+++ /dev/null
-/*
- * Imakefile file for xscreensaver, Copyright (c) 1991-1994 Jamie Zawinski.
- *
- * You should not need to edit this file; edit config.h instead.
- *
- */
-
-#include "config.h"
-
- TARFILES = README Imakefile config.h screenblank.txt
- TAR = tar
- COMPRESS = compress
- COMPRESS_EXT = Z
-/**/# COMPRESS = gzip --verbose --best
-/**/# COMPRESS_EXT = gz
-
-all:: utils/Makefile driver/Makefile hacks/Makefile
- cd utils ; $(MAKE) $@ CC="$(CC)" CCOPTIONS="$(CCOPTIONS)" CDEBUGFLAGS="$(CDEBUGFLAGS)"
- cd driver ; $(MAKE) $@ CC="$(CC)" CCOPTIONS="$(CCOPTIONS)" CDEBUGFLAGS="$(CDEBUGFLAGS)"
- cd hacks ; $(MAKE) $@ CC="$(CC)" CCOPTIONS="$(CCOPTIONS)" CDEBUGFLAGS="$(CDEBUGFLAGS)"
-
-clean install install.man:: utils/Makefile driver/Makefile hacks/Makefile
- cd utils ; $(MAKE) $@ BINDIR=$(BINDIR) XAPPLOADDIR=$(XAPPLOADDIR)
- cd driver ; $(MAKE) $@ BINDIR=$(BINDIR) XAPPLOADDIR=$(XAPPLOADDIR)
- cd hacks ; $(MAKE) $@ BINDIR=$(BINDIR) XAPPLOADDIR=$(XAPPLOADDIR)
-
-Makefiles:: utils/Makefile driver/Makefile hacks/Makefile
-
-utils/Makefile: utils/Imakefile config.h
- cd utils ; $(IMAKE_CMD) -DTOPDIR=$(TOP) -DCURDIR=$(CURRENT_DIR)/utils
-driver/Makefile: driver/Imakefile config.h
- cd driver ; $(IMAKE_CMD) -DTOPDIR=$(TOP) -DCURDIR=$(CURRENT_DIR)/driver
-hacks/Makefile: hacks/Imakefile config.h
- cd hacks ; $(IMAKE_CMD) -DTOPDIR=$(TOP) -DCURDIR=$(CURRENT_DIR)/hacks
-
-/* This really makes me sick... */
-tar: utils/Makefile driver/Makefile hacks/Makefile
- @NAME=`sed -n \
- 's/[^0-9]*\([0-9]\.[0-9][0-9]*\).*/xscreensaver-\1/p' utils/version.h` ; \
- rm -f $$NAME ; ln -s . $$NAME ; \
- FILES= ; \
- for subdir in driver utils hacks ; do \
- cd $$subdir ; \
- FILES="$$FILES `make echo_tarfiles \
- | grep -v '^make\[' \
- | sed \"s|^|$$subdir/|g;s| | $$subdir/|g\" \
- ` "; \
- cd .. ; done ; \
- echo creating tar file $${NAME}.tar.$(COMPRESS_EXT)... ; \
- $(TAR) -vchf - \
- `echo $(TARFILES) $$FILES | sed "s|^|$$NAME/|g; s| | $$NAME/|g" ` \
- | $(COMPRESS) > $${NAME}.tar.$(COMPRESS_EXT) ; \
- rm $$NAME
+++ /dev/null
-
-To build:
-
- - read the comments in `config.h' and edit it as appropriate
- - xmkmf ; make
- - make install install.man
-
-The xscreensaver program waits until the keyboard and mouse have been idle
-for a period, and then runs a graphics demo chosen at random. It turns off
-as soon as there is any mouse or keyboard activity.
-
-The purpose of xscreensaver is to display pretty pictures on your screen
-when it is not in use, in keeping with the philosophy that unattended
-monitors should always be doing something interesting, just like they do
-in the movies.
-
-However, xscreensaver can also be used as a screen locker, to prevent
-others from using your terminal while your are away.
-
-The benefit that this program has over the combination of the xlock and
-xautolock programs is the ease with which new graphics hacks can be
-installed: you don't need to recompile this program to add a new display
-mode, you just change some resource settings. Any program which can be
-invoked in such a way that it draws on the root window of the screen can
-now be used as a screensaver without modification. The programs that
-are being run as screensavers don't need to have any special knowledge
-about what it means to be a screensaver.
-
-The XIDLE, MIT-SCREEN-SAVER, and/or SGI SCREEN_SAVER server extensions
-will be used if you have them.
-
-Unfortunately, locking doesn't work if you don't have Motif.
-
-Also included are several graphics hacks for use as screensavers. There's
-nothing magic about these: they're just programs that draw on the root
-window, which are pointed at by the screensaver's default resource settings.
-
- qix - My own implementation of this, with many more options
- than you would have thought qix could have.
- helix - Generates spirally "stringart" patterns.
- pedal - Draws a different kind of spirally pattern.
- rorschach - Random inkblot patterns.
- attraction - A bouncing ball demo, or a qix-like demo, or a wild
- color-cycling thing, with some odd rules.
- greynetic - Random colored/stippled rectangles.
- rocks - Flying through an asteroid field.
- blitspin - Rotate a bitmap using bitblts.
- imsmap - Generates random maps or cloud formations.
- hypercube - 2d projection of a hypercube rotating on all four axes.
- slidescreen - Divides the screen into a grid and plays a 16-puzzle on it.
- decayscreen - A melting effect.
- halo - Random circular patterns.
- pyro - Fireworks. Looks a lot like the version in xlock.
- hopalong - Fractals. I snarfed this code from xlock.
- flame - Fractals. Also from xlock.
- noseguy - A guy with a big nose wanders around the screen saying
- things. I snarfed this code from xnlock.
- maze - This is the X maze demo modified to take a -root option
- so that it works with xscreensaver.
- lmorph - morphing line drawings.
- bubbles - condensation forms on your monitor, then pops.
-
-All of these will pop up their own window unless given that -root option.
-See their man pages for more details.
-
-Other reasonable things to use as screensavers, if you have them, are
-
- xdaliclock -root -builtin2 - melting digital clock
- xswarm -r 2>&- - swimming sperm
- xwave -root - random 3d graphs
- xbouncebits - bounce arbitrary bitmaps around
- ico -r -p8 -faces -sleep 1 - it's dull, but it's there
- xv -root file.gif -quit - they don't all have to animate!
- xsplinefun - bouncing splines
- kaleid -root - qix-like kaleidescope patterns
- xfishtank -c black -d -r 1 - fish (use version 2.0 or later)
- xtacy -root - various eye candy
-
-You can get all of these from the contrib directory on ftp.x.org. If you
-know of (or write) any other interesting programs that can be used as
-screensavers, please let me know!
-
-The latest version of xscreensaver is always ftpable from ftp.x.org. You can
-also get it from my web page at http://www.netscape.com/people/jwz/.
-
- -- Jamie Zawinski <jwz@netscape.com>
-
-\f
-Changes since 1.26: Added support for SGI SCREEN_SAVER extension.
- Made `fade' and `unfade' work on 8-bit SGIs.
- Made the dialog boxes more Motify.
- Added `bubbles' hack.
-Changes since 1.25: Added `lmorph' hack.
- Added viscosity and mouse-control to attraction.
- Fixed possible bad color choices in qix and attraction.
- Added ramp-mode to halo.
- Added a new RNG, which is faster and more portable
- than using the RNG in libc.
- Made locking work on SCO.
- Various other minor tweaks that I don't remember.
-Changes since 1.24: Made it capture the stdout/stderr of its subprocesses
- and present them on the screensaver window itself.
- Made demo mode work correctly with non-default visuals
- and color maps, instead of always using the defaults.
- Added -visual argument to all included screenhacks.
- Support for the R6 MIT-SCREEN-SAVER server extension.
- Made the demo mode list scroll properly.
- Added `pedal' hack.
-Changes since 1.23: Fixed some private-colormap oddities in slidescreen,
- decayscreen, and xroger. Fixed apparent conservation-
- of-mass problem in pyro; made the shrapnel round.
-Changes since 1.22: Minor tweaks for IRIX5; fixed locking race condition.
-Changes since 1.21: Minor tweaks for X11R6.
- Fixes for non-default visuals.
-Changes since 1.20: Fixed bug in color blitspin; added default image.
- Added diagnostics to noseguy. Fixed off-by-one
- error in flame. Added some missing casts.
-Changes since 1.18: Added `flame' hack.
- Fixed a minor Motif dialog text field bug.
- Fixed yet another XPointer-not-defined-in-R4 bug.
-Changes since 1.17: Added support for shadow password files.
- Fixed some Motif-related locking bugs.
- Added diagnostics when locking is disabled.
- Made blitspin able to use the XPM library.
- Added `decayscreen' hack.
-Changes since 1.16: Added `halo' hack.
-Changes since 1.15: Portability fixes.
-Changes since 1.14: Broke the driver up into more source files.
- Moved the hacks into their own directory.
- Made all `time' parameters accept the 00:00:00 syntax,
- so that even the parameters which are normally read as
- minutes can be specified in seconds.
- Added colormap cycling to `imsmap'.
- Made hyper work with K&R compilers.
-Changes since 1.13: Added `orbit' option to `attraction' hack.
- Added `lock-timeout' option.
- Cleaned up options of `maze' hack.
-Changes since 1.8: Added demo mode, and locking.
- Added `maze' hack.
- Added `norotate' option to `rocks' hack.
+++ /dev/null
-/* Config file for xscreensaver, Copyright (c) 1991-1996 Jamie Zawinski.
- * This file is included by the various Imakefiles.
- */
-
-/* Uncomment the following line if you have the XPM library installed.
- * Some of the demos can make use of this if it is available.
- */
-#define HAVE_XPM
-
-
-/* Uncomment the following line if you don't have Motif. If you don't have
- * Motif, then the screensaver won't have any dialog boxes, which means
- * that it won't be compiled with support for demo-mode or display-locking.
- * But other than that, it will work fine.
- */
-/* #define NO_MOTIF */
-
-
-/* Uncomment the following line if for some reason the locking code doesn't
- * work (for example, if you don't have the crypt() system call, or if you
- * don't use standard passwd files.) If you need to do this, please let me
- * know.
- *
- * I'm told that locking doesn't work for sites which run AFS. I don't know
- * anything about how one codes authentication for AFS; if you do, please let
- * me know...
- */
-/* #define NO_LOCKING */
-
-
-/* Select supported server extensions.
- * There are three distinct server extensions which are useful with
- * XScreenSaver: XIDLE, MIT-SCREEN-SAVER, and SCREEN_SAVER.
- *
- * The XIDLE extension resides in .../contrib/extensions/xidle/ on the X11R5
- * contrib tape. This extension lets the client get accurate idle-time
- * information from the X server in a potentially more reliable way than by
- * simply watching for keyboard and mouse activity. However, the XIDLE
- * extension has apparently not been ported to X11R6.
- *
- * The SCREEN_SAVER extension is found (as far as I know) only in the SGI
- * X server, and it exists in all releases since (at least) Irix 5. The
- * relevant header file is /usr/include/X11/extensions/XScreenSaver.h.
- *
- * The similarly-named MIT-SCREEN-SAVER extension came into existence long
- * after the SGI SCREEN_SAVER extension was already in use, and resides in
- * .../contrib/extensions/screensaver/ on the X11R6 contrib tape. It is
- * also found in certain recent X servers built in to NCD X terminals.
- *
- * The MIT extension does basically the same thing that the XIDLE extension
- * does, but there are two things wrong with it: first, because of the way
- * the extension was designed, the `fade' option to XScreenSaver will be
- * uglier: just before the screen fades out, there will be an unattractive
- * flicker to black, because this extension blanks the screen *before*
- * telling us that it is time to do so. Second, this extension is known to
- * be buggy; on the systems I use, it works, but some people have reported
- * X server crashes as a result of using it. XScreenSaver uses this
- * extension rather conservatively, because when I tried to use any of its
- * more complicated features, I could get it to crash the server at the
- * drop of a hat.
- *
- * In short, the MIT-SCREEN-SAVER extension is a piece of junk. The older
- * SGI SCREEN_SAVER extension works great, as does XIDLE. It would be nice
- * If those two existed on more systems, that is, would be adopted by the
- * X Consortium in favor of their inferior "not-invented-here" entry.
- */
-
-/* Uncomment the following line if you have the XIDLE extension installed.
- * If you have the XIDLE extension, this is recommended. (You have this
- * extension if the file /usr/include/X11/extensions/xidle.h exists.)
- * Turning on this flag lets XScreenSaver work better with servers which
- * support this extension; but it will still work with servers which do not
- * suport it, so it's a good idea to compile in support for it if you can.
- */
-/* #define HAVE_XIDLE_EXTENSION */
-
-/* Uncomment the following line if you have the MIT-SCREEN-SAVER extension
- * installed. This is NOT RECOMMENDED. See the caveats about this extension,
- * above. (It's available if the file /usr/include/X11/extensions/scrnsaver.h
- * exists.)
- */
-/* #define HAVE_MIT_SAVER_EXTENSION */
-
-
-/* Use the following line if you have the SGI SCREEN_SAVER extension; the
- * default below should be correct (use it if and only if running on an SGI.)
- * Compiling in support for this extension is recommended, if possible.
- */
-#ifdef SGIArchitecture
-# define HAVE_SGI_SAVER_EXTENSION
-#endif
-
-
-/* Uncomment the following line if your system doesn't have the select()
- * system call. If you need to do this, please let me know. (I don't really
- * think that any such systems exist in this day and age...)
- */
-/* #define NO_SELECT */
-
-
-/* Uncomment the following line if your system doesn't have the setuid(),
- * setregid(), and getpwnam() library routines.
- *
- * WARNING: if you do this, it will be unsafe to run xscreensaver as root
- * (which probably means you can't have it be started by xdm.) If you are
- * on such a system, please try to find the corresponding way to do this,
- * and then tell me what it is.
- */
-/* #define NO_SETUID */
-
-
-/* Uncomment the following line if your system uses `shadow' passwords,
- * that is, the passwords live in /etc/shadow instead of /etc/passwd,
- * and one reads them with getspnam() instead of getpwnam(). (Note that
- * SCO systems do some random other thing; others might as well. See the
- * ifdefs in driver/lock.c if you're having trouble related to reading
- * passwords.)
- */
-/* #define HAVE_SHADOW */
-
-
-/* You may need to edit these to correspond to where Motif is installed,
- * if your site has Motif installed in a nonstandard place.
- */
-#ifndef NO_MOTIF
- MOTIFINCLUDES = -I/usr/local/include/
- MOTIFLDOPTIONS = -L/usr/local/lib/
- MOTIFLIBS = -lXm
-#endif
-
-
-/* On some systems, only programs running as root can use the getpwent()
- library routine. This means that, in order for locking to work, the
- screensaver must be installed as setuid to root. Define this to make
- that happen. (You must run "make install" as root for it to work.)
- (If your system needs this, and the default below is not correct,
- please let me know.)
- */
-#if defined(HPArchitecture) || defined(AIXArchitecture) || defined(HAVE_SHADOW) || defined(NetBSDArchitecture)
-# define INSTALL_SETUID
-#endif
-
-#ifdef HPArchitecture
- CCOPTIONS = -Aa -D_HPUX_SOURCE /* eat me */
-# if (ProjectX <= 4)
- MOTIFINCLUDES = -I/usr/include/Motif1.1
- MOTIFLDOPTIONS = -L/usr/lib/Motif1.1
-# else /* R5 */
- MOTIFINCLUDES = -I/usr/include/Motif1.2
- MOTIFLDOPTIONS = -L/usr/lib/Motif1.2
-# endif /* R5 */
-#endif /* HPArchitecture */
-
-#ifdef MacIIArchitecture
- CCOPTIONS = -D_POSIX_SOURCE
-#endif /* MacIIArchitecture */
-
-#if (ProjectX <= 4)
-# define R5ISMS -DXPointer="char*"
-#else /* r5 or better */
-# define R5ISMS
-#endif
-
-/* It seems that some versions of Sun's dynamic X libraries are broken; if
- you get link errors about _get_wmShellWidgetClass being undefined, try
- adding -Bstatic to the link command.
- */
+++ /dev/null
-# If you're debugging xscreensaver and you are running a virtual root window
-# manager, you'd better let the process handle these signals: it remaps the
-# virtual root window when they arrive. If you don't do this, your window
-# manager will be hosed.
-#
-# Also, gdb copes badly with breakpoints in functions that are called on the
-# other side of a fork(). The Trace/BPT traps cause the spawned process to
-# die.
-#
-#handle 1 pass nostop
-#handle 3 pass nostop
-#handle 4 pass nostop
-#handle 6 pass nostop
-#handle 7 pass nostop
-#handle 8 pass nostop
-#handle 9 pass nostop
-#handle 10 pass nostop
-#handle 11 pass nostop
-#handle 12 pass nostop
-#handle 13 pass nostop
-#handle 15 pass nostop
-#handle 19 pass nostop
-b exit
-set args -sync -verbose -idelay 0
-#b purify_stop_here
+++ /dev/null
-/*
- * Imakefile file for xscreensaver, Copyright (c) 1993-1996 Jamie Zawinski.
- *
- * You should not need to edit this file; edit ../config.h instead.
- *
- */
-
-#include "../config.h"
-
-/* #### If anyone ever finishes the Athena locking code, remove this. */
-#if defined(NO_MOTIF) && !defined(NO_LOCKING)
-# define NO_LOCKING
-#endif
-
-#ifdef NO_LOCKING
-# undef INSTALL_SETUID
-#endif
-
-#ifdef HAVE_XIDLE_EXTENSION
-# define XIDLE_DEF -DHAVE_XIDLE_EXTENSION
-#else
-# define XIDLE_DEF
-#endif
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-# define MIT_SAVER_DEF -DHAVE_MIT_SAVER_EXTENSION
-#else
-# define MIT_SAVER_DEF
-#endif
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-# define SGI_SAVER_DEF -DHAVE_SGI_SAVER_EXTENSION
-#else
-# define SGI_SAVER_DEF
-#endif
-
-#ifdef NO_LOCKING
-# define LOCKING_DEF -DNO_LOCKING
-#else
-# define LOCKING_DEF
-#endif
-
-#ifdef NO_SETUID
-# define SETUID_DEF -DNO_SETUID
-#else
-# define SETUID_DEF
-#endif
-
-#ifdef HAVE_SHADOW
-# define SHADOW_DEF -DHAVE_SHADOW
-#else
-# define SHADOW_DEF
-#endif
-
-#ifdef NO_MOTIF
-# define MOTIF_DEF -DNO_MOTIF
-# define MOTIF_SRC
-# define MOTIF_OBJ
-# define MOTIF_LIB
-# define MOTIF_INC
-#else
-# define MOTIF_DEF
-# define MOTIF_SRC $(DBOX_SRCS) $(UTILS)/xroger.c
-# define MOTIF_OBJ $(DBOX_OBJS) $(UTILS)/xroger.o
-# define MOTIF_LIB $(MOTIFLDOPTIONS) $(MOTIFLIBS)
-# define MOTIF_INC $(MOTIFINCLUDES)
-#endif
-
- UTILS = ../utils
- INCLUDES = -I$(UTILS) MOTIF_INC
- DEFINES = SETUID_DEF XIDLE_DEF MIT_SAVER_DEF SGI_SAVER_DEF MOTIF_DEF LOCKING_DEF SHADOW_DEF R5ISMS
- SAVERLIBS = $(XMULIB) $(XTOOLLIB) $(EXTENSIONLIB) $(XLIB)
- COMMLIBS = $(XLIB)
- UTIL_SRCS = $(UTILS)/resources.c $(UTILS)/fade.c $(UTILS)/visual.c $(UTILS)/usleep.c $(UTILS)/yarandom.c
- UTIL_OBJS = $(UTILS)/resources.o $(UTILS)/fade.o $(UTILS)/visual.o $(UTILS)/usleep.o $(UTILS)/yarandom.o
- DBOX_SRCS = dialogs.c demo.c
- DBOX_OBJS = dialogs.o demo.o
- LOCK_SRCS = lock.c
- LOCK_OBJS = lock.o
- SAVERSRCS = xscreensaver.c timers.c subprocs.c windows.c stderr.c
- SAVEROBJS = xscreensaver.o timers.o subprocs.o windows.o stderr.o
- SRCS1 = $(SAVERSRCS) MOTIF_SRC $(LOCK_SRCS) $(UTIL_SRCS)
- OBJS1 = $(SAVEROBJS) MOTIF_OBJ $(LOCK_OBJS) $(UTIL_OBJS)
- COMMSRCS = xscreensaver-command.c
- COMMOBJS = xscreensaver-command.o
- SRCS2 = $(COMMSRCS)
- OBJS2 = $(COMMOBJS)
- MEN = xscreensaver.man xscreensaver-command.man
- TARFILES = README Imakefile $(SAVERSRCS) $(DBOX_SRCS) $(LOCK_SRCS) \
- $(COMMSRCS) xscreensaver.h XScreenSaver.ad dialogs.xd \
- $(MEN) .gdbinit
-
-#if defined(HPArchitecture) && !defined(NO_LOCKING)
-EXTRA_LIBRARIES = -lXhp11 /* for XHPDisableReset() */
-#endif
-
-#if defined(NetBSDArchitecture) && !defined(NO_LOCKING)
-EXTRA_LIBRARIES = -lcrypt
-#endif
-
-#if defined(i386ScoArchitecture)
-EXTRA_LIBRARIES = -lintl -lprot -lx -lcrypt_i
-#endif
-
-all:: xscreensaver xscreensaver-command
-
-echo_tarfiles:
- @echo $(TARFILES)
-
-PROGRAMS = xscreensaver xscreensaver-command
-
-#ifdef INSTALL_SETUID
-#undef InstallProgram
-#define InstallProgram(p,d) InstallProgramWithFlags(p,d,$(INSTUIDFLAGS))
-#endif
-
-ComplexProgramTarget_1(xscreensaver,MOTIF_LIB $(SAVERLIBS), $(HP_NULL_STR))
-
-#ifdef INSTALL_SETUID
-#undef InstallProgram
-#define InstallProgram(p,d) InstallProgramWithFlags(p,d,$(HP_NULL_STR))
-#endif
-
-ComplexProgramTarget_2(xscreensaver-command,$(COMMLIBS),$(HP_NULL_STR))
-
-InstallAppDefaults(XScreenSaver)
-
-xscreensaver.o: XScreenSaver.ad.h $(UTILS)/version.h
-xscreensaver-command.o: $(UTILS)/version.h
-
-demo.o: $(UTILS)/version.h
-lock.o: $(UTILS)/version.h
-
-/* build this before calling makedepend */
-depend:: XScreenSaver.ad.h
-
-XScreenSaver.ad.h: XScreenSaver.ad
- $(UTILS)/ad2c XScreenSaver.ad > XScreenSaver.ad.h
-
-clean::
- $(RM) XScreenSaver.ad.h
-
-
-#if defined(SparcArchitecture) || defined(SGIArchitecture)
-# undef UsePurify
-# define UsePurify
-#endif
-
-#ifdef UsePurify
- PURIFY = purify
- PURIFYOPTIONS =
-
-# undef PurifyProgramTarget
-# define PurifyProgramTarget(program,deplist,linklist) @@\
-program.pure: deplist @@\
- RemoveTargetProgram($@) @@\
- $(CCENVSETUP) $(PURIFY) $(PURIFYOPTIONS) $(CC) \
- -o $@ $(LDOPTIONS) linklist $(EXTRA_LOAD_FLAGS)
-
-PurifyProgramTarget(xscreensaver,$(OBJS1),$(OBJS1) MOTIF_LIB $(SAVERLIBS))
-
-#endif /* Purify */
+++ /dev/null
-
-This directory contains the source for xscreensaver and xscreensaver-command,
-the screensaver driver, and the program for externally controlling it. Some
-stuff from the ../utils/ directory is used here as well.
-
-If you have compilation problems, check the parameters in ../config.h.
+++ /dev/null
-! app-defaults file for XScreenSaver by Jamie Zawinski.
-! See "man xscreensaver" for more info. If you don't have that,
-! see http://www.netscape.com/people/jwz/ to get the latest version.
-
-*timeout: 10
-*cycle: 10
-*lockTimeout: 0
-*passwdTimeout: 30
-*nice: 10
-*lock: False
-*verbose: False
-*fade: True
-*unfade: False
-*fadeSeconds: 1
-*fadeTicks: 75
-
-*captureStderr: True
-*captureStdout: True
-*textForeground: Yellow
-*textBackground: Black
-*font: *-medium-r-*-140-*-m-*
-
-! Turning on "installColormap" interacts erratically with twm and tvtwm,
-! but seems to work fine with mwm and olwm. Try it and see.
-!
-*installColormap: True
-
-
-! Any program which can draw on the root window will work as a screensaver.
-! The following three resources enumerate them.
-
-*programs: qix -root \n\
- qix -root -solid -delay 0 -segments 100 \n\
- qix -root -linear -count 10 -size 100 -segments 200 \n\
- attraction -root -mode balls \n\
- attraction -root -mode lines -points 3 -segments 200 \n\
- attraction -root -mode splines -segments 300 \n\
- attraction -root -mode lines -radius 300 \
- -orbit -vmult 0.5 \n\
- pyro -root \n\
- helix -root \n\
- pedal -root \n\
- rorschach -root -offset 7 \n\
- hopalong -root \n\
- greynetic -root \n\
- xroger -root \n\
- imsmap -root \n\
- slidescreen -root \n\
- decayscreen -root \n\
- hypercube -root \n\
- halo -root \n\
- maze -root \n\
- flame -root \n\
- lmorph -root \n
-
-! Programs on this list are run only for monochrome screens.
-! (These are in addition to those listed in "*programs".)
-*monoPrograms: qix -root -linear -count 5 -size 200 -spread 30 \
- -segments 75 -solid -xor \n\
- rocks -root \n\
- noseguy -root \n
-
-! Programs on this list are run only for color (really, non-mono) screens.
-! (These are in addition to those listed in "*programs".)
-*colorPrograms: qix -root -count 4 -solid -transparent \n\
- qix -root -count 5 -solid -transparent -linear \
- -segments 250 -size 100 \n\
- attraction -root -mode polygons \n\
- attraction -root -mode filled-splines -segments 0 \n\
- attraction -root -glow -points 10 \n\
- rocks -root -fg darksalmon \n\
- noseguy -root -fg yellow -bg black \n\
- bubbles -root \n
-
-
-! Some other programs that you might want to track down (these work as
-! XScreenSaver helpers, but are not distributed with it):
-!
-! xdaliclock -root -builtin2 \n\
-! xswarm -r 2>&- \n\
-! xwave -root \n\
-! xbouncebits ... \n\
-! ico -r -faces -sleep 1 -obj ico \n\
-! xsplinefun \n\
-! kaleid -root \n\
-! xfishtank -c black -d -r 2 \n\
-! xtacy -root -delay 100 -gravity \n\
-
-
-! To display a slideshow of images, add commands like this to *programs:
-!
