 1993, 1994, 1995, 1996, 1997, 1998 * by Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its @@ -303,6 +303,39 @@ visual_depth (Screen *screen, Visual *visual) } +#if 0 +/* You very probably don't want to be using this. + Pixmap depth doesn't refer to the depths of pixmaps, but rather, to + the depth of protocol-level on-the-wire pixmap data, that is, XImages. + To get this info, you should be looking at XImage->bits_per_pixel + instead. (And allocating the data for your XImage structures by + multiplying ximage->bytes_per_line by ximage->height.) + */ +int +visual_pixmap_depth (Screen *screen, Visual *visual) +{ + Display *dpy = DisplayOfScreen (screen); + int vdepth = visual_depth (screen, visual); + int pdepth = vdepth; + int i, pfvc = 0; + XPixmapFormatValues *pfv = XListPixmapFormats (dpy, &pfvc); + + /* Return the first matching depth in the pixmap formats. If there are no + matching pixmap formats (which shouldn't be able to happen at all) then + return the visual depth instead. */ + for (i = 0; i < pfvc; i++) + if (pfv[i].depth == vdepth) + { + pdepth = pfv[i].bits_per_pixel; + break; + } + if (pfv) + XFree (pfv); + return pdepth; +} +#endif /* 0 */ + + int visual_class (Screen *screen, Visual *visual) { diff --git a/utils/visual.h b/utils/visual.h index 1d033db3..14820a9c 100644 --- a/utils/visual.h +++ b/utils/visual.h @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1997 by Jamie Zawinski +/* xscreensaver, Copyright (c) 1993-1998 by Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -15,6 +15,7 @@ extern Visual *get_visual (Screen *, const char *name, Bool, Bool); extern Visual *get_visual_resource (Screen *, char *, char *, Bool); extern int visual_depth (Screen *, Visual *); +/* extern int visual_pixmap_depth (Screen *, Visual *); */ extern int visual_class (Screen *, Visual *); extern int visual_cells (Screen *, Visual *); extern int screen_number (Screen *); diff --git a/utils/xroger.c b/utils/xroger.c index ec1b465e..e64d2899 100644 --- a/utils/xroger.c +++ b/utils/xroger.c @@ -1,4 +1,4 @@ -/* xscreensaver, Copyright (c) 1991-1993 Jamie Zawinski +/* xscreensaver, Copyright (c) 1991-1998 Jamie Zawinski * * Permission to use, copy, modify, distribute, and sell this software and its * documentation for any purpose is hereby granted without fee, provided that @@ -18,79 +18,117 @@ crossbones (Display *dpy, Window window, GC draw_gc, double xscale = w / 440.0; double yscale = h / 216.0; XPoint points [6]; - points [0].x = x + xscale * 20; - points [0].y = y + yscale * 10; - points [1].x = x + xscale * 120; - points [1].y = y + yscale * 10; - points [2].x = x + xscale * 243; - points [2].y = y + yscale * 93; - points [3].x = x + xscale * 57; - points [3].y = y + yscale * 210; - points [4].x = x + xscale * 20; - points [4].y = y + yscale * 210; - points [5].x = x + xscale * 175; - points [5].y = y + yscale * 113; + points[0].x = x + xscale * 20; points[0].y = y + yscale * 10; + points[1].x = x + xscale * 120; points[1].y = y + yscale * 10; + points[2].x = x + xscale * 243; points[2].y = y + yscale * 93; + points[3].x = x + xscale * 57; points[3].y = y + yscale * 210; + points[4].x = x + xscale * 20; points[4].y = y + yscale * 210; + points[5].x = x + xscale * 175; points[5].y = y + yscale * 113; XFillPolygon (dpy, window, draw_gc, points, 6, Complex, CoordModeOrigin); - points [0].x = x + xscale * 197; - points [0].y = y + yscale * 127; - points [1].x = x + xscale * 384; - points [1].y = y + yscale * 10; - points [2].x = x + xscale * 420; - points [2].y = y + yscale * 10; - points [3].x = x + xscale * 265; - points [3].y = y + yscale * 108; - points [4].x = x + xscale * 420; - points [4].y = y + yscale * 210; - points [5].x = x + xscale * 320; - points [5].y = y + yscale * 210; + points[0].x = x + xscale * 202; points[0].y = y + yscale * 132; + points[1].x = x + xscale * 384; points[1].y = y + yscale * 10; + points[2].x = x + xscale * 420; points[2].y = y + yscale * 10; + points[3].x = x + xscale * 270; points[3].y = y + yscale * 113; + points[4].x = x + xscale * 420; points[4].y = y + yscale * 210; + points[5].x = x + xscale * 320; points[5].y = y + yscale * 210; XFillPolygon (dpy, window, draw_gc, points, 6, Complex, CoordModeOrigin); } +#include "spline.h" + void skull (Display *dpy, Window window, GC draw_gc, GC erase_gc, int x, int y, int w, int h) { - XPoint points [3]; - crossbones (dpy, window, draw_gc, x, y+h/2, w, h/2); - x += w/100; - y += h/15; - XFillArc (dpy, window, draw_gc, (int) (x + (w * 0.3)), y, w/2, h/2, - -40*64, 260*64); - XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.35)), y + h/5, - (int) (w * 0.4), h/5); - XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.375)), - (int) (y + (h * 0.425)), w / 20, h / 20); - XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.495)), - (int) (y + (h * 0.425)), w / 20, h / 20); - XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.555)), - (int) (y + (h * 0.425)), w / 20, h / 20); - XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.675)), - (int) (y + (h * 0.425)), w / 20, h / 20); - points [0].x = x + (w * 0.435); - points [0].y = y + (h * 0.425); - points [1].x = x + (w * 0.485); - points [1].y = points [0].y; - points [2].x = (points [0].x + points [1].x) / 2; - points [2].y = points [0].y + h/10; - XFillPolygon (dpy, window, draw_gc, points, 3, Complex, CoordModeOrigin); - points [0].x = x + (w * 0.615); - points [1].x = x + (w * 0.665); - points [2].x = (points [0].x + points [1].x) / 2; - XFillPolygon (dpy, window, draw_gc, points, 3, Complex, CoordModeOrigin); - points [0].x = x + (w * 0.52); - points [0].y = y + (h * 0.35); - points [1].x = points [0].x - (w * 0.05); - points [1].y = points [0].y; - points [2].x = points [0].x; - points [2].y = points [0].y - (w * 0.10); - XFillPolygon (dpy, window, erase_gc, points, 3, Complex, CoordModeOrigin); - points [0].x = x + (w * 0.57); - points [1].x = x + (w * 0.62); - points [2].x = points [0].x; - XFillPolygon (dpy, window, erase_gc, points, 3, Complex, CoordModeOrigin); - XFillArc (dpy, window, erase_gc, x + ((int) (w * 0.375)), y + h/7, - w/10, h/10, 0, 360*64); - XFillArc (dpy, window, erase_gc, x + ((int) (w * 0.615)), y + h/7, - w/10, h/10, 0, 360*64); + spline s; + float w100, h100; + XPoint points [20]; + double sx[20], sy[20]; + int i; + + memset(&s, 0, sizeof(s)); + s.control_x = sx; + s.control_y = sy; + + y -= (w * 0.025); + + crossbones (dpy, window, draw_gc, x, y+(h/2), w, (h / 3)); + + x += (w * 0.27); + y += (h * 0.25); + w *= 0.6; + h *= 0.6; + + w100 = w / 100.0; + h100 = h / 100.0; + + points[ 0].x = x + (0 * w100); points[ 0].y = y + (10 * h100); + points[ 1].x = x + (10 * w100); points[ 1].y = y + (0 * h100); + points[ 2].x = x + (90 * w100); points[ 2].y = y + (0 * h100); + points[ 3].x = x + (100 * w100); points[ 3].y = y + (10 * h100); + points[ 4].x = x + (100 * w100); points[ 4].y = y + (30 * h100); + points[ 5].x = x + (90 * w100); points[ 5].y = y + (40 * h100); + points[ 6].x = x + (70 * w100); points[ 6].y = y + (40 * h100); + points[ 7].x = x + (70 * w100); points[ 7].y = y + (50 * h100); + points[ 8].x = x + (30 * w100); points[ 8].y = y + (50 * h100); + points[ 9].x = x + (30 * w100); points[ 9].y = y + (40 * h100); + points[10].x = x + (10 * w100); points[10].y = y + (40 * h100); + points[11].x = x + (0 * w100); points[11].y = y + (30 * h100); + + for (i = 0; i < 12; i++) + sx[i] = points[i].x, sy[i] = points[i].y; + s.n_controls = i; + s.allocated_points = i; + s.points = (XPoint *) calloc (i, sizeof (*s.points)); + compute_closed_spline(&s); + + XFillPolygon (dpy, window, draw_gc, points+6, 4, Complex, CoordModeOrigin); + XFillPolygon (dpy, window, draw_gc, s.points, s.n_points, + Complex, CoordModeOrigin); + + points[0].x = x + (20 * w100); points[0].y = y + (18 * h100); + points[1].x = x + (25 * w100); points[1].y = y + (15 * h100); + points[2].x = x + (43 * w100); points[2].y = y + (15 * h100); + points[3].x = x + (45 * w100); points[3].y = y + (17 * h100); + points[4].x = x + (45 * w100); points[4].y = y + (25 * h100); + points[5].x = x + (40 * w100); points[5].y = y + (30 * h100); + points[6].x = x + (30 * w100); points[6].y = y + (30 * h100); + points[7].x = x + (20 * w100); points[7].y = y + (23 * h100); + for (i = 0; i < 8; i++) + sx[i] = points[i].x, sy[i] = points[i].y; + s.n_controls = i; + compute_closed_spline(&s); + XFillPolygon (dpy, window, erase_gc, s.points, s.n_points, + Complex, CoordModeOrigin); + + points[0].x = x + (80 * w100); points[0].y = y + (18 * h100); + points[1].x = x + (75 * w100); points[1].y = y + (15 * h100); + points[2].x = x + (57 * w100); points[2].y = y + (15 * h100); + points[3].x = x + (55 * w100); points[3].y = y + (17 * h100); + points[4].x = x + (55 * w100); points[4].y = y + (25 * h100); + points[5].x = x + (60 * w100); points[5].y = y + (30 * h100); + points[6].x = x + (70 * w100); points[6].y = y + (30 * h100); + points[7].x = x + (80 * w100); points[7].y = y + (23 * h100); + for (i = 0; i < 8; i++) + sx[i] = points[i].x, sy[i] = points[i].y; + s.n_controls = i; + compute_closed_spline(&s); + XFillPolygon (dpy, window, erase_gc, s.points, s.n_points, + Complex, CoordModeOrigin); + + points[ 0].x = x + (48 * w100); points[ 0].y = y + (30 * h100); + points[ 1].x = x + (52 * w100); points[ 1].y = y + (30 * h100); + points[ 2].x = x + (56 * w100); points[ 2].y = y + (42 * h100); + points[ 3].x = x + (52 * w100); points[ 3].y = y + (45 * h100); + points[ 4].x = x + (48 * w100); points[ 4].y = y + (45 * h100); + points[ 5].x = x + (44 * w100); points[ 5].y = y + (42 * h100); + for (i = 0; i < 6; i++) + sx[i] = points[i].x, sy[i] = points[i].y; + s.n_controls = i; + compute_closed_spline(&s); + XFillPolygon (dpy, window, erase_gc, s.points, s.n_points, + Complex, CoordModeOrigin); + + free(s.points); } diff --git a/xscreensaver.lsm b/xscreensaver.lsm new file mode 100644 index 00000000..810e2311 --- /dev/null +++ b/xscreensaver.lsm @@ -0,0 +1,28 @@ +Begin3 +Title: xscreensaver +Version: 2.16 +Entered-date: 21FEB98 +Description: A modular screen saver and locker for the X Window System. + Highly customizable: allows the use of any program that + can draw on the root window as a display mode. + Comes with more than 60 display modes. + Home page: http://people.netscape.com/jwz/xscreensaver/ +Keywords: screen saver, screen lock, lock, xlock, X11 +Author: jwz@netscape.com (Jamie Zawinski) +Maintained-by: jwz@netscape.com (Jamie Zawinski) +Primary-site: ftp.x.org /contrib/applications/ + 742K xscreensaver-2.16.tar.gz + 17K xscreensaver.README + 1K xscreensaver.lsm +Alternate-site: sunsite.unc.edu /pub/Linux/X11/screensavers/ + 742K xscreensaver-2.16.tar.gz + 17K xscreensaver.README + 1K xscreensaver.lsm +Platforms: Linux, Irix, SunOS, Solaris, HPUX, AIX, FreeBSD, NetBSD, + BSDI, SCO, OSF1, Ultrix, VMS. + Requires X11 and ANSI C. + Works with Motif or Athena. + Shadow passwords, Kerberos, and OpenGL optionally supported. + Multi-headed machines supported. +Copying-policy: BSD +End diff --git a/xscreensaver.lsm.sh b/xscreensaver.lsm.sh new file mode 100755 index 00000000..2ae10138 --- /dev/null +++ b/xscreensaver.lsm.sh @@ -0,0 +1,53 @@ +#!/bin/sh +# +# generate an lsm file (http://sunsite.unc.edu/pub/Linux/Incoming/LSM-TEMPLATE) +# that is more-or-less correct for the current version of xscreensaver. +# jwz, 18-Jan-98 + +size() { + ls -l $* | + tail -1 | + sed 's/.* \([0-9][0-9][0-9][0-9][0-9]*\) .*/\1/' | + sed 's/[0-9][0-9][0-9]$/K/' +} + +TAR_SIZE=`size xscreensaver-*.gz` +README_SIZE=`size README` +#LSM_SIZE=`size xscreensaver.lsm` +LSM_SIZE="1K" + +VERSION=`sed -n 's/.*\([0-9][0-9]*\.[0-9]*\).*/\1/p' < utils/version.h` +DATE=`date '+%d%b%y' | tr a-z A-Z` + +#URL=`sed -n 's/\(http:[^ ]*\)/\1/p' < README | sed 's/[^a-zA-Z/]$//'` + +echo "Begin3 +Title: xscreensaver +Version: $VERSION +Entered-date: $DATE +Description: A modular screen saver and locker for the X Window System. + Highly customizable: allows the use of any program that + can draw on the root window as a display mode. + Comes with more than 60 display modes. + Home page: http://people.netscape.com/jwz/xscreensaver/ +Keywords: screen saver, screen lock, lock, xlock, X11 +Author: jwz@netscape.com (Jamie Zawinski) +Maintained-by: jwz@netscape.com (Jamie Zawinski) +Primary-site: ftp.x.org /contrib/applications/ + $TAR_SIZE xscreensaver-$VERSION.tar.gz + $README_SIZE xscreensaver.README + $LSM_SIZE xscreensaver.lsm +Alternate-site: sunsite.unc.edu /pub/Linux/X11/screensavers/ + $TAR_SIZE xscreensaver-$VERSION.tar.gz + $README_SIZE xscreensaver.README + $LSM_SIZE xscreensaver.lsm +Platforms: Linux, Irix, SunOS, Solaris, HPUX, AIX, FreeBSD, NetBSD, + BSDI, SCO, OSF1, Ultrix, VMS. + Requires X11 and ANSI C. + Works with Motif or Athena. + Shadow passwords, Kerberos, and OpenGL optionally supported. + Multi-headed machines supported. +Copying-policy: BSD +End" + +exit 0