-! xv -root -rmode 5 image-1.gif -quit
-! xv -root -rmode 5 image-2.gif -quit
-! xv -root -rmode 5 image-3.gif -quit
-! ...and so on...
-!
-! however, for this to work, you must also have started the screensaver so
-! that it uses the default colormap (the "-no-install" command-line option, or
-! the "installColormap: False" resource) because when XV is running in "-root"
-! mode, it always assumes that the default colormap is being used, rather than
-! examining the window it is drawing on to see what colormap it has.
-
-
-! Some SGI GL programs work with XScreenSaver; most don't.
-!
-! Bongo works fine:
-!
-! /usr/demos/bin/bongo -wbongo
-!
-! ElectroPaint sort-of works; XScreenSaver will launch it, and it will run
-! properly, but when it's time to turn off the screensaver, you need to hit
-! the Escape key, rather than just moving the mouse. Apparently GL programs
-! are able to intercept the keyboard even when X has the keyboard grabbed!
-!
-! /usr/demos/bin/ep
-!
-! None of the other GL demos I've tried worked, because none of them seem to
-! have command-line options that will make them take up the whole screen; so
-! all you get is a miniscule 100x100 image, which is worthless. This is a
-! shame, since many of those demos would make fine screensavers.
-!
-! If anyone who understands how "haven" works would like to send me the code
-! necessary to do what it does, I would be much obliged.
-
-
-
-!=============================================================================
-!
-! You probably don't want to change anything after this point.
-!
-!=============================================================================
-
-
-! Resources for the dialog boxes:
-!
-*fontList: *-helvetica-medium-r-*-*-*-120-*-*-*-iso8859-1
-*demoDialog*label1.fontList: *-helvetica-medium-r-*-*-*-140-*-*-*-iso8859-1
-*passwdDialog*fontList: *-helvetica-medium-r-*-*-*-140-*-*-*-iso8859-1
-*XmList.fontList: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
-*XmTextField.fontList: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
-*passwdDialog.passwdText.fontList: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
-
-*XmDialogShell*foreground: black
-*XmDialogShell*background: gray90
-*XmDialogShell*XmTextField.foreground: black
-*XmDialogShell*XmTextField.background: white
-*XmDialogShell*demoList.foreground: black
-*XmDialogShell*demoList.background: white
-*XmDialogShell*rogerLabel.foreground: red3
-*XmDialogShell*rogerLabel.background: white
-
-*XmDialogShell.title: XScreenSaver
-*allowShellResize: True
-*autoUnmanage: False
-
-! This doesn't work. Motif ignores it if there is a scroll-list!
-*demoDialog.maxWidth: 600
-
-*label1.labelString: XScreenSaver %s
-*label2.labelString: Copyright © 1991-1996 by Jamie Zawinski <jwz@netscape.com>
-*demoList.visibleItemCount: 10
-*demoList.automaticSelection: True
-*next.labelString: Run Next
-*prev.labelString: Run Previous
-*edit.labelString: Edit Parameters
-*done.labelString: Exit Demo Mode
-*restart.labelString: Reinitialize
-
-*resourcesLabel.labelString: XScreenSaver Parameters
-
-! *timeoutLabel.labelString: Timeout Minutes
-! *cycleLabel.labelString: Cycle Seconds
-! *fadeSecondsLabel.labelString:Fade Seconds
-! *fadeTicksLabel.labelString: Fade Ticks
-! *lockLabel.labelString: Lock Timeout
-! *passwdLabel.labelString: Password Timeout
-! *resourcesForm*XmTextField.columns: 5
-
-*timeoutLabel.labelString: Saver Timeout
-*cycleLabel.labelString: Cycle Timeout
-*fadeSecondsLabel.labelString: Fade Duration
-*fadeTicksLabel.labelString: Fade Ticks
-*lockLabel.labelString: Lock Timeout
-*passwdLabel.labelString: Password Timeout
-*resourcesForm*XmTextField.columns: 8
-
-*verboseToggle.labelString: Verbose
-*cmapToggle.labelString: Install Colormap
-*fadeToggle.labelString: Fade Colormap
-*unfadeToggle.labelString: Unfade Colormap
-*lockToggle.labelString: Require Password
-*resourcesDone.labelString: Done
-*resourcesCancel.labelString: Cancel
-
-*passwdDialog.title: Password
-*passwdLabel1.labelString: XScreenSaver %s
-*passwdLabel2.labelString: This display is locked.
-*passwdLabel3.labelString: Please type %s's password to unlock it.
-*passwdDone.labelString: Done
-*passwdCancel.labelString: Cancel
-
-*passwdLabel1.alignment: ALIGNMENT_BEGINNING
-*passwdLabel2.alignment: ALIGNMENT_BEGINNING
-*passwdLabel3.alignment: ALIGNMENT_BEGINNING
-*rogerLabel.width: 150
-
-! You probably won't need to change these. They are only used if no server
-! extension is in use.
-!
-*pointerPollTime: 5
-*initialDelay: 30
-*windowCreationTimeout: 30
-
-*bourneShell: /bin/sh
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include <X11/Intrinsic.h>
-
-#if !__STDC__
-# define _NO_PROTO
-#endif
-
-#include <Xm/Xm.h>
-#include <Xm/Text.h>
-#include <Xm/List.h>
-#include <Xm/ToggleB.h>
-
-#include "xscreensaver.h"
-#include <stdio.h>
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-extern int mit_saver_ext_event_number;
-extern Window server_mit_saver_window;
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-/* extern int sgi_saver_ext_event_number; */
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
-extern Bool use_mit_saver_extension;
-extern Bool use_sgi_saver_extension;
-
-extern Time timeout, cycle, lock_timeout;
-#ifndef NO_LOCKING
-extern Time passwd_timeout;
-#endif
-extern int fade_seconds, fade_ticks;
-extern Bool verbose_p, install_cmap_p, fade_p, unfade_p;
-extern Bool lock_p, locking_disabled_p;
-
-static void demo_mode_hack P((char *));
-static void demo_mode_done P((void));
-
-static void focus_fuckus P((Widget dialog));
-static void text_cb P((Widget button, XtPointer, XtPointer));
-
-extern void demo_mode_restart_process ();
-
-extern Widget demo_dialog;
-extern Widget label1;
-extern Widget text_line;
-extern Widget demo_form;
-extern Widget demo_list;
-extern Widget next, prev, done, restart, edit;
-
-extern Widget resources_dialog;
-extern Widget resources_form;
-extern Widget res_done, res_cancel;
-extern Widget timeout_text, cycle_text, fade_text, ticks_text;
-extern Widget lock_time_text, passwd_time_text;
-extern Widget verbose_toggle, cmap_toggle, fade_toggle, unfade_toggle,
- lock_toggle;
-
-extern create_demo_dialog ();
-extern create_resources_dialog ();
-
-static void
-focus_fuckus (dialog)
- Widget dialog;
-{
- XSetInputFocus (XtDisplay (dialog), XtWindow (dialog),
- RevertToParent, CurrentTime);
-}
-
-static void
-raise_screenhack_dialog ()
-{
- XMapRaised (XtDisplay (demo_dialog), XtWindow (demo_dialog));
- if (resources_dialog)
- XMapRaised (XtDisplay (resources_dialog), XtWindow (resources_dialog));
- focus_fuckus (resources_dialog ? resources_dialog : demo_dialog);
-}
-
-static void
-destroy_screenhack_dialogs ()
-{
- if (demo_dialog) XtDestroyWidget (demo_dialog);
- if (resources_dialog) XtDestroyWidget (resources_dialog);
- demo_dialog = resources_dialog = 0;
-}
-
-static void
-text_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- char *line = XmTextGetString (button);
- demo_mode_hack (line);
-}
-
-
-static void
-select_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- char **hacks = (char **) client_data;
- XmListCallbackStruct *lcb = (XmListCallbackStruct *) call_data;
- XmTextSetString (text_line, hacks [lcb->item_position - 1]);
- if (lcb->reason == XmCR_DEFAULT_ACTION)
- text_cb (text_line, 0, 0);
- focus_fuckus (demo_dialog);
-}
-
-static void
-ensure_selected_item_visible (list)
- Widget list;
-{
- int *pos_list = 0;
- int pos_count = 0;
- if (XmListGetSelectedPos (list, &pos_list, &pos_count) && pos_count > 0)
- {
- int top = -2;
- int visible = 0;
- XtVaGetValues (list,
- XmNtopItemPosition, &top,
- XmNvisibleItemCount, &visible,
- 0);
- if (pos_list[0] >= top + visible)
- {
- int pos = pos_list[0] - visible + 1;
- if (pos < 0) pos = 0;
- XmListSetPos (list, pos);
- }
- else if (pos_list[0] < top)
- {
- XmListSetPos (list, pos_list[0]);
- }
- }
- if (pos_list)
- XtFree ((char *) pos_list);
-}
-
-static void
-next_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- int *pos_list;
- int pos_count;
- if (! XmListGetSelectedPos (demo_list, &pos_list, &pos_count))
- XmListSelectPos (demo_list, 1, True);
- else
- {
- int pos = pos_list [0];
- XmListSelectPos (demo_list, pos + 1, True);
- XtFree ((char *) pos_list);
- if (! XmListGetSelectedPos (demo_list, &pos_list, &pos_count))
- abort ();
- if (pos_list [0] == pos)
- XmListSelectPos (demo_list, 1, True);
- XtFree ((char *) pos_list);
- }
- ensure_selected_item_visible (demo_list);
- text_cb (text_line, 0, 0);
-}
-
-static void
-prev_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- int *pos_list;
- int pos_count;
- if (! XmListGetSelectedPos (demo_list, &pos_list, &pos_count))
- XmListSelectPos (demo_list, 0, True);
- else
- {
- XmListSelectPos (demo_list, pos_list [0] - 1, True);
- XtFree ((char *) pos_list);
- }
- ensure_selected_item_visible (demo_list);
- text_cb (text_line, 0, 0);
-}
-
-
-static void pop_resources_dialog ();
-static void make_resources_dialog ();
-
-static void
-edit_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- Widget parent = (Widget) client_data;
- if (! resources_dialog)
- make_resources_dialog (parent);
- pop_resources_dialog ();
-}
-
-static void
-done_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- demo_mode_done ();
-}
-
-
-static void
-restart_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- demo_mode_restart_process ();
-}
-
-void
-pop_up_dialog_box (dialog, form, where)
- Widget dialog, form;
- int where;
-{
- /* I'm sure this is the wrong way to pop up a dialog box, but I can't
- figure out how else to do it.
-
- It's important that the screensaver dialogs not get decorated or
- otherwise reparented by the window manager, because they need to be
- children of the *real* root window, not the WM's virtual root, in
- order for us to guarentee that they are visible above the screensaver
- window itself.
- */
- Arg av [100];
- int ac = 0;
- Dimension sw, sh, x, y, w, h;
- XtRealizeWidget (form);
- sw = WidthOfScreen (XtScreen (dialog));
- sh = HeightOfScreen (XtScreen (dialog));
- ac = 0;
- XtSetArg (av [ac], XmNwidth, &w); ac++;
- XtSetArg (av [ac], XmNheight, &h); ac++;
- XtGetValues (form, av, ac);
- switch (where)
- {
- case 0: /* center it in the top-right quadrant */
- x = (sw/2 + w) / 2 + (sw/2) - w;
- y = (sh/2 + h) / 2 - h;
- break;
- case 1: /* center it in the bottom-right quadrant */
- x = (sw/2 + w) / 2 + (sw/2) - w;
- y = (sh/2 + h) / 2 + (sh/2) - h;
- break;
- case 2: /* center it on the screen */
- x = (sw + w) / 2 - w;
- y = (sh + h) / 2 - h;
- break;
- default:
- abort ();
- }
- if (x + w > sw) x = sw - w;
- if (y + h > sh) y = sh - h;
- ac = 0;
- XtSetArg (av [ac], XmNx, x); ac++;
- XtSetArg (av [ac], XmNy, y); ac++;
- XtSetArg (av [ac], XtNoverrideRedirect, True); ac++;
- XtSetArg (av [ac], XmNdefaultPosition, False); ac++;
- /* I wonder whether this does anything useful? */
- /* XtSetArg (av [ac], XmNdialogStyle, XmDIALOG_SYSTEM_MODAL); ac++; */
- XtSetValues (dialog, av, ac);
- XtSetValues (form, av, ac);
- XtManageChild (form);
-
- focus_fuckus (dialog);
-}
-
-
-static void
-make_screenhack_dialog (parent, hacks)
- Widget parent;
- char **hacks;
-{
- char buf [255];
- Arg av[10];
- int ac;
- char *label;
- XmString xm_label = 0;
- XmString new_xm_label;
-
- create_demo_dialog (parent);
- ac = 0;
- XtSetArg (av [ac], XmNlabelString, &xm_label); ac++;
- XtGetValues (label1, av, ac);
- XmStringGetLtoR (xm_label, XmSTRING_DEFAULT_CHARSET, &label);
- if (!strcmp (label, XtName (label1)))
- strcpy (buf, "ERROR: RESOURCES ARE NOT INSTALLED CORRECTLY");
- else
- sprintf (buf, label, screensaver_version);
- new_xm_label = XmStringCreate (buf, XmSTRING_DEFAULT_CHARSET);
- ac = 0;
- XtSetArg (av [ac], XmNlabelString, new_xm_label); ac++;
- XtSetValues (label1, av, ac);
- XmStringFree (new_xm_label);
- XtFree (label);
-
- XtAddCallback (demo_list, XmNbrowseSelectionCallback, select_cb,
- (XtPointer) hacks);
- XtAddCallback (demo_list, XmNdefaultActionCallback, select_cb,
- (XtPointer) hacks);
-
- XtAddCallback (text_line, XmNactivateCallback, text_cb, 0);
- XtAddCallback (next, XmNactivateCallback, next_cb, 0);
- XtAddCallback (prev, XmNactivateCallback, prev_cb, 0);
- XtAddCallback (done, XmNactivateCallback, done_cb, 0);
- XtAddCallback (restart, XmNactivateCallback, restart_cb, 0);
- XtAddCallback (edit, XmNactivateCallback, edit_cb, (XtPointer) parent);
-
- for (; *hacks; hacks++)
- {
- XmString xmstr = XmStringCreate (*hacks, XmSTRING_DEFAULT_CHARSET);
- XmListAddItem (demo_list, xmstr, 0);
- /* XmListSelectPos (widget, i, False); */
- XmStringFree (xmstr);
- }
-
-#if 0
- /* Dialogs that have scroll-lists don't obey maxWidth! Fuck!! Hack it. */
- ac = 0;
- XtSetArg (av [ac], XmNmaxWidth, &max_w); ac++;
- XtGetValues (demo_dialog, av, ac); /* great, this SEGVs */
-#endif
-
- pop_up_dialog_box (demo_dialog, demo_form, 0);
-}
-
-\f
-/* the Screensaver Parameters dialog */
-
-static struct resources {
- int timeout, cycle, secs, ticks, lock_time, passwd_time;
- int verb, cmap, fade, unfade, lock_p;
-} res;
-
-
-extern int parse_time ();
-
-static void
-hack_time_cb (dpy, line, store, sec_p)
- Display *dpy;
- char *line;
- int *store;
- Bool sec_p;
-{
- if (*line)
- {
- int value;
- value = parse_time (line, sec_p, True);
- if (value < 0)
- /*XBell (dpy, 0)*/;
- else
- *store = value;
- }
-}
-
-static void
-res_sec_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- hack_time_cb (XtDisplay (button), XmTextGetString (button),
- (int *) client_data, True);
-}
-
-static void
-res_min_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- hack_time_cb (XtDisplay (button), XmTextGetString (button),
- (int *) client_data, False);
-}
-
-static void
-res_int_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- char *line = XmTextGetString (button);
- int *store = (int *) client_data;
- unsigned int value;
- char c;
- if (! *line)
- ;
- else if (sscanf (line, "%u%c", &value, &c) != 1)
- XBell (XtDisplay (button), 0);
- else
- *store = value;
-}
-
-static void
-res_bool_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- int *store = (int *) client_data;
- *store = ((XmToggleButtonCallbackStruct *) call_data)->set;
-}
-
-static void
-res_cancel_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- XtDestroyWidget (resources_dialog);
- resources_dialog = 0;
- raise_screenhack_dialog ();
-}
-
-
-static void
-res_done_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- res_cancel_cb (button, client_data, call_data);
-
- /* Throttle the timeouts to minimum sane values. */
- if (res.timeout < 5) res.timeout = 5;
- if (res.cycle < 2) res.cycle = 2;
- if (res.passwd_time < 10) res.passwd_time = 10;
-
- timeout = res.timeout * 1000;
- cycle = res.cycle * 1000;
- lock_timeout = res.lock_time * 1000;
-#ifndef NO_LOCKING
- passwd_timeout = res.passwd_time * 1000;
-#endif
- fade_seconds = res.secs;
- fade_ticks = res.ticks;
- verbose_p = res.verb;
- install_cmap_p = res.cmap;
- fade_p = res.fade;
- unfade_p = res.unfade;
- lock_p = res.lock_p;
-
-#if defined(HAVE_MIT_SAVER_EXTENSION) || defined(HAVE_SGI_SAVER_EXTENSION)
- if (use_mit_saver_extension || use_sgi_saver_extension)
- {
- /* Need to set the server timeout to the new one the user has picked.
- */
- int server_timeout, server_interval, prefer_blank, allow_exp;
- XGetScreenSaver (dpy, &server_timeout, &server_interval,
- &prefer_blank, &allow_exp);
- if (server_timeout != (timeout / 1000))
- {
- server_timeout = (timeout / 1000);
- if (verbose_p)
- fprintf (stderr,
- "%s: configuring server for saver timeout of %d seconds.\n",
- progname, server_timeout);
- /* Leave all other parameters the same. */
- XSetScreenSaver (dpy, server_timeout, server_interval,
- prefer_blank, allow_exp);
- }
- }
-#endif /* HAVE_MIT_SAVER_EXTENSION || HAVE_SGI_SAVER_EXTENSION */
-}
-
-
-static void
-make_resources_dialog (parent)
- Widget parent;
-{
- Arg av[10];
- int ac;
-
- create_resources_dialog (parent);
-
- XtAddCallback (res_done, XmNactivateCallback, res_done_cb, 0);
- XtAddCallback (res_cancel, XmNactivateCallback, res_cancel_cb, 0);
-
-#define CB(widget,type,slot) \
- XtAddCallback ((widget), XmNvalueChangedCallback, (type), \
- (XtPointer) (slot))
- CB (timeout_text, res_min_cb, &res.timeout);
- CB (cycle_text, res_min_cb, &res.cycle);
- CB (fade_text, res_sec_cb, &res.secs);
- CB (ticks_text, res_int_cb, &res.ticks);
- CB (lock_time_text, res_min_cb, &res.lock_time);
- CB (passwd_time_text, res_sec_cb, &res.passwd_time);
- CB (verbose_toggle, res_bool_cb, &res.verb);
- CB (cmap_toggle, res_bool_cb, &res.cmap);
- CB (fade_toggle, res_bool_cb, &res.fade);
- CB (unfade_toggle, res_bool_cb, &res.unfade);
- CB (lock_toggle, res_bool_cb, &res.lock_p);
-#undef CB
- ac = 0;
- XtSetArg (av[ac], XmNsensitive, False); ac++;
-
- if (locking_disabled_p)
- {
- XtSetValues (passwd_time_text, av, ac);
- XtSetValues (lock_time_text, av, ac);
- XtSetValues (lock_toggle, av, ac);
- }
- if (CellsOfScreen (XtScreen (parent)) <= 2)
- {
- XtSetValues (fade_text, av, ac);
- XtSetValues (ticks_text, av, ac);
- XtSetValues (cmap_toggle, av, ac);
- XtSetValues (fade_toggle, av, ac);
- XtSetValues (unfade_toggle, av, ac);
- }
-}
-
-
-static void
-fmt_time (buf, s, min_p)
- char *buf;
- unsigned int s;
- int min_p;
-{
- unsigned int h = 0, m = 0;
- if (s >= 60)
- {
- m += (s / 60);
- s %= 60;
- }
- if (m >= 60)
- {
- h += (m / 60);
- m %= 60;
- }
-/*
- if (min_p && h == 0 && s == 0)
- sprintf (buf, "%u", m);
- else if (!min_p && h == 0 && m == 0)
- sprintf (buf, "%u", s);
- else
- if (h == 0)
- sprintf (buf, "%u:%02u", m, s);
- else
-*/
- sprintf (buf, "%u:%02u:%02u", h, m, s);
-}
-
-static void
-pop_resources_dialog ()
-{
- char buf [100];
-
- res.timeout = timeout / 1000;
- res.cycle = cycle / 1000;
- res.lock_time = lock_timeout / 1000;
-#ifndef NO_LOCKING
- res.passwd_time = passwd_timeout / 1000;
-#endif
- res.secs = fade_seconds;
- res.ticks = fade_ticks;
- res.verb = verbose_p;
- res.cmap = install_cmap_p;
- res.fade = fade_p;
- res.unfade = unfade_p;
- res.lock_p = (lock_p && !locking_disabled_p);
-
- fmt_time (buf, res.timeout, 1); XmTextSetString (timeout_text, buf);
- fmt_time (buf, res.cycle, 1); XmTextSetString (cycle_text, buf);
- fmt_time (buf, res.lock_time, 1); XmTextSetString (lock_time_text, buf);
- fmt_time (buf, res.passwd_time, 0); XmTextSetString (passwd_time_text, buf);
- fmt_time (buf, res.secs, 0); XmTextSetString (fade_text, buf);
- sprintf (buf, "%u", res.ticks); XmTextSetString (ticks_text, buf);
-
- XmToggleButtonSetState (verbose_toggle, res.verb, True);
- XmToggleButtonSetState (cmap_toggle, res.cmap, True);
- XmToggleButtonSetState (fade_toggle, res.fade, True);
- XmToggleButtonSetState (unfade_toggle, res.unfade, True);
- XmToggleButtonSetState (lock_toggle, res.lock_p, True);
-
- pop_up_dialog_box (resources_dialog, resources_form, 1);
-}
-
-\f
-/* The code on this page isn't actually Motif-specific */
-
-Bool dbox_up_p = False;
-Bool demo_mode_p = False;
-
-extern XtAppContext app;
-extern Widget toplevel_shell;
-extern Bool use_xidle_extension;
-extern Bool use_mit_saver_extension;
-extern Bool use_sgi_saver_extension;
-extern Time notice_events_timeout;
-
-extern char **screenhacks;
-extern char *demo_hack;
-
-extern void notice_events_timer P((XtPointer closure, XtIntervalId *timer));
-extern Bool handle_clientmessage P((/*XEvent *, Bool*/));
-
-void
-demo_mode ()
-{
- dbox_up_p = True;
- initialize_screensaver_window ();
- raise_window (True, False);
- make_screenhack_dialog (toplevel_shell, screenhacks);
- while (demo_mode_p)
- {
- XEvent event;
- XtAppNextEvent (app, &event);
- switch (event.xany.type)
- {
- case 0: /* synthetic "timeout" event */
- break;
-
- case ClientMessage:
- handle_clientmessage (&event, False);
- break;
-
- case CreateNotify:
- if (!use_xidle_extension &&
- !use_mit_saver_extension &&
- !use_sgi_saver_extension)
- {
- XtAppAddTimeOut (app, notice_events_timeout, notice_events_timer,
- (XtPointer) event.xcreatewindow.window);
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: starting notice_events_timer for 0x%X (%lu)\n",
- progname,
- (unsigned int) event.xcreatewindow.window,
- notice_events_timeout);
-#endif /* DEBUG_TIMERS */
- }
- break;
-
- case ButtonPress:
- case ButtonRelease:
- if (!XtWindowToWidget (dpy, event.xbutton.window))
- raise_screenhack_dialog ();
- /* fall through */
-
- default:
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (event.type == mit_saver_ext_event_number)
- {
- /* Get the "real" server window out of the way as soon
- as possible. */
- if (server_mit_saver_window &&
- window_exists_p (dpy, server_mit_saver_window))
- XUnmapWindow (dpy, server_mit_saver_window);
- }
- else
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
- XtDispatchEvent (&event);
- break;
- }
- }
- destroy_screenhack_dialogs ();
- initialize_screensaver_window ();
- unblank_screen ();
-}
-
-static void
-demo_mode_hack (hack)
- char *hack;
-{
- if (! demo_mode_p) abort ();
- kill_screenhack ();
- if (! demo_hack)
- blank_screen ();
- demo_hack = hack;
- spawn_screenhack (False);
- /* raise_screenhack_dialog(); */
-}
-
-static void
-demo_mode_done ()
-{
- kill_screenhack ();
- if (demo_hack)
- unblank_screen ();
- demo_mode_p = False;
- dbox_up_p = False;
- demo_hack = 0;
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* The code in this file started off its life as the output of XDesigner,
- but I've since hacked it by hand... It's a mess, avert your eyes.
- */
-
-
-#if !__STDC__
-# define _NO_PROTO
-#endif
-
-#include <X11/Xatom.h>
-#include <X11/Intrinsic.h>
-#include <X11/Shell.h>
-
-#include <Xm/Xm.h>
-#include <Xm/DialogS.h>
-#include <Xm/DrawnB.h>
-#include <Xm/Form.h>
-#include <Xm/Label.h>
-#include <Xm/List.h>
-#include <Xm/PushB.h>
-#include <Xm/ScrollBar.h>
-#include <Xm/Separator.h>
-#include <Xm/TextF.h>
-#include <Xm/ToggleB.h>
-
-#include <Xm/SelectioB.h>
-
-extern Visual *visual;
-extern int visual_depth;
-extern Colormap cmap;
-
-
-Widget passwd_dialog;
-Widget passwd_form;
-Widget roger_label;
-Widget passwd_label1;
-Widget passwd_label3;
-Widget passwd_text;
-Widget passwd_done;
-Widget passwd_cancel;
-
-Widget resources_dialog;
-Widget resources_form;
-Widget timeout_text;
-Widget cycle_text;
-Widget fade_text;
-Widget ticks_text;
-Widget lock_time_text;
-Widget passwd_time_text;
-Widget verbose_toggle;
-Widget cmap_toggle;
-Widget fade_toggle;
-Widget unfade_toggle;
-Widget lock_toggle;
-Widget res_done;
-Widget res_cancel;
-
-Widget demo_dialog;
-Widget demo_form;
-Widget label1;
-Widget label2;
-Widget text_area;
-Widget demo_list;
-Widget text_line;
-Widget vline;
-Widget next;
-Widget prev;
-Widget edit;
-Widget done;
-Widget restart;
-Widget spacer;
-
-
-void
-create_passwd_dialog( parent )
-Widget parent;
-{
- Widget shell;
- Widget form1;
- Widget roger;
- Widget dialog;
- Widget form2;
- Widget label1, label2, label3;
- Widget text;
- Widget ok, cancel;
- Widget w;
-
- shell = XmCreateDialogShell (parent, "passwdDialog", 0, 0);
-
- form1 = XmCreateForm (shell, "form", 0, 0);
-
- roger = XmCreateDrawnButton (form1, "rogerLabel", 0, 0);
-
- dialog = XmCreateSelectionBox (form1, "passwdForm", 0, 0);
-
- form2 = XmCreateForm ( dialog, "form", 0, 0);
- label1 = XmCreateLabel ( form2, "passwdLabel1", 0, 0);
- label2 = XmCreateLabel ( form2, "passwdLabel2", 0, 0);
- label3 = XmCreateLabel ( form2, "passwdLabel3", 0, 0);
-
- text = XmSelectionBoxGetChild (dialog, XmDIALOG_TEXT);
- ok = XmSelectionBoxGetChild (dialog, XmDIALOG_OK_BUTTON);
- cancel = XmSelectionBoxGetChild (dialog, XmDIALOG_CANCEL_BUTTON);
-
- w = XmSelectionBoxGetChild (dialog, XmDIALOG_LIST_LABEL);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (dialog, XmDIALOG_LIST);
- if (w) XtUnmanageChild (XtParent(w));
- w = XmSelectionBoxGetChild (dialog, XmDIALOG_SELECTION_LABEL);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (dialog, XmDIALOG_SEPARATOR);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (dialog, XmDIALOG_APPLY_BUTTON);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (dialog, XmDIALOG_HELP_BUTTON);
- if (w) XtUnmanageChild (w);
-
- XtVaSetValues(label1,
- XmNtopAttachment, XmATTACH_FORM,
- XmNleftAttachment, XmATTACH_FORM,
- XmNrightAttachment, XmATTACH_FORM,
- XmNbottomAttachment, XmATTACH_NONE,
- 0);
- XtVaSetValues(label2,
- XmNtopAttachment, XmATTACH_WIDGET,
- XmNtopWidget, label1,
- XmNleftAttachment, XmATTACH_FORM,
- XmNrightAttachment, XmATTACH_FORM,
- XmNbottomAttachment, XmATTACH_NONE,
- 0);
- XtVaSetValues(label3,
- XmNtopAttachment, XmATTACH_WIDGET,
- XmNtopWidget, label2,
- XmNleftAttachment, XmATTACH_FORM,
- XmNrightAttachment, XmATTACH_FORM,
- XmNbottomAttachment, XmATTACH_FORM,
- 0);
-
- XtVaSetValues(roger,
- XmNsensitive, FALSE,
- XmNtopAttachment, XmATTACH_FORM,
- XmNleftAttachment, XmATTACH_FORM,
- XmNrightAttachment, XmATTACH_NONE,
- XmNbottomAttachment, XmATTACH_FORM,
- 0);
- XtVaSetValues(dialog,
- XmNtopAttachment, XmATTACH_FORM,
- XmNleftAttachment, XmATTACH_WIDGET,
- XmNleftWidget, roger,
- XmNrightAttachment, XmATTACH_FORM,
- XmNbottomAttachment, XmATTACH_FORM,
- 0);
-
- XtManageChild(label1);
- XtManageChild(label2);
- XtManageChild(label3);
-
- XtManageChild(form2);
- XtManageChild(text);
- XtManageChild(ok);
- XtManageChild(cancel);
-
- XtManageChild(roger);
- XtManageChild(dialog);
-
- {
- Dimension w = 0, h = 0;
- XtRealizeWidget(form1);
- XtVaGetValues(roger, XmNwidth, &w, XmNheight, &h, 0);
- if (w == h)
- ;
- else if (w > h)
- XtVaSetValues(roger, XmNwidth, w, XmNheight, w, 0);
- else
- XtVaSetValues(roger, XmNwidth, h, XmNheight, h, 0);
- }
-
- passwd_dialog = shell;
- passwd_form = form1;
- roger_label = roger;
- passwd_label1 = label1;
- passwd_label3 = label3;
- passwd_text = text;
- passwd_done = ok;
- passwd_cancel = cancel;
-}
-
-
-
-void
-create_resources_dialog( parent )
-Widget parent;
-{
- Widget children[22]; /* Children to manage */
- Arg al[64]; /* Arg List */
- register int ac = 0; /* Arg Count */
- Widget widget12;
- Widget widget13;
- Widget widget14;
- Widget widget15;
- Widget widget16;
- Widget widget17;
- Widget widget18;
- Widget widget48;
- Widget widget29;
-
- Widget real_dialog;
- Widget w;
-
-
- ac = 0;
- XtSetArg (al[ac], XmNvisual, visual); ac++;
- XtSetArg (al[ac], XmNcolormap, cmap); ac++;
- XtSetArg (al[ac], XmNdepth, visual_depth); ac++;
-
- real_dialog = XmCreatePromptDialog (parent, "resourcesForm", al, ac);
- resources_dialog = XtParent(real_dialog);
-
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_SEPARATOR);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_TEXT);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_SELECTION_LABEL);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_HELP_BUTTON);
- if (w) XtUnmanageChild (w);
-
- ac = 0;
- XtSetArg (al [ac], XmNtopAttachment, XmATTACH_FORM); ac++;
- XtSetArg (al [ac], XmNbottomAttachment, XmATTACH_FORM); ac++;
- XtSetArg (al [ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg (al [ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- resources_form = XmCreateForm (real_dialog, "form", al, ac);
- XtManageChild (resources_form);
-
- ac = 0;
-
- widget12 = XmCreateLabel ( resources_form, "resourcesLabel", al, ac );
- widget13 = XmCreateSeparator ( resources_form, "widget13", al, ac );
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_END); ac++;
- widget14 = XmCreateLabel ( resources_form, "timeoutLabel", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_END); ac++;
- widget15 = XmCreateLabel ( resources_form, "cycleLabel", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_END); ac++;
- widget16 = XmCreateLabel ( resources_form, "fadeSecondsLabel", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_END); ac++;
- widget17 = XmCreateLabel ( resources_form, "fadeTicksLabel", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_END); ac++;
- widget18 = XmCreateLabel ( resources_form, "lockLabel", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_END); ac++;
- widget48 = XmCreateLabel ( resources_form, "passwdLabel", al, ac );
- ac = 0;
- timeout_text = XmCreateTextField ( resources_form, "timeoutText", al, ac );
- cycle_text = XmCreateTextField ( resources_form, "cycleText", al, ac );
- fade_text = XmCreateTextField ( resources_form, "fadeSecondsText", al, ac );
- ticks_text = XmCreateTextField ( resources_form, "fadeTicksText", al, ac );
- lock_time_text = XmCreateTextField ( resources_form, "passwdText", al, ac );
- passwd_time_text = XmCreateTextField ( resources_form, "lockText", al, ac );
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_BEGINNING); ac++;
- verbose_toggle = XmCreateToggleButton ( resources_form, "verboseToggle", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_BEGINNING); ac++;
- cmap_toggle = XmCreateToggleButton ( resources_form, "cmapToggle", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_BEGINNING); ac++;
- fade_toggle = XmCreateToggleButton ( resources_form, "fadeToggle", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_BEGINNING); ac++;
- unfade_toggle = XmCreateToggleButton ( resources_form, "unfadeToggle", al, ac );
- ac = 0;
- XtSetArg(al[ac], XmNalignment, XmALIGNMENT_BEGINNING); ac++;
- lock_toggle = XmCreateToggleButton ( resources_form, "lockToggle", al, ac );
- ac = 0;
- widget29 = XmCreateSeparator ( resources_form, "widget29", al, ac );
-
- res_done = XmSelectionBoxGetChild (real_dialog, XmDIALOG_OK_BUTTON);
- res_cancel = XmSelectionBoxGetChild (real_dialog, XmDIALOG_CANCEL_BUTTON);
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetValues ( widget12,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, widget12); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 0); ac++;
- XtSetValues ( widget13,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, widget13); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomWidget, timeout_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 20); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightWidget, timeout_text); ac++;
- XtSetValues ( widget14,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, cycle_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, cycle_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 20); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightWidget, cycle_text); ac++;
- XtSetValues ( widget15,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, fade_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, fade_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 20); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightWidget, fade_text); ac++;
- XtSetValues ( widget16,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, ticks_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, ticks_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 20); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightWidget, ticks_text); ac++;
- XtSetValues ( widget17,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, lock_time_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, lock_time_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 19); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightWidget, lock_time_text); ac++;
- XtSetValues ( widget18,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, passwd_time_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, passwd_time_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 14); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightWidget, passwd_time_text); ac++;
- XtSetValues ( widget48,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, widget13); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 141); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_NONE); ac++;
- XtSetValues ( timeout_text,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 2); ac++;
- XtSetArg(al[ac], XmNtopWidget, timeout_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, timeout_text); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_NONE); ac++;
- XtSetValues ( cycle_text,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 2); ac++;
- XtSetArg(al[ac], XmNtopWidget, cycle_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, cycle_text); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_NONE); ac++;
- XtSetValues ( fade_text,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 2); ac++;
- XtSetArg(al[ac], XmNtopWidget, fade_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, fade_text); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_NONE); ac++;
- XtSetValues ( ticks_text,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 2); ac++;
- XtSetArg(al[ac], XmNtopWidget, ticks_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, ticks_text); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_NONE); ac++;
- XtSetValues ( lock_time_text,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, lock_time_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, lock_time_text); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_NONE); ac++;
- XtSetValues ( passwd_time_text,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, widget13); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, timeout_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 20); ac++;
- XtSetArg(al[ac], XmNleftWidget, timeout_text); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 20); ac++;
- XtSetValues ( verbose_toggle,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, cycle_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, cycle_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, verbose_toggle); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 20); ac++;
- XtSetValues ( cmap_toggle,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, fade_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, fade_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, cmap_toggle); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 20); ac++;
- XtSetValues ( fade_toggle,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, ticks_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, ticks_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, fade_toggle); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 20); ac++;
- XtSetValues ( unfade_toggle,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, lock_time_text); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 0); ac++;
- XtSetArg(al[ac], XmNbottomWidget, lock_time_text); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_OPPOSITE_WIDGET); ac++;
- XtSetArg(al[ac], XmNleftOffset, 0); ac++;
- XtSetArg(al[ac], XmNleftWidget, unfade_toggle); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 20); ac++;
- XtSetValues ( lock_toggle,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 0); ac++;
- XtSetArg(al[ac], XmNtopWidget, passwd_time_text); ac++;
-
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNbottomOffset, 4); ac++;
-
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetValues ( widget29,al, ac );
- ac = 0;
-
-
-
- ac = 0;
- children[ac++] = widget12;
- children[ac++] = widget13;
- children[ac++] = widget14;
- children[ac++] = widget15;
- children[ac++] = widget16;
- children[ac++] = widget17;
- children[ac++] = widget18;
- children[ac++] = widget48;
- children[ac++] = timeout_text;
- children[ac++] = cycle_text;
- children[ac++] = fade_text;
- children[ac++] = ticks_text;
- children[ac++] = lock_time_text;
- children[ac++] = passwd_time_text;
- children[ac++] = verbose_toggle;
- children[ac++] = cmap_toggle;
- children[ac++] = fade_toggle;
- children[ac++] = unfade_toggle;
- children[ac++] = lock_toggle;
- children[ac++] = widget29;
-
- XtManageChildren(children, ac);
- ac = 0;
-
- resources_form = real_dialog;
-}
-
-
-
-void
-create_demo_dialog( parent )
-Widget parent;
-{
- Widget children[11]; /* Children to manage */
- Arg al[64]; /* Arg List */
- register int ac = 0; /* Arg Count */
- XmString xmstrings[15]; /* temporary storage for XmStrings */
-
- Widget real_dialog;
- Widget w;
-
-
- ac = 0;
- XtSetArg (al[ac], XmNvisual, visual); ac++;
- XtSetArg (al[ac], XmNcolormap, cmap); ac++;
- XtSetArg (al[ac], XmNdepth, visual_depth); ac++;
-
-
- real_dialog = XmCreatePromptDialog (parent, "demoForm", al, ac);
- demo_dialog = XtParent(real_dialog);
-
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_SEPARATOR);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_TEXT);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_SELECTION_LABEL);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_OK_BUTTON);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_CANCEL_BUTTON);
- if (w) XtUnmanageChild (w);
- w = XmSelectionBoxGetChild (real_dialog, XmDIALOG_HELP_BUTTON);
- if (w) XtUnmanageChild (w);
-
- ac = 0;
- XtSetArg (al [ac], XmNtopAttachment, XmATTACH_FORM); ac++;
- XtSetArg (al [ac], XmNbottomAttachment, XmATTACH_FORM); ac++;
- XtSetArg (al [ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg (al [ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- demo_form = XmCreateForm (real_dialog, "form", al, ac);
- XtManageChild (demo_form);
-
- label1 = XmCreateLabel ( demo_form, "label1", al, ac );
- label2 = XmCreateLabel ( demo_form, "label2", al, ac );
- demo_list = XmCreateScrolledList ( demo_form, "demoList", al, ac );
- text_area = XtParent ( demo_list );
-
- ac = 0;
- text_line = XmSelectionBoxGetChild (real_dialog, XmDIALOG_TEXT);
- XtManageChild(text_line);
-
- next = XmCreatePushButton ( real_dialog, "next", al, ac );
- prev = XmCreatePushButton ( real_dialog, "prev", al, ac );
- edit = XmCreatePushButton ( real_dialog, "edit", al, ac );
- done = XmCreatePushButton ( real_dialog, "done", al, ac );
- restart = XmCreatePushButton ( real_dialog, "restart", al, ac );
- XtManageChild(next);
- XtManageChild(prev);
- XtManageChild(edit);
- XtManageChild(done);
- XtManageChild(restart);
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNtopOffset, 5); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetValues ( label1,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, label1); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_NONE); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetValues ( label2,al, ac );
- ac = 0;
-
- XtSetArg(al[ac], XmNtopAttachment, XmATTACH_WIDGET); ac++;
- XtSetArg(al[ac], XmNtopOffset, 4); ac++;
- XtSetArg(al[ac], XmNtopWidget, label2); ac++;
- XtSetArg(al[ac], XmNbottomAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNleftOffset, 4); ac++;
- XtSetArg(al[ac], XmNrightAttachment, XmATTACH_FORM); ac++;
- XtSetArg(al[ac], XmNrightOffset, 4); ac++;
- XtSetValues ( text_area,al, ac );
-
- XtManageChild(demo_list);
- XtManageChild(label1);
- XtManageChild(label2);
-
- demo_form = real_dialog;
-}
+++ /dev/null
-module 'XScreenSaver'
-applicationName = 'XScreenSaver';
-generateNameC = 'dialogs.c';
-generateNameUIL = '';
-generateNameResDB = 'dialogs.ad';
-generateUidFile = '';
-generateMask = 1507557;
-useMask = 1;
-value
-object 'passwd_dialog' : XmDialogShell {
- arguments {
- name = 'passwdDialog';
- XmNtitle= 'XScreenSaver';
- XmNallowShellResize= true;
- };
-object 'passwd_form' : XmForm {
- arguments {
- name = 'passwdForm';
- XmNautoUnmanage= false;
- };
-object 'roger_label' : XmDrawnButton {
- arguments {
- name = 'rogerLabel';
- XmNwidth= 150;
- };
-};
-object 'passwd_label1' : XmLabel {
- arguments {
- name = 'passwdLabel1';
- XmNlabelString= 'XScreenSaver %s';
- XmNalignment= 0;
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'passwdLabel2';
- XmNlabelString= 'This display is locked.';
- XmNalignment= 0;
- };
-};
-object 'passwd_label3' : XmLabel {
- arguments {
- name = 'passwdLabel3';
- XmNlabelString= 'Please type %s\'s password to unlock it.';
- XmNalignment= 0;
- };
-};
-object 'passwd_text' : XmTextField {
- arguments {
- name = 'passwdText';
- };
-};
-object '' : XmSeparator {
- arguments {
- };
-};
-object 'passwd_done' : XmPushButton {
- arguments {
- name = 'passwdDone';
- XmNlabelString= 'Done';
- };
-};
-object 'passwd_cancel' : XmPushButton {
- arguments {
- name = 'passwdCancel';
- XmNlabelString= 'Cancel';
- };
-};
- attachments {
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 1 0 4;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 3 1 4;
- XmNbottomAttachment = 3 3 4;
- XmNtopAttachment = 1 0 4;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 3 1 4;
- XmNbottomAttachment = 3 4 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 1 0 30;
- XmNleftAttachment = 3 1 4;
- XmNbottomAttachment = 3 5 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 3 1 4;
- XmNbottomAttachment = 3 6 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 1 0 0;
- XmNleftAttachment = 3 1 0;
- XmNbottomAttachment = 3 7 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 1 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 7 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 0 0 0;
- };
- };
-};
-};
-object 'resources_dialog' : XmDialogShell {
- arguments {
- name = 'resourcesDialog';
- XmNtitle= 'XScreenSaver';
- XmNallowShellResize= true;
- };
-object 'resources_form' : XmForm {
- arguments {
- name = 'resourcesForm';
- XmNautoUnmanage= false;
- };
-object '' : XmLabel {
- arguments {
- name = 'resourcesLabel';
- XmNlabelString= 'XScreenSaver Parameters';
- };
-};
-object '' : XmSeparator {
- arguments {
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'timeoutLabel';
- XmNlabelString= 'Timeout Minutes';
- XmNalignment= * 2;
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'cycleLabel';
- XmNlabelString= 'Cycle Seconds';
- XmNalignment= * 2;
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'fadeSecondsLabel';
- XmNlabelString= 'Fade Seconds';
- XmNalignment= * 2;
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'fadeTicksLabel';
- XmNlabelString= 'Fade Ticks';
- XmNalignment= * 2;
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'lockLabel';
- XmNlabelString= 'Lock Timeout';
- XmNalignment= * 2;
- };
-};
-object '' : XmLabel {
- arguments {
- name = 'passwdLabel';
- XmNlabelString= 'Password Timeout';
- XmNalignment= * 2;
- };
-};
-object 'timeout_text' : XmTextField {
- arguments {
- name = 'timeoutText';
- XmNcolumns= 5;
- };
-};
-object 'cycle_text' : XmTextField {
- arguments {
- name = 'cycleText';
- XmNcolumns= 5;
- };
-};
-object 'fade_text' : XmTextField {
- arguments {
- name = 'fadeSecondsText';
- XmNcolumns= 5;
- };
-};
-object 'ticks_text' : XmTextField {
- arguments {
- name = 'fadeTicksText';
- XmNcolumns= 5;
- };
-};
-object 'lock_time_text' : XmTextField {
- arguments {
- name = 'passwdText';
- XmNcolumns= 5;
- };
-};
-object 'passwd_time_text' : XmTextField {
- arguments {
- name = 'lockText';
- XmNcolumns= 5;
- };
-};
-object 'verbose_toggle' : XmToggleButton {
- arguments {
- name = 'verboseToggle';
- XmNlabelString= 'Verbose';
- XmNalignment= * 0;
- };
-};
-object 'cmap_toggle' : XmToggleButton {
- arguments {
- name = 'cmapToggle';
- XmNlabelString= 'Install Colormap';
- XmNalignment= * 0;
- };
-};
-object 'fade_toggle' : XmToggleButton {
- arguments {
- name = 'fadeToggle';
- XmNlabelString= 'Fade Colormap';
- XmNalignment= * 0;
- };
-};
-object 'unfade_toggle' : XmToggleButton {
- arguments {
- name = 'unfadeToggle';
- XmNlabelString= 'Unfade Colormap';
- XmNalignment= * 0;
- };
-};
-object 'lock_toggle' : XmToggleButton {
- arguments {
- name = 'lockToggle';
- XmNlabelString= 'Require Password';
- XmNalignment= * 0;
- };
-};
-object '' : XmSeparator {
- arguments {
- };
-};
-object 'res_done' : XmPushButton {
- arguments {
- name = 'resourcesDone';
- XmNlabelString= 'Done';
- };
-};
-object 'res_cancel' : XmPushButton {
- arguments {
- name = 'resourcesCancel';
- XmNlabelString= 'Cancel';
- };
-};
- attachments {
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 1 0 4;
- XmNtopAttachment = 1 0 4;
- };
- attachment {
- XmNrightAttachment = 1 0 0;
- XmNleftAttachment = 1 0 0;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 1 4;
- };
- attachment {
- XmNrightAttachment = 3 9 4;
- XmNleftAttachment = 1 0 20;
- XmNbottomAttachment = 4 9;
- XmNtopAttachment = 3 2 4;
- };
- attachment {
- XmNrightAttachment = 3 10 4;
- XmNleftAttachment = 1 0 20;
- XmNbottomAttachment = 4 10 0;
- XmNtopAttachment = 4 10 0;
- };
- attachment {
- XmNrightAttachment = 3 11 4;
- XmNleftAttachment = 1 0 20;
- XmNbottomAttachment = 4 11 0;
- XmNtopAttachment = 4 11 0;
- };
- attachment {
- XmNrightAttachment = 3 12 4;
- XmNleftAttachment = 1 0 20;
- XmNbottomAttachment = 4 12 0;
- XmNtopAttachment = 4 12 0;
- };
- attachment {
- XmNrightAttachment = 3 13 4;
- XmNleftAttachment = 1 0 19;
- XmNbottomAttachment = 4 13 0;
- XmNtopAttachment = 4 13 0;
- };
- attachment {
- XmNrightAttachment = 3 14 4;
- XmNleftAttachment = 1 0 14;
- XmNbottomAttachment = 4 14 0;
- XmNtopAttachment = 4 14 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 1 0 141;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 2 4;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 4 9 0;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 9 2;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 4 10 0;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 10 2;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 4 11 0;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 11 2;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 4 12 0;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 12 2;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 4 13 0;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 13 4;
- };
- attachment {
- XmNrightAttachment = 1 0 20;
- XmNleftAttachment = 3 9 20;
- XmNbottomAttachment = 4 9 0;
- XmNtopAttachment = 3 2 4;
- };
- attachment {
- XmNrightAttachment = 1 0 20;
- XmNleftAttachment = 4 15 0;
- XmNbottomAttachment = 4 10 0;
- XmNtopAttachment = 4 10 0;
- };
- attachment {
- XmNrightAttachment = 1 0 20;
- XmNleftAttachment = 4 16 0;
- XmNbottomAttachment = 4 11 0;
- XmNtopAttachment = 4 11 0;
- };
- attachment {
- XmNrightAttachment = 1 0 20;
- XmNleftAttachment = 4 17 0;
- XmNbottomAttachment = 4 12 0;
- XmNtopAttachment = 4 12 0;
- };
- attachment {
- XmNrightAttachment = 1 0 20;
- XmNleftAttachment = 4 18 0;
- XmNbottomAttachment = 4 13 0;
- XmNtopAttachment = 4 13 0;
- };
- attachment {
- XmNrightAttachment = 1 0;
- XmNleftAttachment = 1 0;
- XmNbottomAttachment = 3 21 4;
- XmNtopAttachment = 3 14 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 21 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 0 0 0;
- };
- };
-};
-};
-object 'demo_dialog' : XmDialogShell {
- arguments {
- name = 'demoDialog';
- XmNtitle= 'XScreenSaver';
- XmNmaxWidth= 500;
- XmNallowShellResize= true;
- };
-object 'demo_form' : XmForm {
- arguments {
- name = 'demoForm';
- XmNautoUnmanage= false;
- };
-object 'label1' : XmLabel {
- arguments {
- name = 'label1';
- XmNlabelString= 'XScreenSaver %s';
- };
-};
-object 'label2' : XmLabel {
- arguments {
- name = 'label2';
- XmNlabelString= 'Copyright © 1991-1994 by Jamie Zawinski <jwz@netscape.com>';
- };
-};
-object 'text_area' : XmScrolledList {
- arguments {
- name = 'textArea';
- };
-object '' : XmScrollBar {
- arguments {
- name = 'ListhScrollBar';
- };
-};
-object '' : XmScrollBar {
- arguments {
- name = 'ListvScrollBar';
- };
-};
-object 'demo_list' : XmList {
- arguments {
- name = 'demoList';
- XmNvisibleItemCount= 10;
- XmNautomaticSelection= true;
- XmNlistSizePolicy= 2;
- };
-};
-};
-object 'text_line' : XmTextField {
- arguments {
- name = 'textLine';
- };
-};
-object 'vline' : XmSeparator {
- arguments {
- name = 'vline';
- };
-};
-object 'next' : XmPushButton {
- arguments {
- name = 'next';
- XmNlabelString= 'Run Next';
- };
-};
-object 'prev' : XmPushButton {
- arguments {
- name = 'prev';
- XmNlabelString= 'Run Previous';
- };
-};
-object 'edit' : XmPushButton {
- arguments {
- name = 'edit';
- XmNlabelString= 'Edit Parameters';
- };
-};
-object 'done' : XmPushButton {
- arguments {
- name = 'done';
- XmNlabelString= 'Exit Demo Mode';
- };
-};
-object 'restart' : XmPushButton {
- arguments {
- name = 'restart';
- XmNlabelString= 'Restart Screen Saver';
- };
-};
-object 'spacer' : XmLabel {
- arguments {
- name = 'spacer';
- XmNlabelString= * ' ';
- };
-};
- attachments {
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 1 0 5;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 0 0 0;
- XmNtopAttachment = 3 1 4;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 3 4 4;
- XmNtopAttachment = 3 2 4;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 3 5 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 1 0 4;
- XmNbottomAttachment = 3 6 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 1 0 3;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 0 0 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 6 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 4 6 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 7 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 4 7 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 8 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 4 8 0;
- };
- attachment {
- XmNrightAttachment = 0 0 0;
- XmNleftAttachment = 3 9 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 4 9 0;
- };
- attachment {
- XmNrightAttachment = 1 0 4;
- XmNleftAttachment = 3 10 4;
- XmNbottomAttachment = 1 0 4;
- XmNtopAttachment = 4 10 0;
- };
- };
-};
-};
-end module;
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993-1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* #### If anyone ever finishes the Athena locking code, remove this.
- But until then, locking requires Motif.
- */
-#if defined(NO_MOTIF) && !defined(NO_LOCKING)
-# define NO_LOCKING
-#endif
-
-
-#ifndef NO_LOCKING
-
-#if __STDC__
-#include <stdlib.h>
-#include <unistd.h>
-#include <string.h>
-#endif
-
-#ifdef HAVE_SHADOW
-#include <shadow.h>
-#endif
-
-#include <pwd.h>
-#include <stdio.h>
-
-#include <X11/Intrinsic.h>
-
-#include "xscreensaver.h"
-
-extern char *screensaver_version;
-extern char *progname;
-extern XtAppContext app;
-extern Bool verbose_p;
-
-#ifdef SCO
-/* SCO has some kind of goofy, nonstandard security crap. This stuff was
- donated by one of their victims, I mean users, Didier Poirot <dp@chorus.fr>.
- */
-# include <sys/security.h>
-# include <sys/audit.h>
-# include <prot.h>
-#endif
-
-#if !__STDC__
-# define _NO_PROTO
-#endif
-
-#ifdef NO_MOTIF
-
-# include <X11/StringDefs.h>
-# include <X11/Xaw/Text.h>
-# include <X11/Xaw/Label.h>
-
-#else /* Motif */
-
-# include <Xm/Xm.h>
-# include <Xm/List.h>
-# include <Xm/TextF.h>
-
-#endif /* Motif */
-
-Time passwd_timeout;
-
-extern Widget passwd_dialog;
-extern Widget passwd_form;
-extern Widget roger_label;
-extern Widget passwd_label1;
-extern Widget passwd_label3;
-extern Widget passwd_text;
-extern Widget passwd_done;
-extern Widget passwd_cancel;
-
-extern create_passwd_dialog P((Widget));
-extern void ungrab_keyboard_and_mouse P((void));
-
-static enum { pw_read, pw_ok, pw_fail, pw_cancel, pw_time } passwd_state;
-static char typed_passwd [1024];
-
-static char root_passwd [255];
-static char user_passwd [255];
-
-#ifdef HAVE_SHADOW
-# define PWTYPE struct spwd *
-# define PWSLOT sp_pwdp
-# define GETPW getspnam
-#else
-# define PWTYPE struct passwd *
-# define PWSLOT pw_passwd
-# define GETPW getpwnam
-#endif
-
-#ifdef SCO
-# define PRPWTYPE struct pr_passwd *
-# define GETPRPW getprpwnam
-#endif
-
-Bool
-lock_init ()
-{
- Bool ok = True;
- char *u;
- PWTYPE p = GETPW ("root");
-
-#ifdef SCO
- PRPWTYPE prpwd = GETPRPW ("root");
- if (prpwd && *prpwd->ufld.fd_encrypt)
- strcpy (root_passwd, prpwd->ufld.fd_encrypt);
-#else /* !SCO */
- if (p && p->PWSLOT && p->PWSLOT[0] != '*')
- strcpy (root_passwd, p->PWSLOT);
-#endif /* !SCO */
- else
- {
- fprintf (stderr, "%s: couldn't get root's password\n", progname);
- strcpy (root_passwd, "*");
- }
-
- /* It has been reported that getlogin() returns the wrong user id on some
- very old SGI systems... */
- u = (char *) getlogin ();
- if (u)
- {
-#ifdef SCO
- prpwd = GETPRPW (u);
-#endif /* SCO */
- p = GETPW (u);
- }
- else
- {
- /* getlogin() fails if not attached to a terminal;
- in that case, use getpwuid(). */
- struct passwd *p2 = getpwuid (getuid ());
- u = p2->pw_name;
-#ifdef HAVE_SHADOW
- p = GETPW (u);
-#else
- p = p2;
-#endif
- }
-
-#ifdef SCO
- if (prpwd && *prpwd->ufld.fd_encrypt)
- strcpy (user_passwd, prpwd->ufld.fd_encrypt);
-#else /* !SCO */
- if (p && p->PWSLOT &&
- /* p->PWSLOT[0] != '*' */ /* sensible */
- (strlen (p->PWSLOT) > 4) /* solaris */
- )
- strcpy (user_passwd, p->PWSLOT);
-#endif /* !SCO */
- else
- {
- fprintf (stderr, "%s: couldn't get password of \"%s\"\n", progname, u);
- strcpy (user_passwd, "*");
- ok = False;
- }
- return ok;
-}
-
-
-\f
-#if defined(NO_MOTIF) || (XmVersion >= 1002)
- /* The `destroy' bug apears to be fixed as of Motif 1.2.1, but
- the `verify-callback' bug is still present. */
-# define DESTROY_WORKS
-#endif
-
-static void
-passwd_cancel_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- passwd_state = pw_cancel;
-}
-
-static void
-passwd_done_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- if (passwd_state != pw_read) return; /* already done */
- if (!strcmp ((char *) crypt (typed_passwd, user_passwd), user_passwd))
- passwd_state = pw_ok;
- /* do not allow root to have empty passwd */
- else if (typed_passwd [0] &&
- !strcmp ((char *) crypt (typed_passwd, root_passwd), root_passwd))
- passwd_state = pw_ok;
- else
- passwd_state = pw_fail;
-}
-
-#if !defined(NO_MOTIF) && defined(VERIFY_CALLBACK_WORKS)
-
- /* #### It looks to me like adding any modifyVerify callback causes
- #### Motif 1.1.4 to free the the TextF_Value() twice. I can't see
- #### the bug in the Motif source, but Purify complains, even if
- #### check_passwd_cb() is a no-op.
-
- #### Update: Motif 1.2.1 also loses, but in a different way: it
- #### writes beyond the end of a malloc'ed block in ModifyVerify().
- #### Probably this block is the text field's text.
- */
-
-static void
-check_passwd_cb (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- XmTextVerifyCallbackStruct *vcb = (XmTextVerifyCallbackStruct *) call_data;
-
- if (passwd_state != pw_read)
- return;
- else if (vcb->reason == XmCR_ACTIVATE)
- {
- passwd_done_cb (0, 0, 0);
- }
- else if (vcb->text->length > 1) /* don't allow "paste" operations */
- {
- vcb->doit = False;
- }
- else if (vcb->text->ptr != 0)
- {
- int i;
- strncat (typed_passwd, vcb->text->ptr, vcb->text->length);
- typed_passwd [vcb->endPos + vcb->text->length] = 0;
- for (i = 0; i < vcb->text->length; i++)
- vcb->text->ptr [i] = '*';
- }
-}
-
-#else /* !VERIFY_CALLBACK_WORKS */
-
-static void keypress();
-static void backspace();
-static void kill_line();
-static void done();
-
-static XtActionsRec actions[] = {{"keypress", keypress},
- {"backspace", backspace},
- {"kill_line", kill_line},
- {"done", done}
- };
-
-#if 0 /* oh fuck, why doesn't this work? */
-static char translations[] = "\
-<Key>BackSpace: backspace()\n\
-<Key>Delete: backspace()\n\
-Ctrl<Key>H: backspace()\n\
-Ctrl<Key>U: kill_line()\n\
-Ctrl<Key>X: kill_line()\n\
-Ctrl<Key>J: done()\n\
-Ctrl<Key>M: done()\n\
-<Key>: keypress()\n\
-";
-#else
-static char translations[] = "<Key>:keypress()";
-#endif
-
-static void
-text_field_set_string (widget, text, position)
- Widget widget;
- char *text;
- int position;
-{
-#ifdef NO_MOTIF
- XawTextBlock block;
- block.firstPos = 0;
- block.length = strlen (text);
- block.ptr = text;
- block.format = 0;
- XawTextReplace (widget, 0, -1, &block);
- XawTextSetInsertionPoint (widget, position);
-#else /* !NO_MOTIF */
- XmTextFieldSetString (widget, text);
- XmTextFieldSetInsertionPosition (widget, position);
-#endif /* !NO_MOTIF */
-}
-
-
-static void
-keypress (w, event, argv, argc)
- Widget w;
- XEvent *event;
- String *argv;
- Cardinal *argc;
-{
- int i, j;
- char s [sizeof (typed_passwd)];
- int size = XLookupString ((XKeyEvent *) event, s, sizeof (s), 0, 0);
- if (size != 1) return;
-
- /* hack because I can't get translations to dance to my tune... */
- if (*s == '\010') { backspace (w, event, argv, argc); return; }
- if (*s == '\177') { backspace (w, event, argv, argc); return; }
- if (*s == '\025') { kill_line (w, event, argv, argc); return; }
- if (*s == '\030') { kill_line (w, event, argv, argc); return; }
- if (*s == '\012') { done (w, event, argv, argc); return; }
- if (*s == '\015') { done (w, event, argv, argc); return; }
-
- i = j = strlen (typed_passwd);
- typed_passwd [i] = *s;
- s [++i] = 0;
- while (i--)
- s [i] = '*';
-
- text_field_set_string (passwd_text, s, j + 1);
-}
-
-static void
-backspace (w, event, argv, argc)
- Widget w;
- XEvent *event;
- String *argv;
- Cardinal *argc;
-{
- char s [sizeof (typed_passwd)];
- int i = strlen (typed_passwd);
- int j = i;
- if (i == 0)
- return;
- typed_passwd [--i] = 0;
- s [i] = 0;
- while (i--)
- s [i] = '*';
-
- text_field_set_string (passwd_text, s, j + 1);
-}
-
-static void
-kill_line (w, event, argv, argc)
- Widget w;
- XEvent *event;
- String *argv;
- Cardinal *argc;
-{
- memset (typed_passwd, 0, sizeof (typed_passwd));
- text_field_set_string (passwd_text, "", 0);
-}
-
-static void
-done (w, event, argv, argc)
- Widget w;
- XEvent *event;
- String *argv;
- Cardinal *argc;
-{
- passwd_done_cb (w, 0, 0);
-}
-
-#endif /* !VERIFY_CALLBACK_WORKS || NO_MOTIF */
-
-static void
-format_into_label (widget, string)
- Widget widget;
- char *string;
-{
- char *label;
- char buf [255];
- Arg av[10];
- int ac = 0;
-
-#ifdef NO_MOTIF
- XtSetArg (av [ac], XtNlabel, &label); ac++;
- XtGetValues (widget, av, ac);
-#else /* Motif */
- XmString xm_label = 0;
- XmString new_xm_label;
- XtSetArg (av [ac], XmNlabelString, &xm_label); ac++;
- XtGetValues (widget, av, ac);
- XmStringGetLtoR (xm_label, XmSTRING_DEFAULT_CHARSET, &label);
-#endif /* Motif */
-
- if (!label || !strcmp (label, XtName (widget)))
- strcpy (buf, "ERROR: RESOURCES ARE NOT INSTALLED CORRECTLY");
- else
- sprintf (buf, label, string);
-
- ac = 0;
-
-#ifdef NO_MOTIF
- XtSetArg (av [ac], XtNlabel, buf); ac++;
-#else /* Motif */
- new_xm_label = XmStringCreate (buf, XmSTRING_DEFAULT_CHARSET);
- XtSetArg (av [ac], XmNlabelString, new_xm_label); ac++;
-#endif /* Motif */
-
- XtSetValues (widget, av, ac);
-#ifndef NO_MOTIF
- XmStringFree (new_xm_label);
-#endif
- XtFree (label);
-}
-
-#if __STDC__
-extern void skull (Display *, Window, GC, GC, int, int, int, int);
-#endif
-
-static void
-roger (button, client_data, call_data)
- Widget button;
- XtPointer client_data, call_data;
-{
- Display *dpy = XtDisplay (button);
- Screen *screen = XtScreen (button);
- Window window = XtWindow (button);
- Arg av [10];
- int ac = 0;
- XGCValues gcv;
- Colormap cmap;
- GC draw_gc, erase_gc;
- unsigned int fg, bg;
- int x, y, size;
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- if (xgwa.width > xgwa.height) size = xgwa.height;
- else size = xgwa.width;
- if (size > 40) size -= 30;
- x = (xgwa.width - size) / 2;
- y = (xgwa.height - size) / 2;
- XtSetArg (av [ac], XtNforeground, &fg); ac++;
- XtSetArg (av [ac], XtNbackground, &bg); ac++;
- XtGetValues (button, av, ac);
- /* if it's black on white, swap it cause it looks better (hack hack) */
- if (fg == BlackPixelOfScreen (screen) && bg == WhitePixelOfScreen (screen))
- fg = WhitePixelOfScreen (screen), bg = BlackPixelOfScreen (screen);
- gcv.foreground = bg;
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- gcv.foreground = fg;
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- XFillRectangle (dpy, window, erase_gc, 0, 0, xgwa.width, xgwa.height);
- skull (dpy, window, draw_gc, erase_gc, x, y, size, size);
- XFreeGC (dpy, draw_gc);
- XFreeGC (dpy, erase_gc);
-}
-
-#ifdef NO_MOTIF
-
-static void
-make_passwd_dialog (parent)
- Widget parent;
-{
- abort (); /* #### */
-}
-
-#else /* Motif */
-
-static void
-make_passwd_dialog (parent)
- Widget parent;
-{
- struct passwd *pw;
- create_passwd_dialog (parent);
-
- XtAddCallback (passwd_done, XmNactivateCallback, passwd_done_cb, 0);
- XtAddCallback (passwd_cancel, XmNactivateCallback, passwd_cancel_cb, 0);
- XtAddCallback (roger_label, XmNexposeCallback, roger, 0);
-
-#ifdef VERIFY_CALLBACK_WORKS
- XtAddCallback (passwd_text, XmNmodifyVerifyCallback, check_passwd_cb, 0);
- XtAddCallback (passwd_text, XmNactivateCallback, check_passwd_cb, 0);
-#else
- XtAddCallback (passwd_text, XmNactivateCallback, passwd_done_cb, 0);
- XtOverrideTranslations (passwd_text, XtParseTranslationTable (translations));
-#endif
-
-#if !defined(NO_MOTIF) && (XmVersion >= 1002)
- /* The focus stuff changed around; this didn't exist in 1.1.5. */
- XtVaSetValues (passwd_form, XmNinitialFocus, passwd_text, 0);
-#endif
-
- /* Another random thing necessary in 1.2.1 but not 1.1.5... */
- XtVaSetValues (roger_label, XmNborderWidth, 2, 0);
-
- pw = getpwuid (getuid ());
- format_into_label (passwd_label3, (pw->pw_name ? pw->pw_name : "???"));
- format_into_label (passwd_label1, screensaver_version);
-}
-
-#endif /* Motif */
-
-extern void idle_timer ();
-
-static int passwd_idle_timer_tick;
-static XtIntervalId id;
-
-static void
-passwd_idle_timer (junk1, junk2)
- void *junk1;
- XtPointer junk2;
-{
- Display *dpy = XtDisplay (passwd_form);
- Window window = XtWindow (XtParent(passwd_done));
- static Dimension x, y, d, s, ss;
- static GC gc = 0;
- int max = passwd_timeout / 1000;
-
- idle_timer (junk1, junk2);
-
- if (passwd_idle_timer_tick == max) /* first time */
- {
- Arg av [10];
- int ac = 0;
- XGCValues gcv;
- unsigned long fg, bg, ts, bs;
- Dimension w = 0, h = 0;
- XtVaGetValues(XtParent(passwd_done),
- XmNwidth, &w,
- 0);
- XtVaGetValues(passwd_done,
- XmNheight, &h,
- XmNy, &y,
- XtNforeground, &fg,
- XtNbackground, &bg,
- XmNtopShadowColor, &ts,
- XmNbottomShadowColor, &bs,
- 0);
-
- if (ts != bg && ts != fg)
- fg = ts;
- if (bs != bg && bs != fg)
- fg = bs;
-
- d = h / 2;
- if (d & 1) d++;
-
- x = (w / 2);
-
- x -= d/2;
- y += d/2;
-
- gcv.foreground = fg;
- if (gc) XFreeGC (dpy, gc);
- gc = XCreateGC (dpy, window, GCForeground, &gcv);
- s = 360*64 / (passwd_idle_timer_tick - 1);
- ss = 90*64;
- XFillArc (dpy, window, gc, x, y, d, d, 0, 360*64);
- XSetForeground (dpy, gc, bg);
- x += 1;
- y += 1;
- d -= 2;
- }
-
- if (--passwd_idle_timer_tick)
- {
- id = XtAppAddTimeOut (app, 1000,
- (XtTimerCallbackProc) passwd_idle_timer, 0);
- XFillArc (dpy, window, gc, x, y, d, d, ss, s);
- ss += s;
- }
-}
-
-extern void pop_up_dialog_box ();
-extern int BadWindow_ehandler ();
-
-static Bool
-pop_passwd_dialog (parent)
- Widget parent;
-{
- Display *dpy = XtDisplay (passwd_dialog);
- Window focus;
- int revert_to;
- typed_passwd [0] = 0;
- passwd_state = pw_read;
- text_field_set_string (passwd_text, "", 0);
-
- XGetInputFocus (dpy, &focus, &revert_to);
-#ifndef DESTROY_WORKS
- /* This fucker blows up if we destroy the widget. I can't figure
- out why. The second destroy phase dereferences freed memory...
- So we just keep it around; but unrealizing or unmanaging it
- doesn't work right either, so we hack the window directly. FMH.
- */
- if (XtWindow (passwd_form))
- XMapRaised (dpy, XtWindow (passwd_dialog));
-#endif
-
- pop_up_dialog_box (passwd_dialog, passwd_form, 2);
- XtManageChild (passwd_form);
-
-#if !defined(NO_MOTIF) && (XmVersion < 1002)
- /* The focus stuff changed around; this causes problems in 1.2.1
- but is necessary in 1.1.5. */
- XmProcessTraversal (passwd_text, XmTRAVERSE_CURRENT);
-#endif
-
- passwd_idle_timer_tick = passwd_timeout / 1000;
- id = XtAppAddTimeOut (app, 1000, (XtTimerCallbackProc) passwd_idle_timer, 0);
-
-
- XGrabServer (dpy); /* ############ DANGER! */
-
- /* this call to ungrab used to be in main_loop() - see comment in
- xscreensaver.c around line 696. */
- ungrab_keyboard_and_mouse ();
-
- while (passwd_state == pw_read)
- {
- XEvent event;
- XtAppNextEvent (app, &event);
- /* wait for timer event */
- if (event.xany.type == 0 && passwd_idle_timer_tick == 0)
- passwd_state = pw_time;
- XtDispatchEvent (&event);
- }
- XUngrabServer (dpy);
- XSync (dpy, False); /* ###### (danger over) */
-
- if (passwd_state != pw_time)
- XtRemoveTimeOut (id);
-
- if (passwd_state != pw_ok)
- {
- char *lose;
- switch (passwd_state)
- {
- case pw_time: lose = "Timed out!"; break;
- case pw_fail: lose = "Sorry!"; break;
- case pw_cancel: lose = 0; break;
- default: abort ();
- }
-#ifndef NO_MOTIF
- XmProcessTraversal (passwd_cancel, 0); /* turn off I-beam */
-#endif
- if (lose)
- {
- text_field_set_string (passwd_text, lose, strlen (lose) + 1);
- passwd_idle_timer_tick = 1;
- id = XtAppAddTimeOut (app, 3000,
- (XtTimerCallbackProc) passwd_idle_timer, 0);
- while (1)
- {
- XEvent event;
- XtAppNextEvent (app, &event);
- if (event.xany.type == 0 && /* wait for timer event */
- passwd_idle_timer_tick == 0)
- break;
- XtDispatchEvent (&event);
- }
- }
- }
- memset (typed_passwd, 0, sizeof (typed_passwd));
- text_field_set_string (passwd_text, "", 0);
- XtSetKeyboardFocus (parent, None);
-
-#ifdef DESTROY_WORKS
- XtDestroyWidget (passwd_dialog);
- passwd_dialog = 0;
-#else
- XUnmapWindow (XtDisplay (passwd_dialog), XtWindow (passwd_dialog));
-#endif
- {
- int (*old_handler) ();
- old_handler = XSetErrorHandler (BadWindow_ehandler);
- /* I don't understand why this doesn't refocus on the old selected
- window when MWM is running in click-to-type mode. The value of
- `focus' seems to be correct. */
- XSetInputFocus (dpy, focus, revert_to, CurrentTime);
- XSync (dpy, False);
- XSetErrorHandler (old_handler);
- }
-
- return (passwd_state == pw_ok ? True : False);
-}
-
-Bool
-unlock_p (parent)
- Widget parent;
-{
- static Bool initted = False;
- if (! initted)
- {
-#ifndef VERIFY_CALLBACK_WORKS
- XtAppAddActions (app, actions, XtNumber (actions));
-#endif
- passwd_dialog = 0;
- initted = True;
- }
- if (! passwd_dialog)
- make_passwd_dialog (parent);
- return pop_passwd_dialog (parent);
-}
-
-#endif /* !NO_LOCKING */
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991-1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* stderr hackery - Why Unix Sucks, reason number 32767.
- */
-
-#if __STDC__
-#include <stdlib.h>
-#include <unistd.h>
-#endif
-
-#include <stdio.h>
-#include <fcntl.h>
-#include <time.h>
-
-#include <X11/Intrinsic.h>
-
-#include "xscreensaver.h"
-
-extern XtAppContext app;
-extern Colormap cmap;
-extern Window screensaver_window;
-
-extern char *get_string_resource P((char *, char *));
-extern Bool get_boolean_resource P((char *, char *));
-extern unsigned int get_pixel_resource P((char *, char *,
- Display *, Colormap));
-
-static char stderr_buffer [1024];
-static char *stderr_tail = 0;
-static time_t stderr_last_read = 0;
-static XtIntervalId stderr_popup_timer = 0;
-
-FILE *real_stderr = 0;
-FILE *real_stdout = 0;
-
-static int text_x = 0;
-static int text_y = 0;
-
-void
-reset_stderr ()
-{
- text_x = text_y = 0;
-}
-
-static void
-print_stderr (string)
- char *string;
-{
- int h_border = 20;
- int v_border = 20;
- static int line_height;
- static XFontStruct *font = 0;
- static GC gc = 0;
- char *head = string;
- char *tail;
-
- /* In verbose mode, copy it to stderr as well. */
- if (verbose_p)
- fprintf (real_stderr, "%s", string);
-
- if (! gc)
- {
- XGCValues gcv;
- Pixel fg, bg;
- char *font_name = get_string_resource ("font", "Font");
- if (!font_name) font_name = "fixed";
- font = XLoadQueryFont (dpy, font_name);
- if (! font) font = XLoadQueryFont (dpy, "fixed");
- line_height = font->ascent + font->descent;
- fg = get_pixel_resource ("textForeground", "Foreground", dpy, cmap);
- bg = get_pixel_resource ("textBackground", "Background", dpy, cmap);
- gcv.font = font->fid;
- gcv.foreground = fg;
- gcv.background = bg;
- gc = XCreateGC (dpy, screensaver_window,
- (GCFont | GCForeground | GCBackground), &gcv);
- }
-
- for (tail = string; *tail; tail++)
- {
- if (*tail == '\n' || *tail == '\r')
- {
- int maxy = HeightOfScreen (screen) - v_border - v_border;
- if (tail != head)
- XDrawImageString (dpy, screensaver_window, gc,
- text_x + h_border,
- text_y + v_border + font->ascent,
- head, tail - head);
- text_x = 0;
- text_y += line_height;
- head = tail + 1;
- if (*tail == '\r' && *head == '\n')
- head++, tail++;
-
- if (text_y > maxy - line_height)
- {
-#if 0
- text_y = 0;
-#else
- int offset = line_height * 5;
- XCopyArea (dpy, screensaver_window, screensaver_window, gc,
- 0, v_border + offset,
- WidthOfScreen (screen),
- (HeightOfScreen (screen) - v_border - v_border
- - offset),
- 0, v_border);
- XClearArea (dpy, screensaver_window,
- 0, HeightOfScreen (screen) - v_border - offset,
- WidthOfScreen (screen), offset, False);
- text_y -= offset;
-#endif
- }
- }
- }
- if (tail != head)
- {
- int direction, ascent, descent;
- XCharStruct overall;
- XDrawImageString (dpy, screensaver_window, gc,
- text_x + h_border, text_y + v_border + font->ascent,
- head, tail - head);
- XTextExtents (font, tail, tail - head,
- &direction, &ascent, &descent, &overall);
- text_x += overall.width;
- }
-}
-
-
-static void
-stderr_popup_timer_fn (closure, id)
- XtPointer closure;
- XtIntervalId *id;
-{
- char *s = stderr_buffer;
- if (*s)
- {
- /* If too much data was printed, then something has gone haywire,
- so truncate it. */
- char *trailer = "\n\n<< stderr diagnostics have been truncated >>\n\n";
- int max = sizeof (stderr_buffer) - strlen (trailer) - 5;
- if (strlen (s) > max)
- strcpy (s + max, trailer);
- /* Now show the user. */
- print_stderr (s);
- }
-
- stderr_tail = stderr_buffer;
- stderr_popup_timer = 0;
-}
-
-
-static void
-stderr_callback (closure, fd, id)
- XtPointer closure;
- int *fd;
- XtIntervalId *id;
-{
- char *s;
- int left;
- int size;
- int read_this_time = 0;
-
- if (stderr_tail == 0)
- stderr_tail = stderr_buffer;
-
- left = ((sizeof (stderr_buffer) - 2) - (stderr_tail - stderr_buffer));
-
- s = stderr_tail;
- *s = 0;
-
- /* Read as much data from the fd as we can, up to our buffer size. */
- if (left > 0)
- {
- while ((size = read (*fd, (void *) s, left)) > 0)
- {
- left -= size;
- s += size;
- read_this_time += size;
- }
- *s = 0;
- }
- else
- {
- char buf2 [1024];
- /* The buffer is full; flush the rest of it. */
- while (read (*fd, (void *) buf2, sizeof (buf2)) > 0)
- ;
- }
-
- stderr_tail = s;
- stderr_last_read = time ((time_t *) 0);
-
- /* Now we have read some data that we would like to put up in a dialog
- box. But more data may still be coming in - so don't pop up the
- dialog right now, but instead, start a timer that will pop it up
- a second from now. Should more data come in in the meantime, we
- will be called again, and will reset that timer again. So the
- dialog will only pop up when a second has elapsed with no new data
- being written to stderr.
-
- However, if the buffer is full (meaning lots of data has been written)
- then we don't reset the timer.
- */
- if (read_this_time > 0)
- {
- if (stderr_popup_timer)
- XtRemoveTimeOut (stderr_popup_timer);
-
- stderr_popup_timer =
- XtAppAddTimeOut (app, 1 * 1000, stderr_popup_timer_fn, 0);
- }
-}
-
-void
-initialize_stderr ()
-{
- static Boolean done = False;
- int fds [2];
- int in, out;
- int new_stdout, new_stderr;
- int stdout_fd = 1;
- int stderr_fd = 2;
- int flags;
- Boolean stderr_dialog_p = get_boolean_resource ("captureStderr", "Boolean");
- Boolean stdout_dialog_p = get_boolean_resource ("captureStdout", "Boolean");
-
- real_stderr = stderr;
- real_stdout = stdout;
-
- if (!stderr_dialog_p && !stdout_dialog_p)
- return;
-
- if (done) return;
- done = True;
-
- if (pipe (fds))
- {
- perror ("error creating pipe:");
- return;
- }
-
- in = fds [0];
- out = fds [1];
-
-# ifdef O_NONBLOCK
- flags = O_NONBLOCK;
-# else
-# ifdef O_NDELAY
- flags = O_NDELAY;
-# else
- ERROR!! neither O_NONBLOCK nor O_NDELAY are defined.
-# endif
-# endif
-
- /* Set both sides of the pipe to nonblocking - this is so that
- our reads (in stderr_callback) will terminate, and so that
- out writes (in the client programs) will silently fail when
- the pipe is full, instead of hosing the program. */
- if (fcntl (in, F_SETFL, flags) != 0)
- {
- perror ("fcntl:");
- return;
- }
- if (fcntl (out, F_SETFL, flags) != 0)
- {
- perror ("fcntl:");
- return;
- }
-
- if (stderr_dialog_p)
- {
- FILE *new_stderr_file;
- new_stderr = dup (stderr_fd);
- if (new_stderr < 0)
- {
- perror ("could not dup() a stderr:");
- return;
- }
- if (! (new_stderr_file = fdopen (new_stderr, "w")))
- {
- perror ("could not fdopen() the new stderr:");
- return;
- }
- real_stderr = new_stderr_file;
-
- close (stderr_fd);
- if (dup2 (out, stderr_fd) < 0)
- {
- perror ("could not dup() a new stderr:");
- return;
- }
- }
-
- if (stdout_dialog_p)
- {
- FILE *new_stdout_file;
- new_stdout = dup (stdout_fd);
- if (new_stdout < 0)
- {
- perror ("could not dup() a stdout:");
- return;
- }
- if (! (new_stdout_file = fdopen (new_stdout, "w")))
- {
- perror ("could not fdopen() the new stdout:");
- return;
- }
- real_stdout = new_stdout_file;
-
- close (stdout_fd);
- if (dup2 (out, stdout_fd) < 0)
- {
- perror ("could not dup() a new stdout:");
- return;
- }
- }
-
- XtAppAddInput (app, in, (XtPointer) XtInputReadMask, stderr_callback, 0);
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991, 1992, 1993, 1995
- * Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* I would really like some error messages to show up on the screensaver window
- itself when subprocs die, or when we can't launch them. If the process
- produces output, but does not actually die, I would like that output to go
- to the appropriate stdout/stderr as they do now. X and Unix conspire to
- make this incredibly difficult.
-
- - Not all systems have SIGIO, so we can't necessarily be signalled when a
- process dies, so we'd have to poll it with wait() or something awful like
- that, which would mean the main thread waking up more often than it does
- now.
-
- - We can't tell the difference between a process dying, and a process not
- being launched correctly (for example, not being on $PATH) partly because
- of the contortions we need to go through with /bin/sh in order to launch
- it.
-
- - We can't do X stuff from signal handlers, so we'd need to set a flag,
- save the error message, and notice that flag in the main thread. The
- problem is that the main thread is probably sleeping, waiting for the
- next X event, so to do this we'd have to register a pipe FD or something,
- and write to it when something loses.
-
- - We could assume that any output produced by a subproc indicates an error,
- and blast that across the screen. This means we'd need to use popen()
- instead of forking and execing /bin/sh to run it for us. Possibly this
- would work, but see comment in exec_screenhack() about getting pids.
- I think we could do the "exec " trick with popen() but would SIGIO get
- delivered correctly? Who knows. (We could register the pipe-FD with
- Xt, and handle output on it with a callback.)
-
- - For the simple case of the programs not being on $PATH, we could just
- search $PATH before launching the shell, but that seems hardly worth the
- effort... And it's broken!! Why should we have to duplicate half the
- work of the shell? (Because it's Unix, that's why! Bend over.)
- */
-
-#if __STDC__
-#include <stdlib.h>
-#include <unistd.h>
-#include <string.h>
-#endif
-
-#include <stdio.h>
-
-#include <X11/Xlib.h> /* not used for much... */
-
-#ifndef ESRCH
-#include <errno.h>
-#endif
-
-#include <sys/time.h> /* sys/resource.h needs this for timeval */
-#include <sys/resource.h> /* for setpriority() and PRIO_PROCESS */
-#include <sys/wait.h> /* for waitpid() and associated macros */
-#include <signal.h> /* for the signal names */
-
-extern char **environ; /* why isn't this in some header file? */
-
-#ifndef NO_SETUID
-#include <pwd.h> /* for getpwnam() and struct passwd */
-#include <grp.h> /* for getgrgid() and struct group */
-#endif /* NO_SETUID */
-
-#if !defined(SIGCHLD) && defined(SIGCLD)
-#define SIGCHLD SIGCLD
-#endif
-
-#if __STDC__
-extern int putenv (/* const char * */); /* getenv() is in stdlib.h... */
-extern int kill (pid_t, int); /* signal() is in sys/signal.h... */
-#endif
-
-#include "yarandom.h"
-#include "xscreensaver.h"
-
-/* this must be `sh', not whatever $SHELL happens to be. */
-char *shell;
-static pid_t pid = 0;
-char **screenhacks;
-int screenhacks_count;
-int current_hack = -1;
-char *demo_hack;
-int next_mode_p = 0;
-Bool locking_disabled_p = False;
-char *nolock_reason = 0;
-int nice_inferior = 0;
-
-extern Bool demo_mode_p;
-
-static void
-#if __STDC__
-exec_screenhack (char *command)
-#else
-exec_screenhack (command)
- char *command;
-#endif
-{
- char *tmp;
- char buf [512];
- char *av [5];
- int ac = 0;
-
- /* Close this fork's version of the display's fd. It will open its own. */
- close (ConnectionNumber (dpy));
-
- /* I don't believe what a sorry excuse for an operating system UNIX is!
-
- - I want to spawn a process.
- - I want to know it's pid so that I can kill it.
- - I would like to receive a message when it dies of natural causes.
- - I want the spawned process to have user-specified arguments.
-
- The *only way* to parse arguments the way the shells do is to run a
- shell (or duplicate what they do, which would be a *lot* of code.)
-
- The *only way* to know the pid of the process is to fork() and exec()
- it in the spawned side of the fork.
-
- But if you're running a shell to parse your arguments, this gives you
- the pid of the SHELL, not the pid of the PROCESS that you're actually
- interested in, which is an *inferior* of the shell. This also means
- that the SIGCHLD you get applies to the shell, not its inferior.
-
- So, the only solution other than implementing an argument parser here
- is to force the shell to exec() its inferior. What a fucking hack!
- We prepend "exec " to the command string.
-
- (Actually, Clint Wong <clint@jts.com> points out that process groups
- might be used to take care of this problem; this may be worth considering
- some day, except that, 1: this code works now, so why fix it, and 2: from
- what I've seen in Emacs, dealing with process groups isn't especially
- portable.)
- */
- tmp = command;
- command = (char *) malloc (strlen (tmp) + 6);
- memcpy (command, "exec ", 5);
- memcpy (command + 5, tmp, strlen (tmp) + 1);
-
- /* Invoke the shell as "/bin/sh -c 'exec prog -arg -arg ...'" */
- av [ac++] = shell;
- av [ac++] = "-c";
- av [ac++] = command;
- av [ac++] = 0;
-
- if (verbose_p)
- printf ("%s: spawning \"%s\" in pid %d.\n", progname, command, getpid ());
-
-#if defined(SYSV) || defined(SVR4) || defined(__hpux)
- {
- int old_nice = nice (0);
- int n = nice_inferior - old_nice;
- errno = 0;
- if (nice (n) == -1 && errno != 0)
- {
- sprintf (buf, "%s: %snice(%d) failed", progname,
- (verbose_p ? "## " : ""), n);
- perror (buf);
- }
- }
-#else /* !SYSV */
-#ifdef PRIO_PROCESS
- if (setpriority (PRIO_PROCESS, getpid(), nice_inferior) != 0)
- {
- sprintf (buf, "%s: %ssetpriority(PRIO_PROCESS, %d, %d) failed",
- progname, (verbose_p ? "## " : ""), getpid(), nice_inferior);
- perror (buf);
- }
-#else /* !PRIO_PROCESS */
- if (nice_inferior != 0)
- fprintf (stderr,
- "%s: %sdon't know how to change process priority on this system.\n",
- progname, (verbose_p ? "## " : ""));
-#endif /* !PRIO_PROCESS */
-#endif /* !SYSV */
-
- /* Now overlay the current process with /bin/sh running the command.
- If this returns, it's an error.
- */
- execve (av [0], av, environ);
-
- sprintf (buf, "%s: %sexecve() failed", progname, (verbose_p ? "## " : ""));
- perror (buf);
- exit (1); /* Note that this only exits a child fork. */
-}
-
-/* to avoid a race between the main thread and the SIGCHLD handler */
-static int killing = 0;
-static Bool suspending = False;
-
-static char *current_hack_name P((void));
-
-static void
-#if __STDC__
-await_child_death (Bool killed)
-#else
-await_child_death (killed)
- Bool killed;
-#endif
-{
- Bool suspended_p = False;
- int status;
- pid_t kid;
- killing = 1;
- if (! pid)
- return;
-
- do
- {
- kid = waitpid (pid, &status, WUNTRACED);
- }
- while (kid == -1 && errno == EINTR);
-
- if (kid == pid)
- {
- if (WIFEXITED (status))
- {
- int exit_status = WEXITSTATUS (status);
- if (exit_status & 0x80)
- exit_status |= ~0xFF;
- /* One might assume that exiting with non-0 means something went
- wrong. But that loser xswarm exits with the code that it was
- killed with, so it *always* exits abnormally. Treat abnormal
- exits as "normal" (don't mention them) if we've just killed
- the subprocess. But mention them if they happen on their own.
- */
- if (exit_status != 0 && (verbose_p || (! killed)))
- fprintf (stderr,
- "%s: %schild pid %d (%s) exited abnormally (code %d).\n",
- progname, (verbose_p ? "## " : ""),
- pid, current_hack_name (), exit_status);
- else if (verbose_p)
- printf ("%s: child pid %d (%s) exited normally.\n",
- progname, pid, current_hack_name ());
- }
- else if (WIFSIGNALED (status))
- {
- if (!killed || WTERMSIG (status) != SIGTERM)
- fprintf (stderr,
- "%s: %schild pid %d (%s) terminated with signal %d!\n",
- progname, (verbose_p ? "## " : ""),
- pid, current_hack_name (), WTERMSIG (status));
- else if (verbose_p)
- printf ("%s: child pid %d (%s) terminated with SIGTERM.\n",
- progname, pid, current_hack_name ());
- }
- else if (suspending)
- {
- suspended_p = True;
- suspending = False; /* complain if it happens twice */
- }
- else if (WIFSTOPPED (status))
- {
- suspended_p = True;
- fprintf (stderr, "%s: %schild pid %d (%s) stopped with signal %d!\n",
- progname, (verbose_p ? "## " : ""), pid,
- current_hack_name (), WSTOPSIG (status));
- }
- else
- fprintf (stderr, "%s: %schild pid %d (%s) died in a mysterious way!",
- progname, (verbose_p ? "## " : ""), pid, current_hack_name());
- }
- else if (kid <= 0)
- fprintf (stderr, "%s: %swaitpid(%d, ...) says there are no kids? (%d)\n",
- progname, (verbose_p ? "## " : ""), pid, kid);
- else
- fprintf (stderr, "%s: %swaitpid(%d, ...) says proc %d died, not %d?\n",
- progname, (verbose_p ? "## " : ""), pid, kid, pid);
- killing = 0;
- if (suspended_p != True)
- pid = 0;
-}
-
-static char *
-current_hack_name ()
-{
- static char chn [1024];
- char *hack = (demo_mode_p ? demo_hack : screenhacks [current_hack]);
- int i;
- for (i = 0; hack [i] != 0 && hack [i] != ' ' && hack [i] != '\t'; i++)
- chn [i] = hack [i];
- chn [i] = 0;
- return chn;
-}
-
-#ifdef SIGCHLD
-static void
-sigchld_handler (sig)
- int sig;
-{
- if (killing)
- return;
- if (! pid)
- abort ();
- await_child_death (False);
-}
-#endif
-
-
-void
-init_sigchld ()
-{
-#ifdef SIGCHLD
- if (((int) signal (SIGCHLD, sigchld_handler)) == -1)
- {
- char buf [255];
- sprintf (buf, "%s: %scouldn't catch SIGCHLD", progname,
- (verbose_p ? "## " : ""));
- perror (buf);
- }
-#endif
-}
-
-
-extern void raise_window P((Bool inhibit_fade, Bool between_hacks_p));
-
-void
-spawn_screenhack (first_time_p)
- Bool first_time_p;
-{
- raise_window (first_time_p, True);
- XFlush (dpy);
-
- if (screenhacks_count || demo_mode_p)
- {
- char *hack;
- pid_t forked;
- char buf [255];
- int new_hack;
- if (demo_mode_p)
- {
- hack = demo_hack;
- }
- else
- {
- if (screenhacks_count == 1)
- new_hack = 0;
- else if (next_mode_p == 1)
- new_hack = (current_hack + 1) % screenhacks_count,
- next_mode_p = 0;
- else if (next_mode_p == 2)
- {
- new_hack = ((current_hack + screenhacks_count - 1)
- % screenhacks_count);
- next_mode_p = 0;
- }
- else
- while ((new_hack = random () % screenhacks_count) == current_hack)
- ;
- current_hack = new_hack;
- hack = screenhacks[current_hack];
- }
-
- switch (forked = fork ())
- {
- case -1:
- sprintf (buf, "%s: %scouldn't fork",
- progname, (verbose_p ? "## " : ""));
- perror (buf);
- restore_real_vroot ();
- exit (1);
- case 0:
- exec_screenhack (hack); /* this does not return */
- break;
- default:
- pid = forked;
- break;
- }
- }
-}
-
-void
-kill_screenhack ()
-{
- killing = 1;
- if (! pid)
- return;
- if (kill (pid, SIGTERM) < 0)
- {
- if (errno == ESRCH)
- {
- /* Sometimes we don't get a SIGCHLD at all! WTF?
- It's a race condition. It looks to me like what's happening is
- something like: a subprocess dies of natural causes. There is a
- small window between when the process dies and when the SIGCHLD
- is (would have been) delivered. If we happen to try to kill()
- the process during that time, the kill() fails, because the
- process is already dead. But! no SIGCHLD is delivered (perhaps
- because the failed kill() has reset some state in the kernel?)
- Anyway, if kill() says "No such process", then we have to wait()
- for it anyway, because the process has already become a zombie.
- I love Unix.
- */
- await_child_death (False);
- }
- else
- {
- char buf [255];
- sprintf (buf, "%s: %scouldn't kill child process %d", progname,
- (verbose_p ? "## " : ""), pid);
- perror (buf);
- }
- }
- else
- {
- if (verbose_p)
- printf ("%s: killing pid %d.\n", progname, pid);
- await_child_death (True);
- }
-}
-
-
-void
-suspend_screenhack (suspend_p)
- Bool suspend_p;
-{
-
- suspending = suspend_p;
- if (! pid)
- ;
- else if (kill (pid, (suspend_p ? SIGSTOP : SIGCONT)) < 0)
- {
- char buf [255];
- sprintf (buf, "%s: %scouldn't %s child process %d", progname,
- (verbose_p ? "## " : ""),
- (suspend_p ? "suspend" : "resume"),
- pid);
- perror (buf);
- }
- else if (verbose_p)
- printf ("%s: %s pid %d.\n", progname,
- (suspend_p ? "suspending" : "resuming"), pid);
-}
-
-\f
-/* Restarting the xscreensaver process from scratch. */
-
-static char **saved_argv;
-
-void
-save_argv (argc, argv)
- int argc;
- char **argv;
-{
- saved_argv = (char **) malloc ((argc + 2) * sizeof (char *));
- saved_argv [argc] = 0;
- while (argc--)
- {
- int i = strlen (argv [argc]) + 1;
- saved_argv [argc] = (char *) malloc (i);
- memcpy (saved_argv [argc], argv [argc], i);
- }
-}
-
-void
-restart_process ()
-{
- XCloseDisplay (dpy);
- fflush (stdout);
- fflush (stderr);
- execvp (saved_argv [0], saved_argv);
- fprintf (stderr, "%s: %scould not restart process: %s (%d)\n",
- progname, (verbose_p ? "## " : ""),
- (errno == E2BIG ? "arglist too big" :
- errno == EACCES ? "could not execute" :
- errno == EFAULT ? "memory fault" :
- errno == EIO ? "I/O error" :
- errno == ENAMETOOLONG ? "name too long" :
- errno == ELOOP ? "too many symbolic links" :
- errno == ENOENT ? "file no longer exists" :
- errno == ENOTDIR ? "directory no longer exists" :
- errno == ENOEXEC ? "bad executable file" :
- errno == ENOMEM ? "out of memory" :
- "execvp() returned unknown error code"),
- errno);
- exit (1);
-}
-
-void
-demo_mode_restart_process ()
-{
- int i;
- for (i = 0; saved_argv [i]; i++);
- /* add the -demo switch; save_argv() left room for this. */
- saved_argv [i] = "-demo";
- saved_argv [i+1] = 0;
- restart_process ();
-}
-
-void
-hack_environment ()
-{
- /* Store $DISPLAY into the environment, so that the $DISPLAY variable that
- the spawned processes inherit is the same as the value of -display passed
- in on our command line (which is not necessarily the same as what our
- $DISPLAY variable is.)
- */
- char *s, buf [2048];
- int i;
- sprintf (buf, "DISPLAY=%s", DisplayString (dpy));
- i = strlen (buf);
- s = (char *) malloc (i+1);
- strncpy (s, buf, i+1);
- if (putenv (s))
- abort ();
-}
-
-\f
-/* Change the uid/gid of the screensaver process, so that it is safe for it
- to run setuid root (which it needs to do on some systems to read the
- encrypted passwords from the passwd file.)
-
- hack_uid() is run before opening the X connection, so that XAuth works.
- hack_uid_warn() is called after the connection is opened and the command
- line arguments are parsed, so that the messages from hack_uid() get
- printed after we know whether we're in `verbose' mode.
- */
-
-#ifndef NO_SETUID
-
-static int hack_uid_errno;
-static char hack_uid_buf [255], *hack_uid_error;
-
-void
-hack_uid ()
-{
- /* If we've been run as setuid or setgid to someone else (most likely root)
- turn off the extra permissions so that random user-specified programs
- don't get special privileges. (On some systems it might be necessary
- to install this as setuid root in order to read the passwd file to
- implement lock-mode...)
- */
- setgid (getgid ());
- setuid (getuid ());
-
- hack_uid_errno = 0;
- hack_uid_error = 0;
-
- /* If we're being run as root (as from xdm) then switch the user id
- to something safe. */
- if (getuid () == 0)
- {
- struct passwd *p;
- /* Locking can't work when running as root, because we have no way of
- knowing what the user id of the logged in user is (so we don't know
- whose password to prompt for.)
- */
- locking_disabled_p = True;
- nolock_reason = "running as root";
- p = getpwnam ("nobody");
- if (! p) p = getpwnam ("daemon");
- if (! p) p = getpwnam ("bin");
- if (! p) p = getpwnam ("sys");
- if (! p)
- {
- hack_uid_error = "couldn't find safe uid; running as root.";
- hack_uid_errno = -1;
- }
- else
- {
- struct group *g = getgrgid (p->pw_gid);
- hack_uid_error = hack_uid_buf;
- sprintf (hack_uid_error, "changing uid/gid to %s/%s (%d/%d).",
- p->pw_name, (g ? g->gr_name : "???"), p->pw_uid, p->pw_gid);
-
- /* Change the gid to be a safe one. If we can't do that, then
- print a warning. We change the gid before the uid so that we
- change the gid while still root. */
- if (setgid (p->pw_gid) != 0)
- {
- hack_uid_errno = errno;
- sprintf (hack_uid_error, "couldn't set gid to %s (%d)",
- (g ? g->gr_name : "???"), p->pw_gid);
- }
-
- /* Now change the uid to be a safe one. */
- if (setuid (p->pw_uid) != 0)
- {
- hack_uid_errno = errno;
- sprintf (hack_uid_error, "couldn't set uid to %s (%d)",
- p->pw_name, p->pw_uid);
- }
- }
- }
-#ifndef NO_LOCKING
- else /* disable locking if already being run as "someone else" */
- {
- struct passwd *p = getpwuid (getuid ());
- if (!p ||
- !strcmp (p->pw_name, "root") ||
- !strcmp (p->pw_name, "nobody") ||
- !strcmp (p->pw_name, "daemon") ||
- !strcmp (p->pw_name, "bin") ||
- !strcmp (p->pw_name, "sys"))
- {
- locking_disabled_p = True;
- nolock_reason = hack_uid_buf;
- sprintf (nolock_reason, "running as %s", p->pw_name);
- }
- }
-#endif /* NO_LOCKING */
-}
-
-void
-hack_uid_warn ()
-{
- if (! hack_uid_error)
- ;
- else if (hack_uid_errno == 0)
- {
- if (verbose_p)
- printf ("%s: %s\n", progname, hack_uid_error);
- }
- else
- {
- char buf [255];
- sprintf (buf, "%s: %s%s", progname, (verbose_p ? "## " : ""),
- hack_uid_error);
- if (hack_uid_errno == -1)
- fprintf (stderr, "%s\n", buf);
- else
- {
- errno = hack_uid_errno;
- perror (buf);
- }
- }
-}
-
-#endif /* !NO_SETUID */
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* #define DEBUG_TIMERS */
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Intrinsic.h>
-#include <X11/Xos.h>
-#include <X11/Xmu/Error.h>
-
-#ifdef HAVE_XIDLE_EXTENSION
-#include <X11/extensions/xidle.h>
-#endif /* HAVE_XIDLE_EXTENSION */
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-#include <X11/extensions/scrnsaver.h>
-extern int mit_saver_ext_event_number;
-extern Window server_mit_saver_window;
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-#include <X11/extensions/XScreenSaver.h>
-extern int sgi_saver_ext_event_number;
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
-#include "xscreensaver.h"
-
-#if __STDC__
-# define P(x)x
-#else
-#define P(x)()
-#endif
-
-extern XtAppContext app;
-
-Time cycle;
-Time timeout;
-Time pointer_timeout;
-Time notice_events_timeout;
-
-extern Bool use_xidle_extension;
-extern Bool use_mit_saver_extension;
-extern Bool use_sgi_saver_extension;
-extern Bool dbox_up_p;
-extern Bool locked_p;
-extern Window screensaver_window;
-
-extern Bool handle_clientmessage P((XEvent *, Bool));
-
-static time_t last_activity_time; /* for when we have no server extensions */
-static XtIntervalId timer_id = 0;
-static XtIntervalId check_pointer_timer_id = 0;
-XtIntervalId cycle_id = 0;
-XtIntervalId lock_id = 0;
-
-void
-idle_timer (junk1, junk2)
- void *junk1;
- XtPointer junk2;
-{
- /* What an amazingly shitty design. Not only does Xt execute timeout
- events from XtAppNextEvent() instead of from XtDispatchEvent(), but
- there is no way to tell Xt to block until there is an X event OR a
- timeout happens. Once your timeout proc is called, XtAppNextEvent()
- still won't return until a "real" X event comes in.
-
- So this function pushes a stupid, gratuitous, unnecessary event back
- on the event queue to force XtAppNextEvent to return Right Fucking Now.
- When the code in sleep_until_idle() sees an event of type XAnyEvent,
- which the server never generates, it knows that a timeout has occurred.
- */
- XEvent fake_event;
- fake_event.type = 0; /* XAnyEvent type, ignored. */
- fake_event.xany.display = dpy;
- fake_event.xany.window = 0;
- XPutBackEvent (dpy, &fake_event);
-}
-
-
-static void
-#if __STDC__
-notice_events (Window window, Bool top_p)
-#else
-notice_events (window, top_p)
- Window window;
- Bool top_p;
-#endif
-{
- XWindowAttributes attrs;
- unsigned long events;
- Window root, parent, *kids;
- unsigned int nkids;
-
- if (XtWindowToWidget (dpy, window))
- /* If it's one of ours, don't mess up its event mask. */
- return;
-
- if (!XQueryTree (dpy, window, &root, &parent, &kids, &nkids))
- return;
- if (window == root)
- top_p = False;
-
- XGetWindowAttributes (dpy, window, &attrs);
- events = ((attrs.all_event_masks | attrs.do_not_propagate_mask)
- & KeyPressMask);
-
- /* Select for SubstructureNotify on all windows.
- Select for KeyPress on all windows that already have it selected.
- Do we need to select for ButtonRelease? I don't think so.
- */
- XSelectInput (dpy, window, SubstructureNotifyMask | events);
-
- if (top_p && verbose_p && (events & KeyPressMask))
- {
- /* Only mention one window per tree (hack hack). */
- printf ("%s: selected KeyPress on 0x%lX\n", progname,
- (unsigned long) window);
- top_p = False;
- }
-
- if (kids)
- {
- while (nkids)
- notice_events (kids [--nkids], top_p);
- XFree ((char *) kids);
- }
-}
-
-
-int
-BadWindow_ehandler (dpy, error)
- Display *dpy;
- XErrorEvent *error;
-{
- /* When we notice a window being created, we spawn a timer that waits
- 30 seconds or so, and then selects events on that window. This error
- handler is used so that we can cope with the fact that the window
- may have been destroyed <30 seconds after it was created.
- */
- if (error->error_code == BadWindow ||
- error->error_code == BadMatch ||
- error->error_code == BadDrawable)
- return 0;
- XmuPrintDefaultErrorMessage (dpy, error, stderr);
- exit (1);
-}
-
-void
-notice_events_timer (closure, timer)
- XtPointer closure;
- XtIntervalId *timer;
-{
- Window window = (Window) closure;
- int (*old_handler) ();
- old_handler = XSetErrorHandler (BadWindow_ehandler);
- notice_events (window, True);
- XSync (dpy, False);
- XSetErrorHandler (old_handler);
-}
-
-
-/* When the screensaver is active, this timer will periodically change
- the running program.
- */
-void
-cycle_timer (junk1, junk2)
- void *junk1;
- XtPointer junk2;
-{
- Time how_long = cycle;
- if (dbox_up_p)
- {
- if (verbose_p)
- printf ("%s: dbox up; delaying hack change.\n", progname);
- how_long = 30000; /* 30 secs */
- }
- else
- {
- if (verbose_p)
- printf ("%s: changing graphics hacks.\n", progname);
- kill_screenhack ();
- spawn_screenhack (False);
- }
- cycle_id = XtAppAddTimeOut (app, how_long,
- (XtTimerCallbackProc) cycle_timer, 0);
-
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: starting cycle_timer (%ld, %ld)\n",
- progname, how_long, cycle_id);
-#endif
-}
-
-
-void
-activate_lock_timer (junk1, junk2)
- void *junk1;
- XtPointer junk2;
-{
- if (verbose_p)
- printf ("%s: timed out; activating lock\n", progname);
- locked_p = True;
-}
-
-
-/* Call this when user activity (or "simulated" activity) has been noticed.
- */
-static void
-reset_timers P((void))
-{
- if (use_mit_saver_extension || use_sgi_saver_extension)
- return;
-
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: restarting idle_timer (%ld, %ld)\n",
- progname, timeout, timer_id);
-#endif
- XtRemoveTimeOut (timer_id);
- timer_id = XtAppAddTimeOut (app, timeout,
- (XtTimerCallbackProc) idle_timer, 0);
- if (cycle_id) abort ();
-
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: starting idle_timer (%ld, %ld)\n",
- progname, timeout, timer_id);
-#endif
-
- last_activity_time = time ((time_t *) 0);
-}
-
-/* When we aren't using a server extension, this timer is used to periodically
- wake up and poll the mouse position, which is possibly more reliable than
- selecting motion events on every window.
- */
-static void
-check_pointer_timer (closure, this_timer)
- void *closure;
- XtPointer this_timer;
-{
- static int last_root_x = -1;
- static int last_root_y = -1;
- static Window last_child = (Window) -1;
- static unsigned int last_mask = 0;
- Window root, child;
- int root_x, root_y, x, y;
- unsigned int mask;
- XtIntervalId *timerP = (XtIntervalId *) closure;
-
- if (use_xidle_extension ||
- use_mit_saver_extension ||
- use_sgi_saver_extension)
- abort ();
-
- *timerP = XtAppAddTimeOut (app, pointer_timeout,
- (XtTimerCallbackProc) check_pointer_timer,
- closure);
-
- XQueryPointer (dpy, screensaver_window, &root, &child,
- &root_x, &root_y, &x, &y, &mask);
- if (root_x == last_root_x && root_y == last_root_y &&
- child == last_child && mask == last_mask)
- return;
-
-#ifdef DEBUG_TIMERS
- if (verbose_p && this_timer)
- if (root_x == last_root_x && root_y == last_root_y && child == last_child)
- printf ("%s: modifiers changed at %s.\n", progname, timestring ());
- else
- printf ("%s: pointer moved at %s.\n", progname, timestring ());
-#endif
-
- last_root_x = root_x;
- last_root_y = root_y;
- last_child = child;
- last_mask = mask;
-
- reset_timers ();
-}
-
-
-void
-sleep_until_idle (until_idle_p)
- Bool until_idle_p;
-{
- XEvent event;
-
- if (until_idle_p)
- {
- if (!use_mit_saver_extension && !use_sgi_saver_extension)
- {
- /* Wake up periodically to ask the server if we are idle. */
- timer_id = XtAppAddTimeOut (app, timeout,
- (XtTimerCallbackProc) idle_timer, 0);
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: starting idle_timer (%ld, %ld)\n",
- progname, timeout, timer_id);
-#endif
- }
-
- if (!use_xidle_extension &&
- !use_mit_saver_extension &&
- !use_sgi_saver_extension)
- /* start polling the mouse position */
- check_pointer_timer (&check_pointer_timer_id, 0);
- }
-
- while (1)
- {
- XtAppNextEvent (app, &event);
-
- switch (event.xany.type) {
- case 0: /* our synthetic "timeout" event has been signalled */
- if (until_idle_p)
- {
- Time idle;
-#ifdef HAVE_XIDLE_EXTENSION
- if (use_xidle_extension)
- {
- if (! XGetIdleTime (dpy, &idle))
- {
- fprintf (stderr, "%s: %sXGetIdleTime() failed.\n",
- progname, (verbose_p ? "## " : ""));
- exit (1);
- }
- }
- else
-#endif /* HAVE_XIDLE_EXTENSION */
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (use_mit_saver_extension)
- {
- /* We don't need to do anything in this case - the synthetic
- event isn't necessary, as we get sent specific events
- to wake us up. */
- idle = 0;
- }
- else
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-#ifdef HAVE_SGI_SAVER_EXTENSION
- if (use_sgi_saver_extension)
- {
- /* We don't need to do anything in this case - the synthetic
- event isn't necessary, as we get sent specific events
- to wake us up. */
- idle = 0;
- }
- else
-#endif /* HAVE_SGI_SAVER_EXTENSION */
- {
- idle = 1000 * (last_activity_time - time ((time_t *) 0));
- }
-
- if (idle >= timeout)
- goto DONE;
- else if (!use_mit_saver_extension && !use_sgi_saver_extension)
- {
- timer_id = XtAppAddTimeOut (app, timeout - idle,
- (XtTimerCallbackProc) idle_timer,
- 0);
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: starting idle_timer (%ld, %ld)\n",
- progname, timeout - idle, timer_id);
-#endif /* DEBUG_TIMERS */
- }
- }
- break;
-
- case ClientMessage:
- if (handle_clientmessage (&event, until_idle_p))
- goto DONE;
- break;
-
- case CreateNotify:
- if (!use_xidle_extension &&
- !use_mit_saver_extension &&
- !use_sgi_saver_extension)
- {
- XtAppAddTimeOut (app, notice_events_timeout,
- (XtTimerCallbackProc) notice_events_timer,
- (XtPointer) event.xcreatewindow.window);
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: starting notice_events_timer for 0x%X (%lu)\n",
- progname,
- (unsigned int) event.xcreatewindow.window,
- notice_events_timeout);
-#endif /* DEBUG_TIMERS */
- }
- break;
-
- case KeyPress:
- case KeyRelease:
- case ButtonPress:
- case ButtonRelease:
- case MotionNotify:
-
-#ifdef DEBUG_TIMERS
- if (verbose_p)
- {
- if (event.xany.type == MotionNotify)
- printf ("%s: MotionNotify at %s\n", progname, timestring ());
- else if (event.xany.type == KeyPress)
- printf ("%s: KeyPress seen on 0x%X at %s\n", progname,
- (unsigned int) event.xkey.window, timestring ());
- }
-#endif
-
- /* We got a user event */
- if (!until_idle_p)
- goto DONE;
- else
- reset_timers ();
- break;
-
- default:
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (event.type == mit_saver_ext_event_number)
- {
- XScreenSaverNotifyEvent *sevent =
- (XScreenSaverNotifyEvent *) &event;
- if (sevent->state == ScreenSaverOn)
- {
-# ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: ScreenSaverOn event received at %s\n",
- progname, timestring ());
-# endif /* DEBUG_TIMERS */
-
- /* Get the "real" server window out of the way as soon
- as possible. */
- if (server_mit_saver_window &&
- window_exists_p (dpy, server_mit_saver_window))
- XUnmapWindow (dpy, server_mit_saver_window);
-
- if (sevent->kind != ScreenSaverExternal)
- {
-# ifdef DEBUG_TIMERS
- fprintf (stderr,
- "%s: ScreenSaverOn event wasn't of type External!\n",
- progname);
-# endif /* DEBUG_TIMERS */
- }
-
- if (until_idle_p)
- goto DONE;
- }
- else if (sevent->state == ScreenSaverOff)
- {
-# ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: ScreenSaverOff event received at %s\n",
- progname, timestring ());
-# endif /* DEBUG_TIMERS */
- if (!until_idle_p)
- goto DONE;
- }
-# ifdef DEBUG_TIMERS
- else if (verbose_p)
- printf ("%s: unknown MIT-SCREEN-SAVER event received at %s\n",
- progname, timestring ());
-# endif /* DEBUG_TIMERS */
- }
- else
-
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
- if (event.type == (sgi_saver_ext_event_number + ScreenSaverStart))
- {
-# ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: ScreenSaverStart event received at %s\n",
- progname, timestring ());
-# endif /* DEBUG_TIMERS */
-
- if (until_idle_p)
- goto DONE;
- }
- else if (event.type == (sgi_saver_ext_event_number + ScreenSaverEnd))
- {
-# ifdef DEBUG_TIMERS
- if (verbose_p)
- printf ("%s: ScreenSaverEnd event received at %s\n",
- progname, timestring ());
-# endif /* DEBUG_TIMERS */
- if (!until_idle_p)
- goto DONE;
- }
- else
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
- XtDispatchEvent (&event);
- }
- }
- DONE:
-
- if (check_pointer_timer_id)
- {
- XtRemoveTimeOut (check_pointer_timer_id);
- check_pointer_timer_id = 0;
- }
- if (timer_id)
- {
- XtRemoveTimeOut (timer_id);
- timer_id = 0;
- }
-
- if (until_idle_p && cycle_id)
- abort ();
-
- return;
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xutil.h>
-#include <X11/Xatom.h>
-#include <X11/Xos.h>
-#include <X11/Xmu/SysUtil.h>
-
-#include <signal.h> /* for the signal names */
-
-#include "xscreensaver.h"
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-#include <X11/extensions/scrnsaver.h>
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-#include <X11/extensions/XScreenSaver.h>
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
-extern Bool use_mit_saver_extension;
-extern Bool use_sgi_saver_extension;
-
-#if __STDC__
-extern int kill (pid_t, int); /* signal() is in sys/signal.h... */
-#endif /* __STDC__ */
-
-extern Time timeout;
-
-extern Bool lock_p, demo_mode_p;
-
-Atom XA_VROOT, XA_XSETROOT_ID;
-Atom XA_SCREENSAVER_VERSION, XA_SCREENSAVER_ID;
-
-#if __STDC__
-extern void describe_visual (FILE *, Display *, Visual *);
-extern void reset_stderr (void);
-#endif
-
-Window screensaver_window = 0;
-Cursor cursor;
-Colormap cmap, cmap2;
-Bool install_cmap_p;
-Bool fade_p, unfade_p;
-int fade_seconds, fade_ticks;
-
-static unsigned long black_pixel;
-static Window real_vroot, real_vroot_value;
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-Window server_mit_saver_window = 0;
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#define ALL_POINTER_EVENTS \
- (ButtonPressMask | ButtonReleaseMask | EnterWindowMask | \
- LeaveWindowMask | PointerMotionMask | PointerMotionHintMask | \
- Button1MotionMask | Button2MotionMask | Button3MotionMask | \
- Button4MotionMask | Button5MotionMask | ButtonMotionMask)
-
-/* I don't really understand Sync vs Async, but these seem to work... */
-#define grab_kbd(win) \
- XGrabKeyboard (dpy, (win), True, GrabModeSync, GrabModeAsync, CurrentTime)
-#define grab_mouse(win) \
- XGrabPointer (dpy, (win), True, ALL_POINTER_EVENTS, \
- GrabModeAsync, GrabModeAsync, None, cursor, CurrentTime)
-
-void
-grab_keyboard_and_mouse P((void))
-{
- Status status;
- XSync (dpy, False);
-
- if (demo_mode_p) return;
-
- status = grab_kbd (screensaver_window);
- if (status != GrabSuccess)
- { /* try again in a second */
- sleep (1);
- status = grab_kbd (screensaver_window);
- if (status != GrabSuccess)
- fprintf (stderr, "%s: %scouldn't grab keyboard! (%d)\n",
- progname, (verbose_p ? "## " : ""), status);
- }
- status = grab_mouse (screensaver_window);
- if (status != GrabSuccess)
- { /* try again in a second */
- sleep (1);
- status = grab_mouse (screensaver_window);
- if (status != GrabSuccess)
- fprintf (stderr, "%s: %scouldn't grab pointer! (%d)\n",
- progname, (verbose_p ? "## " : ""), status);
- }
-}
-
-void
-ungrab_keyboard_and_mouse P((void))
-{
- XUngrabPointer (dpy, CurrentTime);
- XUngrabKeyboard (dpy, CurrentTime);
-}
-
-
-void
-ensure_no_screensaver_running ()
-{
- int i;
- Window root = RootWindowOfScreen (screen);
- Window root2, parent, *kids;
- unsigned int nkids;
- int (*old_handler) ();
-
- old_handler = XSetErrorHandler (BadWindow_ehandler);
-
- if (! XQueryTree (dpy, root, &root2, &parent, &kids, &nkids))
- abort ();
- if (root != root2)
- abort ();
- if (parent)
- abort ();
- for (i = 0; i < nkids; i++)
- {
- Atom type;
- int format;
- unsigned long nitems, bytesafter;
- char *version;
-
- if (XGetWindowProperty (dpy, kids[i], XA_SCREENSAVER_VERSION, 0, 1,
- False, XA_STRING, &type, &format, &nitems,
- &bytesafter, (unsigned char **) &version)
- == Success
- && type != None)
- {
- char *id;
- if (!XGetWindowProperty (dpy, kids[i], XA_SCREENSAVER_ID, 0, 512,
- False, XA_STRING, &type, &format, &nitems,
- &bytesafter, (unsigned char **) &id)
- == Success
- || type == None)
- id = "???";
-
- fprintf (stderr,
- "%s: %salready running on display %s (window 0x%x)\n from process %s.\n",
- progname, (verbose_p ? "## " : ""), DisplayString (dpy),
- (int) kids [i], id);
- exit (1);
- }
- }
-
- if (kids) XFree ((char *) kids);
- XSync (dpy, False);
- XSetErrorHandler (old_handler);
-}
-
-
-void
-disable_builtin_screensaver ()
-{
- int server_timeout, server_interval, prefer_blank, allow_exp;
- /* Turn off the server builtin saver if it is now running. */
- XForceScreenSaver (dpy, ScreenSaverReset);
- XGetScreenSaver (dpy, &server_timeout, &server_interval,
- &prefer_blank, &allow_exp);
-
-#if defined(HAVE_MIT_SAVER_EXTENSION) || defined(HAVE_SGI_SAVER_EXTENSION)
- if (use_mit_saver_extension || use_sgi_saver_extension)
- {
- /* Override the values specified with "xset" with our own parameters. */
- allow_exp = True;
- server_interval = 0;
- server_timeout = (timeout / 1000);
-
- /* The SGI extension won't give us events unless blanking is on.
- I think (unsure right now) that the MIT extension is the opposite. */
- prefer_blank = (use_sgi_saver_extension ? True : False);
-
- if (verbose_p)
- fprintf (stderr,
- "%s: configuring server for saver timeout of %d seconds.\n",
- progname, server_timeout);
- XSetScreenSaver (dpy, server_timeout, server_interval,
- prefer_blank, allow_exp);
- }
- else
-#endif /* HAVE_MIT_SAVER_EXTENSION || HAVE_SGI_SAVER_EXTENSION */
- if (server_timeout != 0)
- {
- server_timeout = 0;
- XSetScreenSaver (dpy, server_timeout, server_interval,
- prefer_blank, allow_exp);
- printf ("%s%sisabling server builtin screensaver.\n\
- You can re-enable it with \"xset s on\".\n",
- (verbose_p ? "" : progname), (verbose_p ? "\n\tD" : ": d"));
- }
-}
-
-\f
-/* Virtual-root hackery */
-
-#ifdef _VROOT_H_
-ERROR! You must not include vroot.h in this file.
-#endif
-
-static void
-#if __STDC__
-store_vroot_property (Window win, Window value)
-#else
-store_vroot_property (win, value)
- Window win, value;
-#endif
-{
-#if 0
- printf ("%s: storing XA_VROOT = 0x%x (%s) = 0x%x (%s)\n", progname,
- win,
- (win == screensaver_window ? "ScreenSaver" :
- (win == real_vroot ? "VRoot" :
- (win == real_vroot_value ? "Vroot_value" : "???"))),
- value,
- (value == screensaver_window ? "ScreenSaver" :
- (value == real_vroot ? "VRoot" :
- (value == real_vroot_value ? "Vroot_value" : "???"))));
-#endif
- XChangeProperty (dpy, win, XA_VROOT, XA_WINDOW, 32, PropModeReplace,
- (unsigned char *) &value, 1);
-}
-
-static void
-#if __STDC__
-remove_vroot_property (Window win)
-#else
-remove_vroot_property (win)
- Window win;
-#endif
-{
-#if 0
- printf ("%s: removing XA_VROOT from 0x%x (%s)\n", progname, win,
- (win == screensaver_window ? "ScreenSaver" :
- (win == real_vroot ? "VRoot" :
- (win == real_vroot_value ? "Vroot_value" : "???"))));
-#endif
- XDeleteProperty (dpy, win, XA_VROOT);
-}
-
-
-static void
-kill_xsetroot_data P((void))
-{
- Atom type;
- int format;
- unsigned long nitems, bytesafter;
- Pixmap *dataP = 0;
-
- /* If the user has been using xv or xsetroot as a screensaver (to display
- an image on the screensaver window, as a kind of slideshow) then the
- pixmap and its associated color cells have been put in RetainPermanent
- CloseDown mode. Since we're not destroying the xscreensaver window,
- but merely unmapping it, we need to free these resources or those
- colormap cells will stay allocated while the screensaver is off. (We
- could just delete the screensaver window and recreate it later, but
- that could cause other problems.) This code does an atomic read-and-
- delete of the _XSETROOT_ID property, and if it held a pixmap, then we
- cause the RetainPermanent resources of the client which created it
- (and which no longer exists) to be freed.
- */
- if (XGetWindowProperty (dpy, screensaver_window, XA_XSETROOT_ID, 0, 1,
- True, AnyPropertyType, &type, &format, &nitems,
- &bytesafter, (unsigned char **) &dataP)
- == Success
- && type != None)
- {
- if (dataP && *dataP && type == XA_PIXMAP && format == 32 &&
- nitems == 1 && bytesafter == 0)
- {
- if (verbose_p)
- printf ("%s: destroying xsetroot data (0x%lX).\n",
- progname, *dataP);
- XKillClient (dpy, *dataP);
- }
- else
- fprintf (stderr, "%s: %sdeleted unrecognised _XSETROOT_ID property: \n\
- %lu, %lu; type: %lu, format: %d, nitems: %lu, bytesafter %ld\n",
- progname, (verbose_p ? "## " : ""),
- (unsigned long) dataP, (dataP ? *dataP : 0), type,
- format, nitems, bytesafter);
- }
-}
-
-
-static void handle_signals P((Bool on_p));
-
-static void
-save_real_vroot P((void))
-{
- int i;
- Window root = RootWindowOfScreen (screen);
- Window root2, parent, *kids;
- unsigned int nkids;
-
- real_vroot = 0;
- real_vroot_value = 0;
- if (! XQueryTree (dpy, root, &root2, &parent, &kids, &nkids))
- abort ();
- if (root != root2)
- abort ();
- if (parent)
- abort ();
- for (i = 0; i < nkids; i++)
- {
- Atom type;
- int format;
- unsigned long nitems, bytesafter;
- Window *vrootP = 0;
-
- if (XGetWindowProperty (dpy, kids[i], XA_VROOT, 0, 1, False, XA_WINDOW,
- &type, &format, &nitems, &bytesafter,
- (unsigned char **) &vrootP)
- != Success)
- continue;
- if (! vrootP)
- continue;
- if (real_vroot)
- {
- if (*vrootP == screensaver_window) abort ();
- fprintf (stderr,
- "%s: %smore than one virtual root window found (0x%x and 0x%x).\n",
- progname, (verbose_p ? "## " : ""),
- (int) real_vroot, (int) kids [i]);
- exit (1);
- }
- real_vroot = kids [i];
- real_vroot_value = *vrootP;
- }
-
- if (real_vroot)
- {
- handle_signals (True);
- remove_vroot_property (real_vroot);
- XSync (dpy, False);
- }
-
- XFree ((char *) kids);
-}
-
-static Bool
-restore_real_vroot_1 P((void))
-{
- if (verbose_p && real_vroot)
- printf ("%s: restoring __SWM_VROOT property on the real vroot (0x%lx).\n",
- progname, (unsigned long) real_vroot);
- remove_vroot_property (screensaver_window);
- if (real_vroot)
- {
- store_vroot_property (real_vroot, real_vroot_value);
- real_vroot = 0;
- real_vroot_value = 0;
- /* make sure the property change gets there before this process
- terminates! We might be doing this because we have intercepted
- SIGTERM or something. */
- XSync (dpy, False);
- return True;
- }
- return False;
-}
-
-void
-restore_real_vroot ()
-{
- if (restore_real_vroot_1 ())
- handle_signals (False);
-}
-
-\f
-/* Signal hackery to ensure that the vroot doesn't get left in an
- inconsistent state
- */
-
-static const char *sig_names [255] = { 0 };
-
-static void
-restore_real_vroot_handler (sig)
- int sig;
-{
- signal (sig, SIG_DFL);
- if (restore_real_vroot_1 ())
- fprintf (stderr, "\n%s: %s%s (%d) intercepted, vroot restored.\n",
- progname, (verbose_p ? "## " : ""),
- ((sig < sizeof(sig_names) && sig >= 0 && sig_names [sig])
- ? sig_names [sig] : "unknown signal"),
- sig);
- kill (getpid (), sig);
-}
-
-
-static void
-#if __STDC__
-catch_signal (int sig, char *signame, Bool on_p)
-#else
-catch_signal (sig, signame, on_p)
- int sig;
- char *signame;
- Bool on_p;
-#endif
-{
- if (! on_p)
- signal (sig, SIG_DFL);
- else
- {
- sig_names [sig] = signame;
- if (((int) signal (sig, restore_real_vroot_handler)) == -1)
- {
- char buf [255];
- sprintf (buf, "%s: %scouldn't catch %s (%d)", progname,
- (verbose_p ? "## " : ""), signame, sig);
- perror (buf);
- restore_real_vroot ();
- exit (1);
- }
- }
-}
-
-static void
-handle_signals (on_p)
- Bool on_p;
-{
-#if 0
- if (on_p) printf ("handling signals\n");
- else printf ("unhandling signals\n");
-#endif
-
- catch_signal (SIGHUP, "SIGHUP", on_p);
- catch_signal (SIGINT, "SIGINT", on_p);
- catch_signal (SIGQUIT, "SIGQUIT", on_p);
- catch_signal (SIGILL, "SIGILL", on_p);
- catch_signal (SIGTRAP, "SIGTRAP", on_p);
- catch_signal (SIGIOT, "SIGIOT", on_p);
- catch_signal (SIGABRT, "SIGABRT", on_p);
-#ifdef SIGEMT
- catch_signal (SIGEMT, "SIGEMT", on_p);
-#endif
- catch_signal (SIGFPE, "SIGFPE", on_p);
- catch_signal (SIGBUS, "SIGBUS", on_p);
- catch_signal (SIGSEGV, "SIGSEGV", on_p);
-#ifdef SIGSYS
- catch_signal (SIGSYS, "SIGSYS", on_p);
-#endif
- catch_signal (SIGTERM, "SIGTERM", on_p);
-#ifdef SIGXCPU
- catch_signal (SIGXCPU, "SIGXCPU", on_p);
-#endif
-#ifdef SIGXFSZ
- catch_signal (SIGXFSZ, "SIGXFSZ", on_p);
-#endif
-#ifdef SIGDANGER
- catch_signal (SIGDANGER, "SIGDANGER", on_p);
-#endif
-}
-
-\f
-/* Managing the actual screensaver window */
-
-Bool
-window_exists_p (dpy, window)
- Display *dpy;
- Window window;
-{
- int (*old_handler) ();
- XWindowAttributes xgwa;
- xgwa.screen = 0;
- old_handler = XSetErrorHandler (BadWindow_ehandler);
- XGetWindowAttributes (dpy, window, &xgwa);
- XSync (dpy, False);
- XSetErrorHandler (old_handler);
- return (xgwa.screen != 0);
-}
-
-void
-initialize_screensaver_window P((void))
-{
- /* This resets the screensaver window as fully as possible, since there's
- no way of knowing what some random client may have done to us in the
- meantime. We could just destroy and recreate the window, but that has
- its own set of problems...
- */
- XColor black;
- XClassHint class_hints;
- XSetWindowAttributes attrs;
- unsigned long attrmask;
- int width = WidthOfScreen (screen);
- int height = HeightOfScreen (screen);
- char id [2048];
-
- reset_stderr ();
-
- black.red = black.green = black.blue = 0;
-
- if (cmap == DefaultColormapOfScreen (screen))
- cmap = 0;
-
- if (install_cmap_p || visual != DefaultVisualOfScreen (screen))
- {
- if (! cmap)
- {
- cmap = XCreateColormap (dpy, RootWindowOfScreen (screen),
- visual, AllocNone);
- if (! XAllocColor (dpy, cmap, &black)) abort ();
- black_pixel = black.pixel;
- }
- }
- else
- {
- if (cmap)
- {
- XFreeColors (dpy, cmap, &black_pixel, 1, 0);
- XFreeColormap (dpy, cmap);
- }
- cmap = DefaultColormapOfScreen (screen);
- black_pixel = BlackPixelOfScreen (screen);
- }
-
- if (cmap2)
- {
- XFreeColormap (dpy, cmap2);
- cmap2 = 0;
- }
-
- if (fade_p)
- {
- cmap2 = copy_colormap (dpy, cmap, 0);
- if (! cmap2)
- fade_p = unfade_p = 0;
- }
-
- attrmask = (CWOverrideRedirect | CWEventMask | CWBackingStore | CWColormap |
- CWBackPixel | CWBackingPixel | CWBorderPixel);
- attrs.override_redirect = True;
-
- /* When use_mit_saver_extension or use_sgi_saver_extension is true, we won't
- actually be reading these events during normal operation; but we still
- need to see Button events for demo-mode to work properly.
- */
- attrs.event_mask = (KeyPressMask | KeyReleaseMask |
- ButtonPressMask | ButtonReleaseMask |
- PointerMotionMask);
-
- attrs.backing_store = NotUseful;
- attrs.colormap = cmap;
- attrs.background_pixel = black_pixel;
- attrs.backing_pixel = black_pixel;
- attrs.border_pixel = black_pixel;
-
-#if 0
- if (demo_mode_p || lock_p) width = width / 2; /* #### */
-#endif
-
- if (screensaver_window || !verbose_p)
- ;
- else if (visual == DefaultVisualOfScreen (screen))
- {
- fprintf (stderr, "%s: using default visual ", progname);
- describe_visual (stderr, dpy, visual);
- }
- else
- {
- fprintf (stderr, "%s: using visual: ", progname);
- describe_visual (stderr, dpy, visual);
- fprintf (stderr, "%s: default visual: ", progname);
- describe_visual (stderr, dpy, DefaultVisualOfScreen (screen));
- }
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (use_mit_saver_extension)
- {
- XScreenSaverInfo *info;
- Window root = RootWindowOfScreen (screen);
-
- /* This call sets the server screensaver timeouts to what we think
- they should be (based on the resources and args xscreensaver was
- started with.) It's important that we do this to sync back up
- with the server - if we have turned on prematurely, as by an
- ACTIVATE ClientMessage, then the server may decide to activate
- the screensaver while it's already active. That's ok for us,
- since we would know to ignore that ScreenSaverActivate event,
- but a side effect of this would be that the server would map its
- saver window (which we then hide again right away) meaning that
- the bits currently on the screen get blown away. Ugly. */
-#if 0
- /* #### Ok, that doesn't work - when we tell the server that the
- screensaver is "off" it sends us a Deactivate event, which is
- sensible... but causes the saver to never come on. Hmm. */
- disable_builtin_screensaver ();
-#endif /* 0 */
-
-#if 0
- /* #### The MIT-SCREEN-SAVER extension gives us access to the
- window that the server itself uses for saving the screen.
- However, using this window in any way, in particular, calling
- XScreenSaverSetAttributes() as below, tends to make the X server
- crash. So fuck it, let's try and get along without using it...
-
- It's also inconvenient to use this window because it doesn't
- always exist (though the ID is constant.) So to use this
- window, we'd have to reimplement the ACTIVATE ClientMessage to
- tell the *server* to tell *us* to turn on, to cause the window
- to get created at the right time. Gag. */
- XScreenSaverSetAttributes (dpy, root,
- 0, 0, width, height, 0,
- visual_depth, InputOutput, visual,
- attrmask, &attrs);
- XSync (dpy, False);
-#endif /* 0 */
-
- info = XScreenSaverAllocInfo ();
- XScreenSaverQueryInfo (dpy, root, info);
- server_mit_saver_window = info->window;
- if (! server_mit_saver_window) abort ();
- XFree (info);
- }
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
- if (screensaver_window)
- {
- XWindowChanges changes;
- unsigned int changesmask = CWX|CWY|CWWidth|CWHeight|CWBorderWidth;
- changes.x = 0;
- changes.y = 0;
- changes.width = width;
- changes.height = height;
- changes.border_width = 0;
-
- XConfigureWindow (dpy, screensaver_window, changesmask, &changes);
- XChangeWindowAttributes (dpy, screensaver_window, attrmask, &attrs);
- }
- else
- {
- screensaver_window =
- XCreateWindow (dpy, RootWindowOfScreen (screen), 0, 0, width, height,
- 0, visual_depth, InputOutput, visual, attrmask,
- &attrs);
- }
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (!use_mit_saver_extension ||
- window_exists_p (dpy, screensaver_window))
- /* When using the MIT-SCREEN-SAVER extension, the window pointed to
- by screensaver_window only exists while the saver is active.
- So we must be careful to only try and manipulate it while it
- exists...
- */
-#endif /* HAVE_MIT_SAVER_EXTENSION */
- {
- class_hints.res_name = progname;
- class_hints.res_class = progclass;
- XSetClassHint (dpy, screensaver_window, &class_hints);
- XStoreName (dpy, screensaver_window, "screensaver");
- XChangeProperty (dpy, screensaver_window, XA_SCREENSAVER_VERSION,
- XA_STRING, 8, PropModeReplace,
- (unsigned char *) screensaver_version,
- strlen (screensaver_version));
-
- sprintf (id, "%d on host ", getpid ());
- if (! XmuGetHostname (id + strlen (id), sizeof (id) - strlen (id) - 1))
- strcat (id, "???");
- XChangeProperty (dpy, screensaver_window, XA_SCREENSAVER_ID, XA_STRING,
- 8, PropModeReplace, (unsigned char *) id, strlen (id));
-
- if (!cursor)
- {
- Pixmap bit;
- bit = XCreatePixmapFromBitmapData (dpy, screensaver_window, "\000",
- 1, 1,
- BlackPixelOfScreen (screen),
- BlackPixelOfScreen (screen), 1);
- cursor = XCreatePixmapCursor (dpy, bit, bit, &black, &black, 0, 0);
- XFreePixmap (dpy, bit);
- }
-
- XSetWindowBackground (dpy, screensaver_window, black_pixel);
- if (! demo_mode_p)
- XDefineCursor (dpy, screensaver_window, cursor);
- else
- XUndefineCursor (dpy, screensaver_window);
- }
-}
-
-
-void
-raise_window (inhibit_fade, between_hacks_p)
- Bool inhibit_fade, between_hacks_p;
-{
- initialize_screensaver_window ();
-
- if (fade_p && !inhibit_fade && !demo_mode_p)
- {
- int grabbed;
- Colormap current_map = (between_hacks_p
- ? cmap
- : DefaultColormapOfScreen (screen));
- copy_colormap (dpy, current_map, cmap2);
- if (verbose_p) fprintf (stderr, "%s: fading... ", progname);
- XGrabServer (dpy);
- /* grab and blacken mouse on the root window (saver not mapped yet) */
- grabbed = grab_mouse (RootWindowOfScreen (screen));
- /* fade what's on the screen to black */
- XInstallColormap (dpy, cmap2);
- fade_colormap (dpy, current_map, cmap2, fade_seconds, fade_ticks,
- True, True);
- if (verbose_p) fprintf (stderr, "fading done.\n");
- XClearWindow (dpy, screensaver_window);
- XMapRaised (dpy, screensaver_window);
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (server_mit_saver_window &&
- window_exists_p (dpy, server_mit_saver_window))
- XUnmapWindow (dpy, server_mit_saver_window);
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
- /* Once the saver window is up, restore the colormap.
- (The "black" pixels of the two colormaps are compatible.) */
- XInstallColormap (dpy, cmap);
- if (grabbed == GrabSuccess)
- XUngrabPointer (dpy, CurrentTime);
- XUngrabServer (dpy);
- }
- else
- {
- XClearWindow (dpy, screensaver_window);
- XMapRaised (dpy, screensaver_window);
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (server_mit_saver_window &&
- window_exists_p (dpy, server_mit_saver_window))
- XUnmapWindow (dpy, server_mit_saver_window);
-#endif /* HAVE_MIT_SAVER_EXTENSION */
- }
-
- if (install_cmap_p)
- XInstallColormap (dpy, cmap);
-}
-
-#ifdef __hpux
- /* Calls to XHPDisableReset and XHPEnableReset must be balanced,
- or BadAccess errors occur. */
-static Bool hp_locked_p = False;
-#endif /* __hpux */
-
-void
-blank_screen ()
-{
- save_real_vroot ();
- store_vroot_property (screensaver_window, screensaver_window);
- raise_window (False, False);
- grab_keyboard_and_mouse ();
-#ifdef __hpux
- if (lock_p && !hp_locked_p)
- XHPDisableReset (dpy); /* turn off C-Sh-Reset */
- hp_locked_p = True;
-#endif
-}
-
-void
-unblank_screen ()
-{
- if (unfade_p && !demo_mode_p)
- {
- int grabbed;
- Colormap default_map = DefaultColormapOfScreen (screen);
- blacken_colormap (dpy, cmap2);
- if (verbose_p) fprintf (stderr, "%s: unfading... ", progname);
- XGrabServer (dpy);
- /* grab and blacken mouse on the root window. */
- grabbed = grab_mouse (RootWindowOfScreen (screen));
- XInstallColormap (dpy, cmap2);
- XUnmapWindow (dpy, screensaver_window);
- fade_colormap (dpy, default_map, cmap2, fade_seconds, fade_ticks,
- False, True);
- XInstallColormap (dpy, default_map);
- if (verbose_p) fprintf (stderr, "unfading done.\n");
- if (grabbed == GrabSuccess)
- XUngrabPointer (dpy, CurrentTime);
- XUngrabServer (dpy);
- }
- else
- {
- if (install_cmap_p)
- {
- XClearWindow (dpy, screensaver_window); /* avoid technicolor */
- XInstallColormap (dpy, DefaultColormapOfScreen (screen));
- }
- XUnmapWindow (dpy, screensaver_window);
- }
-
-
- /* If the focus window does has a non-default colormap, then install
- that colormap as well. (On SGIs, this will cause both the root map
- and the focus map to be installed simultaniously. It'd be nice to
- pick up the other colormaps that had been installed, too; perhaps
- XListInstalledColormaps could be used for that?)
- */
- {
- Window focus = 0;
- int revert_to;
- XGetInputFocus (dpy, &focus, &revert_to);
- if (focus && focus != PointerRoot && focus != None)
- {
- XWindowAttributes xgwa;
- Colormap default_map = DefaultColormapOfScreen (screen);
- xgwa.colormap = 0;
- XGetWindowAttributes (dpy, focus, &xgwa);
- if (xgwa.colormap &&
- xgwa.colormap != default_map)
- XInstallColormap (dpy, xgwa.colormap);
- }
- }
-
-
- kill_xsetroot_data ();
- ungrab_keyboard_and_mouse ();
- restore_real_vroot ();
-
-#ifdef __hpux
- if (lock_p && hp_locked_p)
- XHPEnableReset (dpy); /* turn C-Sh-Reset back on */
- hp_locked_p = False;
-#endif
-}
+++ /dev/null
-/* xscreensaver-command, Copyright (c) 1991-1995
- * Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "version.h"
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xatom.h>
-#include <X11/Xos.h>
-#if __STDC__
-# include <stdlib.h>
-#endif
-
-#ifdef _VROOT_H_
-ERROR! you must not include vroot.h in this file
-#endif
-
-static char *screensaver_version;
-static char *usage = "usage: %s -<switch>\n\
-\n\
- This program provides external control of a running xscreensaver process.\n\
- Version %s, copyright (c) 1991-1994 Jamie Zawinski <jwz@netscape.com>.\n\
-\n\
- -demo Enter interactive demo mode.\n\
- -deactivate Turns off the screensaver if it is on, as user input would.\n\
- -activate Turns it on as if the user had been idle for long enough.\n\
- -cycle Stops the current hack and runs a new one.\n\
- -next Like either -activate or -cycle, depending on which is more\n\
- appropriate, except that the screenhack that will be run is\n\
- the next one in the list of hacks, instead of a randomly-\n\
- chosen one. This option is good for looking at a demo of\n\
- each of the hacks in place.\n\
- -prev Like -next, but goes in the other direction.\n\
- -exit Causes the screensaver process to exit. It should be ok to\n\
- just kill the process (NOT with -9!) but this is a slightly\n\
- easier way.\n\
- -restart Causes the screensaver process to exit and then restart with\n\
- the same command line arguments. This is a good way of \n\
- causing the screensaver to re-read the resource database.\n\
- -lock Same as -activate, but with immediate locking.\n\
-\n\
- See the man page for more details.\n\n";
-
-static Window
-find_screensaver_window (dpy, progname)
- Display *dpy;
- char *progname;
-{
- int i;
- Window root = RootWindowOfScreen (DefaultScreenOfDisplay (dpy));
- Window root2, parent, *kids;
- unsigned int nkids;
-
- if (! XQueryTree (dpy, root, &root2, &parent, &kids, &nkids))
- abort ();
- if (root != root2)
- abort ();
- if (parent)
- abort ();
- if (! (kids && nkids))
- abort ();
- for (i = 0; i < nkids; i++)
- {
- Atom type;
- int format;
- unsigned long nitems, bytesafter;
- char *version;
-
- if (XGetWindowProperty (dpy, kids[i],
- XInternAtom (dpy, "_SCREENSAVER_VERSION", False),
- 0, 1, False, XA_STRING,
- &type, &format, &nitems, &bytesafter,
- (unsigned char **) &version)
- == Success
- && type != None)
- return kids[i];
- }
- fprintf (stderr, "%s: no screensaver is running on display %s\n", progname,
- DisplayString (dpy));
- exit (1);
-}
-
-
-#define USAGE() \
- { fprintf (stderr, usage, argv[0], screensaver_version); exit (1); }
-
-void
-main (argc, argv)
- int argc;
- char **argv;
-{
- Display *dpy;
- Window window;
- XEvent event;
- int i;
- char *message = 0, *dpyname = 0;
- screensaver_version = (char *) malloc (5);
- memcpy (screensaver_version, screensaver_id + 17, 4);
- screensaver_version [4] = 0;
- for (i = 1; i < argc; i++)
- {
- char *s = argv [i];
- int L = strlen (s);
- if (L < 2) USAGE ();
- if (!strncmp (s, "-display", L)) dpyname = argv [++i];
- else if (message) USAGE ()
- else if (!strncmp (s, "-activate", L)) message = "ACTIVATE";
- else if (!strncmp (s, "-deactivate", L)) message = "DEACTIVATE";
- else if (!strncmp (s, "-cycle", L)) message = "CYCLE";
- else if (!strncmp (s, "-next", L)) message = "NEXT";
- else if (!strncmp (s, "-prev", L)) message = "PREV";
- else if (!strncmp (s, "-exit", L)) message = "EXIT";
- else if (!strncmp (s, "-restart", L)) message = "RESTART";
- else if (!strncmp (s, "-demo", L)) message = "DEMO";
- else if (!strncmp (s, "-lock", L)) message = "LOCK";
- else USAGE ();
- }
- if (! message) USAGE ();
- if (!dpyname) dpyname = (char *) getenv ("DISPLAY");
- dpy = XOpenDisplay (dpyname);
- if (!dpy)
- {
- fprintf (stderr, "%s: can't open display %s\n", argv[0],
- (dpyname ? dpyname : "(null)"));
- exit (1);
- }
- window = find_screensaver_window (dpy, argv[0]);
-
- event.xany.type = ClientMessage;
- event.xclient.display = dpy;
- event.xclient.window = window;
- event.xclient.message_type = XInternAtom (dpy, "SCREENSAVER", False);
- event.xclient.format = 32;
- event.xclient.data.l[0] = (long) XInternAtom (dpy, message, False);
- if (! XSendEvent (dpy, window, False, 0L, &event))
- {
- fprintf (stderr, "%s: XSendEvent(dpy, 0x%x ...) failed.\n", argv [0],
- (unsigned int) window);
- exit (1);
- }
- XSync (dpy, 0);
- exit (0);
-}
+++ /dev/null
-.de EX \"Begin example
-.ne 5
-.if n .sp 1
-.if t .sp .5
-.nf
-.in +.5i
-..
-.de EE
-.fi
-.in -.5i
-.if n .sp 1
-.if t .sp .5
-..
-.TH XScreenSaver 1 "22-mar-93" "X Version 11"
-.SH NAME
-xscreensaver-command - control a running xscreensaver process
-.SH SYNOPSIS
-.B xscreensaver-command
-[\-activate] [\-deactivate] [\-cycle] [\-next] [\-prev] [\-exit] [\-restart] [\-demo] [\-lock]
-.SH DESCRIPTION
-The \fIxscreensaver\-command\fP program controls a running \fIxscreensaver\fP
-process by sending it client-messages.
-.SH OPTIONS
-.I xscreensaver-command
-accepts the following options:
-.TP 8
-.B \-activate
-Tell the screensaver to turn on immediately (that is, pretend that the
-user been idle for long enough.) It will turn off as soon as there is
-any user activity, as usual.
-
-It is useful to run this from a menu; you may wish to run it as
-.EX
-sleep 5 ; xscreensaver-command -activate
-.EE
-to be sure that you have time to remove your hand from the mouse before
-the screensaver comes on.
-.TP 8
-.B \-deactivate
-Tell the screensaver to turn off, as if there had been user activity.
-If locking is enabled, then the screensaver will prompt for a password
-as usual.
-.TP 8
-.B \-cycle
-Tell the screensaver to change which graphics hack it is running, just
-as if the ``cycle'' timer had expired.
-.TP 8
-.B \-next
-This is like either \fI\-activate\fP or \fI\-cycle\fP, depending on which is
-more appropriate, except that the screenhack that will be run is the next
-one in the list of programs, instead of a randomly-chosen one. This option
-is good for looking at a demo of each of the screensavers currently available.
-You might want to put this on a menu.
-.TP 8
-.B \-prev
-This is like \fI\-next\fP, but cycles in the other direction.
-.TP 8
-.B \-demo
-Cause the screensaver to enter its interactive demo mode, if it has been
-compiled with support for it.
-.TP 8
-.B \-lock
-Like \fI\-activate\fP, but a password will be required before the screensaver
-turns off, even if the screensaver's \fIlock\fP resource is false. The
-display will be locked immediately even if the screensaver's \fIlockTimeout\fP
-resource is non-zero.
-.TP 8
-.B \-exit
-Causes the screensaver process to exit gracefully. This is a slightly
-safer way to kill the screensaver than by using \fIkill\fP.
-
-Never use \fIkill -9\fP with \fIxscreensaver\fP while the screensaver is
-active. If you are using a virtual root window manager, that can leave
-things in an inconsistent state, and you may need to restart your window
-manager to repair the damage.
-.TP 8
-.B \-restart
-Causes the screensaver process to exit and then restart with the same command
-line arguments. This is a good way of causing the screensaver to re-read the
-resource database.
-
-If the screensaver is run from \fIxdm(1)\fP (that is, it is already running
-before you log in) then you may want to issue the ``restart'' command from
-one of your startup scripts, so that the screensaver gets your resource
-settings instead of the default ones.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B PATH
-to find the executable to restart.
-.SH "SEE ALSO"
-.BR X (1),
-.BR xscreensaver (1)
-.SH BUGS
-Diagnostics are reported on the \fBstderr\fP of the \fIxscreensaver\fP
-process, not this process, so the caller of \fIxscreensaver-command\fP
-may not see the error messages.
-.SH COPYRIGHT
-Copyright \(co 1992, 1993 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "version.h"
-
-/* ========================================================================
- * First we wait until the keyboard and mouse become idle for the specified
- * amount of time. We do this in one of three different ways: periodically
- * checking with the XIdle server extension; selecting key and mouse events
- * on (nearly) all windows; or by waiting for the MIT-SCREEN-SAVER extension
- * to send us a "you are idle" event.
- *
- * Then, we map a full screen black window (or, in the case of the
- * MIT-SCREEN-SAVER extension, use the one it gave us.)
- *
- * We place a __SWM_VROOT property on this window, so that newly-started
- * clients will think that this window is a "virtual root" window.
- *
- * If there is an existing "virtual root" window (one that already had
- * an __SWM_VROOT property) then we remove that property from that window.
- * Otherwise, clients would see that window (the real virtual root) instead
- * of ours (the impostor.)
- *
- * Then we pick a random program to run, and start it. Two assumptions
- * are made about this program: that it has been specified with whatever
- * command-line options are necessary to make it run on the root window;
- * and that it has been compiled with vroot.h, so that it is able to find
- * the root window when a virtual-root window manager (or this program) is
- * running.
- *
- * Then, we wait for keyboard or mouse events to be generated on the window.
- * When they are, we kill the inferior process, unmap the window, and restore
- * the __SWM_VROOT property to the real virtual root window if there was one.
- *
- * While we are waiting, we also set up timers so that, after a certain
- * amount of time has passed, we can start a different screenhack. We do
- * this by killing the running child process with SIGTERM, and then starting
- * a new one in the same way.
- *
- * If there was a real virtual root, meaning that we removed the __SWM_VROOT
- * property from it, meaning we must (absolutely must) restore it before we
- * exit, then we set up signal handlers for most signals (SIGINT, SIGTERM,
- * etc.) that do this. Most Xlib and Xt routines are not reentrant, so it
- * is not generally safe to call them from signal handlers; however, this
- * program spends most of its time waiting, so the window of opportunity
- * when code could be called reentrantly is fairly small; and also, the worst
- * that could happen is that the call would fail. If we've gotten one of
- * these signals, then we're on our way out anyway. If we didn't restore the
- * __SWM_VROOT property, that would be very bad, so it's worth a shot. Note
- * that this means that, if you're using a virtual-root window manager, you
- * can really fuck up the world by killing this process with "kill -9".
- *
- * This program accepts ClientMessages of type SCREENSAVER; these messages
- * may contain the atom ACTIVATE or DEACTIVATE, meaning to turn the
- * screensaver on or off now, regardless of the idleness of the user,
- * and a few other things. The included "xscreensaver_command" program
- * sends these messsages.
- *
- * If we don't have the XIdle, MIT-SCREEN-SAVER, or SGI SCREEN_SAVER
- * extensions, then we do the XAutoLock trick: notice every window that
- * gets created, and wait 30 seconds or so until its creating process has
- * settled down, and then select KeyPress events on those windows which
- * already select for KeyPress events. It's important that we not select
- * KeyPress on windows which don't select them, because that would
- * interfere with event propagation. This will break if any program
- * changes its event mask to contain KeyRelease or PointerMotion more than
- * 30 seconds after creating the window, but that's probably pretty rare.
- *
- * The reason that we can't select KeyPresses on windows that don't have
- * them already is that, when dispatching a KeyPress event, X finds the
- * lowest (leafmost) window in the hierarchy on which *any* client selects
- * for KeyPress, and sends the event to that window. This means that if a
- * client had a window with subwindows, and expected to receive KeyPress
- * events on the parent window instead of the subwindows, then that client
- * would malfunction if some other client selected KeyPress events on the
- * subwindows. It is an incredible misdesign that one client can make
- * another client malfunction in this way.
- *
- * To detect mouse motion, we periodically wake up and poll the mouse
- * position and button/modifier state, and notice when something has
- * changed. We make this check every five seconds by default, and since the
- * screensaver timeout has a granularity of one minute, this makes the
- * chance of a false positive very small. We could detect mouse motion in
- * the same way as keyboard activity, but that would suffer from the same
- * "client changing event mask" problem that the KeyPress events hack does.
- * I think polling is more reliable.
- *
- * None of this crap happens if we're using one of the extensions, so install
- * one of them if the description above sounds just too flaky to live. It
- * is, but those are your choices.
- *
- * A third idle-detection option could be implemented (but is not): when
- * running on the console display ($DISPLAY is `localhost`:0) and we're on a
- * machine where /dev/tty and /dev/mouse have reasonable last-modification
- * times, we could just stat() those. But the incremental benefit of
- * implementing this is really small, so forget I said anything.
- *
- * Debugging hints:
- * - Have a second terminal handy.
- * - Be careful where you set your breakpoints, you don't want this to
- * stop under the debugger with the keyboard grabbed or the blackout
- * window exposed.
- * - you probably can't set breakpoints in functions that are called on
- * the other side of a call to fork() -- if your clients are dying
- * with signal 5, Trace/BPT Trap, you're losing in this way.
- * - If you aren't using a server extension, don't leave this stopped
- * under the debugger for very long, or the X input buffer will get
- * huge because of the keypress events it's selecting for. This can
- * make your X server wedge with "no more input buffers."
- *
- * ======================================================================== */
-
-#if __STDC__
-#include <stdlib.h>
-#include <unistd.h>
-#endif
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xatom.h>
-#include <X11/Intrinsic.h>
-#include <X11/Xos.h>
-#include <X11/Xmu/Error.h>
-
-#ifdef HAVE_XIDLE_EXTENSION
-#include <X11/extensions/xidle.h>
-#endif /* HAVE_XIDLE_EXTENSION */
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-#include <X11/extensions/scrnsaver.h>
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-#include <X11/extensions/XScreenSaver.h>
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
-#include "yarandom.h"
-#include "xscreensaver.h"
-
-extern char *get_string_resource P((char *, char *));
-extern Bool get_boolean_resource P((char *, char *));
-extern int get_integer_resource P((char *, char *));
-extern unsigned int get_minutes_resource P((char *, char *));
-extern unsigned int get_seconds_resource P((char *, char *));
-
-extern Visual *get_visual_resource P((Display *, char *, char *));
-extern int get_visual_depth P((Display *, Visual *));
-
-extern void notice_events_timer P((XtPointer closure, XtIntervalId *timer));
-extern void cycle_timer P((void *junk1, XtPointer junk2));
-extern void activate_lock_timer P((void *junk1, XtPointer junk2));
-extern void sleep_until_idle P((Bool until_idle_p));
-
-extern void ensure_no_screensaver_running P((void));
-extern void initialize_screensaver_window P((void));
-extern void disable_builtin_screensaver P((void));
-
-extern void hack_environment P((void));
-extern void grab_keyboard_and_mouse P((void));
-extern void ungrab_keyboard_and_mouse P((void));
-
-extern void save_argv P((int argc, char **argv));
-
-extern void initialize_stderr P((void));
-
-char *screensaver_version;
-char *progname;
-char *progclass;
-XrmDatabase db;
-
-XtAppContext app;
-
-Display *dpy;
-Screen *screen;
-Visual *visual;
-int visual_depth;
-
-Widget toplevel_shell;
-
-Time lock_timeout;
-
-extern Time timeout;
-extern Time cycle;
-#ifndef NO_LOCKING
-extern Time passwd_timeout;
-#endif
-extern Time pointer_timeout;
-extern Time notice_events_timeout;
-extern XtIntervalId lock_id, cycle_id;
-
-Bool use_xidle_extension;
-Bool use_mit_saver_extension;
-Bool use_sgi_saver_extension;
-Bool verbose_p;
-Bool lock_p, locked_p;
-
-extern char **screenhacks;
-extern int screenhacks_count;
-extern char *shell;
-extern int nice_inferior;
-extern Window screensaver_window;
-extern Cursor cursor;
-extern Colormap cmap, cmap2;
-extern Bool fade_p, unfade_p;
-extern int fade_seconds, fade_ticks;
-extern Bool install_cmap_p;
-extern Bool locking_disabled_p;
-extern char *nolock_reason;
-extern Bool demo_mode_p;
-extern Bool dbox_up_p;
-extern int next_mode_p;
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-int mit_saver_ext_event_number = 0;
-int mit_saver_ext_error_number = 0;
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-int sgi_saver_ext_event_number = 0;
-int sgi_saver_ext_error_number = 0;
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
-static time_t initial_delay;
-
-extern Atom XA_VROOT, XA_XSETROOT_ID;
-extern Atom XA_SCREENSAVER_VERSION, XA_SCREENSAVER_ID;
-
-static Atom XA_SCREENSAVER;
-static Atom XA_ACTIVATE, XA_DEACTIVATE, XA_CYCLE, XA_NEXT, XA_PREV;
-static Atom XA_EXIT, XA_RESTART, XA_DEMO, XA_LOCK;
-
-#ifdef NO_MOTIF /* kludge */
-Bool demo_mode_p = 0;
-Bool dbox_up_p = 0;
-#endif
-
-\f
-#ifdef NO_DEMO_MODE
-# define demo_mode() abort()
-#else
-extern void demo_mode P((void));
-#endif
-\f
-static XrmOptionDescRec options [] = {
- { "-timeout", ".timeout", XrmoptionSepArg, 0 },
- { "-cycle", ".cycle", XrmoptionSepArg, 0 },
- { "-idelay", ".initialDelay", XrmoptionSepArg, 0 },
- { "-nice", ".nice", XrmoptionSepArg, 0 },
- { "-visual", ".visualID", XrmoptionSepArg, 0 },
- { "-lock-timeout", ".lockTimeout", XrmoptionSepArg, 0 },
- { "-install", ".installColormap", XrmoptionNoArg, "on" },
- { "-no-install", ".installColormap", XrmoptionNoArg, "off" },
- { "-verbose", ".verbose", XrmoptionNoArg, "on" },
- { "-silent", ".verbose", XrmoptionNoArg, "off" },
- { "-xidle-extension", ".xidleExtension", XrmoptionNoArg, "on" },
- { "-no-xidle-extension", ".xidleExtension", XrmoptionNoArg, "off" },
- { "-mit-extension", ".mitSaverExtension",XrmoptionNoArg, "on" },
- { "-no-mit-extension", ".mitSaverExtension",XrmoptionNoArg, "off" },
- { "-sgi-extension", ".sgiSaverExtension",XrmoptionNoArg, "on" },
- { "-no-sgi-extension", ".sgiSaverExtension",XrmoptionNoArg, "off" },
- { "-lock", ".lock", XrmoptionNoArg, "on" },
- { "-no-lock", ".lock", XrmoptionNoArg, "off" }
-};
-
-static char *defaults[] = {
-#include "XScreenSaver.ad.h"
- 0
-};
-
-static void
-do_help P((void))
-{
- printf ("\
-xscreensaver %s, copyright (c) 1991-1996 by Jamie Zawinski <jwz@netscape.com>.\n\
-The standard Xt command-line options are accepted; other options include:\n\
-\n\
- -timeout <minutes> When the screensaver should activate.\n\
- -cycle <minutes> How long to let each hack run.\n\
- -idelay <seconds> How long to sleep before startup.\n\
- -visual <id-or-class> Which X visual to run on.\n\
- -demo Enter interactive demo mode on startup.\n\
- -install Install a private colormap.\n\
- -no-install Don't.\n\
- -verbose Be loud.\n\
- -silent Don't.\n\
- -xidle-extension Use the R5 XIdle server extension.\n\
- -no-xidle-extension Don't.\n\
- -mit-extension Use the R6 MIT_SCREEN_SAVER server extension.\n\
- -no-mit-extension Don't.\n\
- -sgi-extension Use the SGI SCREEN-SAVER server extension.\n\
- -no-sgi-extension Don't.\n\
- -lock Require a password before deactivating.\n\
- -no-lock Don't.\n\
- -lock-timeout <minutes> Grace period before locking; default 0.\n\
- -help This message.\n\
-\n\
-Use the `xscreensaver-command' program to control a running screensaver.\n\
-\n\
-The *programs, *colorPrograms, and *monoPrograms resources control which\n\
-graphics demos will be launched by the screensaver. See the man page for\n\
-more details.\n\n",
- screensaver_version);
-
-#ifdef NO_LOCKING
- printf ("Support for locking was not enabled at compile-time.\n");
-#endif
-#ifdef NO_DEMO_MODE
- printf ("Support for demo mode was not enabled at compile-time.\n");
-#endif
-#if !defined(HAVE_XIDLE_EXTENSION) && !defined(HAVE_MIT_SAVER_EXTENSION) && !defined(HAVE_SGI_SAVER_EXTENSION)
- printf ("Support for the XIDLE, SCREEN_SAVER, and MIT-SCREEN-SAVER server\
- extensions\nwas not enabled at compile-time.\n");
-#endif /* !HAVE_XIDLE_EXTENSION && !HAVE_MIT_SAVER_EXTENSION && !HAVE_SGI_SAVER_EXTENSION */
-
- fflush (stdout);
- exit (1);
-}
-
-
-static void
-get_screenhacks P((void))
-{
- char *data[3];
- int i, hacks_size = 10;
-
- data[0] = get_string_resource ("programs", "Programs");
- data[1] = ((CellsOfScreen (screen) <= 2)
- ? get_string_resource ("monoPrograms", "MonoPrograms")
- : get_string_resource ("colorPrograms", "ColorPrograms"));
- data[2] = 0;
- if (! data[0]) data[0] = data[1], data[1] = 0;
-
- screenhacks = (char **) malloc (sizeof (char *) * hacks_size);
- screenhacks_count = 0;
-
- for (i = 0; data[i]; i++)
- {
- int j = 0;
- char *d = data [i];
- int size = strlen (d);
- while (j < size)
- {
- int end, start = j;
- if (d[j] == ' ' || d[j] == '\t' || d[j] == '\n' || d[j] == 0)
- {
- j++;
- continue;
- }
- if (hacks_size <= screenhacks_count)
- screenhacks = (char **) realloc (screenhacks,
- (hacks_size = hacks_size * 2) *
- sizeof (char *));
- screenhacks [screenhacks_count++] = d + j;
- while (d[j] != 0 && d[j] != '\n')
- j++;
- end = j;
- while (j > start && (d[j-1] == ' ' || d[j-1] == '\t'))
- j--;
- d[j] = 0;
- j = end + 1;
- }
- }
-
- /* shrink all whitespace to one space, for the benefit of the "demo"
- mode display. We only do this when we can easily tell that the
- whitespace is not significant (no shell metachars).
- */
- for (i = 0; i < screenhacks_count; i++)
- {
- char *s = screenhacks [i];
- char *s2;
- int L = strlen (s);
- int j, k;
- for (j = 0; j < L; j++)
- {
- switch (s[j])
- {
- case '\'': case '"': case '`': case '\\':
- goto DONE;
- case '\t':
- s[j] = ' ';
- case ' ':
- k = 0;
- for (s2 = s+j+1; *s2 == ' ' || *s2 == '\t'; s2++)
- k++;
- if (k > 0)
- for (s2 = s + j + 1; *s2; s2++)
- s2 [0] = s2 [k];
- break;
- }
- }
- DONE:
- ;
- }
-
- if (screenhacks_count)
- {
- /* Shrink down the screenhacks array to be only as big as it needs to.
- This doesn't really matter at all. */
- screenhacks = (char **)
- realloc (screenhacks, ((screenhacks_count + 1) * sizeof(char *)));
- screenhacks [screenhacks_count] = 0;
- }
- else
- {
- free (screenhacks);
- screenhacks = 0;
- }
-}
-
-
-static void
-get_resources P((void))
-{
- /* Note: we can't use the resource ".visual" because Xt is SO FUCKED. */
- visual = get_visual_resource (dpy, "visualID", "VisualID");
- timeout = 1000 * get_minutes_resource ("timeout", "Time");
- cycle = 1000 * get_minutes_resource ("cycle", "Time");
- lock_timeout = 1000 * get_minutes_resource ("lockTimeout", "Time");
- nice_inferior = get_integer_resource ("nice", "Nice");
- verbose_p = get_boolean_resource ("verbose", "Boolean");
- lock_p = get_boolean_resource ("lock", "Boolean");
- install_cmap_p = get_boolean_resource ("installColormap", "Boolean");
- fade_p = get_boolean_resource ("fade", "Boolean");
- unfade_p = get_boolean_resource ("unfade", "Boolean");
- fade_seconds = get_seconds_resource ("fadeSeconds", "Time");
- fade_ticks = get_integer_resource ("fadeTicks", "Integer");
- shell = get_string_resource ("bourneShell", "BourneShell");
- initial_delay = get_seconds_resource ("initialDelay", "Time");
- pointer_timeout = 1000 * get_seconds_resource ("pointerPollTime", "Time");
- notice_events_timeout = 1000 * get_seconds_resource ("windowCreationTimeout",
- "Time");
-#ifndef NO_LOCKING
- passwd_timeout = 1000 * get_seconds_resource ("passwdTimeout", "Time");
- if (passwd_timeout == 0) passwd_timeout = 30000;
-#endif
- if (timeout < 10000) timeout = 10000;
- if (cycle != 0 && cycle < 2000) cycle = 2000;
- if (pointer_timeout == 0) pointer_timeout = 5000;
- if (notice_events_timeout == 0) notice_events_timeout = 10000;
- if (fade_seconds == 0 || fade_ticks == 0) fade_p = False;
- if (! fade_p) unfade_p = False;
-
- visual_depth = get_visual_depth (dpy, visual);
-
- if (visual_depth <= 1 || CellsOfScreen (screen) <= 2)
- install_cmap_p = False;
-
-#ifdef NO_LOCKING
- locking_disabled_p = True;
- nolock_reason = "not compiled with locking support";
- if (lock_p)
- {
- lock_p = False;
- fprintf (stderr, "%s: %snot compiled with support for locking.\n",
- progname, (verbose_p ? "## " : ""));
- }
-#else /* ! NO_LOCKING */
- if (lock_p && locking_disabled_p)
- {
- fprintf (stderr, "%s: %slocking is disabled (%s).\n", progname,
- (verbose_p ? "## " : ""), nolock_reason);
- lock_p = False;
- }
-#endif /* ! NO_LOCKING */
-
- /* don't set use_xidle_extension unless it is explicitly specified */
- if (get_string_resource ("xidleExtension", "Boolean"))
- use_xidle_extension = get_boolean_resource ("xidleExtension", "Boolean");
- else
-#ifdef HAVE_XIDLE_EXTENSION /* pick a default */
- use_xidle_extension = True;
-#else /* !HAVE_XIDLE_EXTENSION */
- use_xidle_extension = False;
-#endif /* !HAVE_XIDLE_EXTENSION */
-
- /* don't set use_saver_extension unless it is explicitly specified */
- if (get_string_resource ("mitSaverExtension", "Boolean"))
- use_mit_saver_extension = get_boolean_resource ("mitSaverExtension",
- "Boolean");
- else
-#ifdef HAVE_MIT_SAVER_EXTENSION /* pick a default */
- use_mit_saver_extension = True;
-#else /* !HAVE_MIT_SAVER_EXTENSION */
- use_mit_saver_extension = False;
-#endif /* !HAVE_MIT_SAVER_EXTENSION */
-
- /* don't set use_saver_extension unless it is explicitly specified */
- if (get_string_resource ("sgiSaverExtension", "Boolean"))
- use_sgi_saver_extension = get_boolean_resource ("sgiSaverExtension",
- "Boolean");
- else
-#ifdef HAVE_SGI_SAVER_EXTENSION /* pick a default */
- use_sgi_saver_extension = True;
-#else /* !HAVE_SGI_SAVER_EXTENSION */
- use_sgi_saver_extension = False;
-#endif /* !HAVE_SGI_SAVER_EXTENSION */
-
- get_screenhacks ();
-}
-
-char *
-timestring P((void))
-{
- long now = time ((time_t *) 0);
- char *str = (char *) ctime (&now);
- char *nl = (char *) strchr (str, '\n');
- if (nl) *nl = 0; /* take off that dang newline */
- return str;
-}
-
-#ifdef NO_SETUID
-# define hack_uid()
-# define hack_uid_warn()
-#else /* !NO_SETUID */
-extern void hack_uid P((void));
-extern void hack_uid_warn P((void));
-#endif /* NO_SETUID */
-
-
-#ifndef NO_LOCKING
-extern Bool unlock_p P((Widget));
-extern Bool lock_init P((void));
-#endif
-
-static void initialize P((int argc, char **argv));
-static void main_loop P((void));
-
-void
-main (argc, argv)
- int argc;
- char **argv;
-{
- initialize (argc, argv);
- main_loop ();
-}
-
-
-static int
-saver_ehandler (dpy, error)
- Display *dpy;
- XErrorEvent *error;
-{
- fprintf (real_stderr, "\nX error in %s:\n", progname);
- if (XmuPrintDefaultErrorMessage (dpy, error, real_stderr))
- exit (-1);
- else
- fprintf (real_stderr, " (nonfatal.)\n");
- return 0;
-}
-
-static void
-#if __STDC__
-initialize_connection (int argc, char **argv)
-#else
-initialize_connection (argc, argv)
- int argc;
- char **argv;
-#endif
-{
- toplevel_shell = XtAppInitialize (&app, progclass,
- options, XtNumber (options),
- &argc, argv, defaults, 0, 0);
-
- dpy = XtDisplay (toplevel_shell);
- screen = XtScreen (toplevel_shell);
- db = XtDatabase (dpy);
- XtGetApplicationNameAndClass (dpy, &progname, &progclass);
-
- if (argc == 2 && !strcmp (argv[1], "-help"))
- do_help ();
- else if (argc > 1)
- {
- fprintf (stderr, "%s: unknown option %s\n", progname, argv [1]);
- exit (1);
- }
- get_resources ();
- hack_uid_warn ();
- hack_environment ();
- XA_VROOT = XInternAtom (dpy, "__SWM_VROOT", False);
- XA_SCREENSAVER = XInternAtom (dpy, "SCREENSAVER", False);
- XA_SCREENSAVER_VERSION = XInternAtom (dpy, "_SCREENSAVER_VERSION", False);
- XA_SCREENSAVER_ID = XInternAtom (dpy, "_SCREENSAVER_ID", False);
- XA_XSETROOT_ID = XInternAtom (dpy, "_XSETROOT_ID", False);
- XA_ACTIVATE = XInternAtom (dpy, "ACTIVATE", False);
- XA_DEACTIVATE = XInternAtom (dpy, "DEACTIVATE", False);
- XA_RESTART = XInternAtom (dpy, "RESTART", False);
- XA_CYCLE = XInternAtom (dpy, "CYCLE", False);
- XA_NEXT = XInternAtom (dpy, "NEXT", False);
- XA_PREV = XInternAtom (dpy, "PREV", False);
- XA_EXIT = XInternAtom (dpy, "EXIT", False);
- XA_DEMO = XInternAtom (dpy, "DEMO", False);
- XA_LOCK = XInternAtom (dpy, "LOCK", False);
-}
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
-
-static int
-ignore_all_errors_ehandler (dpy, error)
- Display *dpy;
- XErrorEvent *error;
-{
- return 0;
-}
-
-static void
-init_mit_saver_extension ()
-{
- XID kill_id;
- Atom kill_type;
- Window root = RootWindowOfScreen (screen);
- Pixmap blank_pix = XCreatePixmap (dpy, root, 1, 1, 1);
-
- /* Kill off the old MIT-SCREEN-SAVER client if there is one.
- This tends to generate X errors, though (possibly due to a bug
- in the server extension itself?) so just ignore errors here. */
- if (XScreenSaverGetRegistered (dpy, XScreenNumberOfScreen (screen),
- &kill_id, &kill_type)
- && kill_id != blank_pix)
- {
- int (*old_handler) ();
- old_handler = XSetErrorHandler (ignore_all_errors_ehandler);
- XKillClient (dpy, kill_id);
- XSync (dpy, False);
- XSetErrorHandler (old_handler);
- }
-
- XScreenSaverSelectInput (dpy, root, ScreenSaverNotifyMask);
-
- XScreenSaverRegister (dpy, XScreenNumberOfScreen (screen),
- (XID) blank_pix, XA_PIXMAP);
-}
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
-
-static void
-init_sgi_saver_extension ()
-{
- if (! XScreenSaverEnable (dpy, XScreenNumberOfScreen(screen)))
- {
- fprintf (stderr,
- "%s: %sSGI SCREEN_SAVER extension exists, but can't be initialized;\n\
- perhaps some other screensaver program is already running?\n",
- progname, (verbose_p ? "## " : ""));
- use_sgi_saver_extension = False;
- }
-}
-
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
-
-extern void init_sigchld P((void));
-
-static void
-initialize (argc, argv)
- int argc;
- char **argv;
-{
- Bool initial_demo_mode_p = False;
- screensaver_version = (char *) malloc (5);
- memcpy (screensaver_version, screensaver_id + 17, 4);
- screensaver_version [4] = 0;
- progname = argv[0]; /* reset later; this is for the benefit of lock_init() */
-
-#ifdef NO_LOCKING
- locking_disabled_p = True;
- nolock_reason = "not compiled with locking support";
-#else
- locking_disabled_p = False;
-
-#ifdef SCO
- set_auth_parameters(argc, argv);
-#endif
-
- if (! lock_init ()) /* before hack_uid() for proper permissions */
- {
- locking_disabled_p = True;
- nolock_reason = "error getting password";
- }
-#endif
-
- hack_uid ();
- progclass = "XScreenSaver";
-
- /* remove -demo switch before saving argv */
- {
- int i;
- for (i = 1; i < argc; i++)
- while (!strcmp ("-demo", argv [i]))
- {
- int j;
- initial_demo_mode_p = True;
- for (j = i; j < argc; j++)
- argv [j] = argv [j+1];
- argv [j] = 0;
- argc--;
- if (argc <= i) break;
- }
- }
- save_argv (argc, argv);
- initialize_connection (argc, argv);
- ensure_no_screensaver_running ();
-
- if (verbose_p)
- printf ("\
-%s %s, copyright (c) 1991-1996 by Jamie Zawinski <jwz@netscape.com>.\n\
- pid = %d.\n", progname, screensaver_version, getpid ());
- ensure_no_screensaver_running ();
-
- demo_mode_p = initial_demo_mode_p;
- screensaver_window = 0;
- cursor = 0;
- srandom ((int) time ((time_t *) 0));
- cycle_id = 0;
- lock_id = 0;
- locked_p = False;
-
- if (use_sgi_saver_extension)
- {
-#ifdef HAVE_SGI_SAVER_EXTENSION
- if (! XScreenSaverQueryExtension (dpy,
- &sgi_saver_ext_event_number,
- &sgi_saver_ext_error_number))
- {
- fprintf (stderr,
- "%s: %sdisplay %s does not support the SGI SCREEN_SAVER extension.\n",
- progname, (verbose_p ? "## " : ""), DisplayString (dpy));
- use_sgi_saver_extension = False;
- }
- else if (use_mit_saver_extension)
- {
- fprintf (stderr, "%s: %sSGI SCREEN_SAVER extension used instead\
- of MIT-SCREEN-SAVER extension.\n",
- progname, (verbose_p ? "## " : ""));
- use_mit_saver_extension = False;
- }
- else if (use_xidle_extension)
- {
- fprintf (stderr,
- "%s: %sSGI SCREEN_SAVER extension used instead of XIDLE extension.\n",
- progname, (verbose_p ? "## " : ""));
- use_xidle_extension = False;
- }
-#else /* !HAVE_MIT_SAVER_EXTENSION */
- fprintf (stderr,
- "%s: %snot compiled with support for the SGI SCREEN_SAVER extension.\n",
- progname, (verbose_p ? "## " : ""));
- use_sgi_saver_extension = False;
-#endif /* !HAVE_SGI_SAVER_EXTENSION */
- }
-
- if (use_mit_saver_extension)
- {
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (! XScreenSaverQueryExtension (dpy,
- &mit_saver_ext_event_number,
- &mit_saver_ext_error_number))
- {
- fprintf (stderr,
- "%s: %sdisplay %s does not support the MIT-SCREEN-SAVER extension.\n",
- progname, (verbose_p ? "## " : ""), DisplayString (dpy));
- use_mit_saver_extension = False;
- }
- else if (use_xidle_extension)
- {
- fprintf (stderr,
- "%s: %sMIT-SCREEN-SAVER extension used instead of XIDLE extension.\n",
- progname, (verbose_p ? "## " : ""));
- use_xidle_extension = False;
- }
-#else /* !HAVE_MIT_SAVER_EXTENSION */
- fprintf (stderr,
- "%s: %snot compiled with support for the MIT-SCREEN-SAVER extension.\n",
- progname, (verbose_p ? "## " : ""));
- use_mit_saver_extension = False;
-#endif /* !HAVE_MIT_SAVER_EXTENSION */
- }
-
- if (use_xidle_extension)
- {
-#ifdef HAVE_XIDLE_EXTENSION
- int first_event, first_error;
- if (! XidleQueryExtension (dpy, &first_event, &first_error))
- {
- fprintf (stderr,
- "%s: %sdisplay %s does not support the XIdle extension.\n",
- progname, (verbose_p ? "## " : ""), DisplayString (dpy));
- use_xidle_extension = False;
- }
-#else /* !HAVE_XIDLE_EXTENSION */
- fprintf (stderr, "%s: %snot compiled with support for XIdle.\n",
- progname, (verbose_p ? "## " : ""));
- use_xidle_extension = False;
-#endif /* !HAVE_XIDLE_EXTENSION */
- }
-
- /* Call this only after having probed for presence of desired extension. */
- initialize_screensaver_window ();
-
- init_sigchld ();
-
- disable_builtin_screensaver ();
-
-#ifdef HAVE_MIT_SAVER_EXTENSION
- if (use_mit_saver_extension)
- init_mit_saver_extension ();
-#endif /* HAVE_MIT_SAVER_EXTENSION */
-
-#ifdef HAVE_SGI_SAVER_EXTENSION
- if (use_sgi_saver_extension)
- init_sgi_saver_extension ();
-#endif /* HAVE_SGI_SAVER_EXTENSION */
-
- if (verbose_p && use_mit_saver_extension)
- fprintf (stderr, "%s: using MIT-SCREEN-SAVER server extension.\n",
- progname);
- if (verbose_p && use_sgi_saver_extension)
- fprintf (stderr, "%s: using SGI SCREEN_SAVER server extension.\n",
- progname);
- if (verbose_p && use_xidle_extension)
- fprintf (stderr, "%s: using XIdle server extension.\n",
- progname);
-
- initialize_stderr ();
- XSetErrorHandler (saver_ehandler);
-
- if (initial_demo_mode_p)
- /* If the user wants demo mode, don't wait around before doing it. */
- initial_delay = 0;
-
- if (!use_xidle_extension &&
- !use_mit_saver_extension &&
- !use_sgi_saver_extension)
- {
- if (initial_delay)
- {
- if (verbose_p)
- {
- printf ("%s: waiting for %d second%s...", progname,
- (int) initial_delay, (initial_delay == 1 ? "" : "s"));
- fflush (stdout);
- }
- sleep (initial_delay);
- if (verbose_p)
- printf (" done.\n");
- }
- if (verbose_p)
- {
- printf ("%s: selecting events on extant windows...", progname);
- fflush (stdout);
- }
- notice_events_timer ((XtPointer)
- RootWindowOfScreen (XtScreen (toplevel_shell)),
- 0);
- if (verbose_p)
- printf (" done.\n");
- }
-}
-
-
-extern void suspend_screenhack P((Bool suspend_p));
-
-static void
-main_loop ()
-{
- while (1)
- {
- if (! demo_mode_p)
- sleep_until_idle (True);
-
- if (demo_mode_p)
- demo_mode ();
- else
- {
- if (verbose_p)
- printf ("%s: user is idle; waking up at %s.\n", progname,
- timestring());
- blank_screen ();
- spawn_screenhack (True);
- if (cycle)
- cycle_id = XtAppAddTimeOut (app, cycle,
- (XtTimerCallbackProc)cycle_timer, 0);
-
-#ifndef NO_LOCKING
- if (lock_p && lock_timeout == 0)
- locked_p = True;
- if (lock_p && !locked_p)
- /* locked_p might be true already because of ClientMessage */
- lock_id = XtAppAddTimeOut (app,lock_timeout,
- (XtTimerCallbackProc)
- activate_lock_timer,0);
-#endif
-
- PASSWD_INVALID:
-
- sleep_until_idle (False); /* until not idle */
-
-#ifndef NO_LOCKING
- if (locked_p)
- {
- Bool val;
- if (locking_disabled_p) abort ();
- dbox_up_p = True;
-
- /* We used to ungrab the keyboard here, before calling unlock_p()
- to pop up the dialog box. This left the keyboard ungrabbed
- for a small window, during an insecure state. Bennett Todd
- was seeing the bahavior that, when the load was high, he could
- actually get characters through to a shell under the saver
- window (he accidentally typed his password there...)
-
- So the ungrab has been moved down into pop_passwd_dialog()
- just after the server is grabbed, closing this window
- entirely.
- */
- /* ungrab_keyboard_and_mouse (); */
-
- suspend_screenhack (True);
- XUndefineCursor (dpy, screensaver_window);
- if (verbose_p)
- printf ("%s: prompting for password.\n", progname);
- val = unlock_p (toplevel_shell);
- if (verbose_p && val == False)
- printf ("%s: password incorrect!\n", progname);
- dbox_up_p = False;
- XDefineCursor (dpy, screensaver_window, cursor);
- suspend_screenhack (False);
-
- /* I think this grab is now redundant, but it shouldn't hurt. */
- grab_keyboard_and_mouse ();
-
- if (! val)
- goto PASSWD_INVALID;
- locked_p = False;
- }
-#endif
- unblank_screen ();
- kill_screenhack ();
- if (cycle_id)
- {
- XtRemoveTimeOut (cycle_id);
- cycle_id = 0;
- }
-#ifndef NO_LOCKING
- if (lock_id)
- {
- XtRemoveTimeOut (lock_id);
- lock_id = 0;
- }
-#endif
- if (verbose_p)
- printf ("%s: user is active; going to sleep at %s.\n", progname,
- timestring ());
- }
- }
-}
-
-\f
-
-Bool
-handle_clientmessage (event, until_idle_p)
- XEvent *event;
- Bool until_idle_p;
-{
- Atom type = 0;
- if (event->xclient.message_type != XA_SCREENSAVER)
- {
- char *str;
- str = XGetAtomName (dpy, event->xclient.message_type);
- fprintf (stderr, "%s: %sunrecognised ClientMessage type %s received\n",
- progname, (verbose_p ? "## " : ""),
- (str ? str : "(null)"));
- if (str) XFree (str);
- return False;
- }
- if (event->xclient.format != 32)
- {
- fprintf (stderr, "%s: %sClientMessage of format %d received, not 32\n",
- progname, (verbose_p ? "## " : ""), event->xclient.format);
- return False;
- }
- type = event->xclient.data.l[0];
- if (type == XA_ACTIVATE)
- {
- if (until_idle_p)
- {
- if (verbose_p)
- printf ("%s: ACTIVATE ClientMessage received.\n", progname);
- if (use_mit_saver_extension || use_sgi_saver_extension)
- {
- XForceScreenSaver (dpy, ScreenSaverActive);
- return False;
- }
- else
- {
- return True;
- }
- }
- fprintf (stderr,
- "%s: %sClientMessage ACTIVATE received while already active.\n",
- progname, (verbose_p ? "## " : ""));
- }
- else if (type == XA_DEACTIVATE)
- {
- if (! until_idle_p)
- {
- if (verbose_p)
- printf ("%s: DEACTIVATE ClientMessage received.\n", progname);
- if (use_mit_saver_extension || use_sgi_saver_extension)
- {
- XForceScreenSaver (dpy, ScreenSaverReset);
- return False;
- }
- else
- {
- return True;
- }
- }
- fprintf (stderr,
- "%s: %sClientMessage DEACTIVATE received while inactive.\n",
- progname, (verbose_p ? "## " : ""));
- }
- else if (type == XA_CYCLE)
- {
- if (! until_idle_p)
- {
- if (verbose_p)
- printf ("%s: CYCLE ClientMessage received.\n", progname);
- if (cycle_id)
- XtRemoveTimeOut (cycle_id);
- cycle_id = 0;
- cycle_timer (0, 0);
- return False;
- }
- fprintf (stderr,
- "%s: %sClientMessage CYCLE received while inactive.\n",
- progname, (verbose_p ? "## " : ""));
- }
- else if (type == XA_NEXT || type == XA_PREV)
- {
- if (verbose_p)
- printf ("%s: %s ClientMessage received.\n", progname,
- (type == XA_NEXT ? "NEXT" : "PREV"));
- next_mode_p = 1 + (type == XA_PREV);
-
- if (! until_idle_p)
- {
- if (cycle_id)
- XtRemoveTimeOut (cycle_id);
- cycle_id = 0;
- cycle_timer (0, 0);
- }
- else
- return True;
- }
- else if (type == XA_EXIT)
- {
- /* Ignore EXIT message if the screen is locked. */
- if (until_idle_p || !locked_p)
- {
- if (verbose_p)
- printf ("%s: EXIT ClientMessage received.\n", progname);
- if (! until_idle_p)
- {
- unblank_screen ();
- kill_screenhack ();
- XSync (dpy, False);
- }
- exit (0);
- }
- else
- fprintf (stderr, "%s: %sEXIT ClientMessage received while locked.\n",
- progname, (verbose_p ? "## " : ""));
- }
- else if (type == XA_RESTART)
- {
- /* The RESTART message works whether the screensaver is active or not,
- unless the screen is locked, in which case it doesn't work.
- */
- if (until_idle_p || !locked_p)
- {
- if (verbose_p)
- printf ("%s: RESTART ClientMessage received.\n", progname);
- if (! until_idle_p)
- {
- unblank_screen ();
- kill_screenhack ();
- XSync (dpy, False);
- }
- restart_process ();
- }
- else
- fprintf(stderr, "%s: %sRESTART ClientMessage received while locked.\n",
- progname, (verbose_p ? "## " : ""));
- }
- else if (type == XA_DEMO)
- {
-#ifdef NO_DEMO_MODE
- fprintf (stderr,
- "%s: %snot compiled with support for DEMO mode\n",
- progname, (verbose_p ? "## " : ""));
-#else
- if (until_idle_p)
- {
- if (verbose_p)
- printf ("%s: DEMO ClientMessage received.\n", progname);
- demo_mode_p = True;
- return True;
- }
- fprintf (stderr,
- "%s: %sDEMO ClientMessage received while active.\n",
- progname, (verbose_p ? "## " : ""));
-#endif
- }
- else if (type == XA_LOCK)
- {
-#ifdef NO_LOCKING
- fprintf (stderr, "%s: %snot compiled with support for LOCK mode\n",
- progname, (verbose_p ? "## " : ""));
-#else
- if (locking_disabled_p)
- fprintf (stderr,
- "%s: %sLOCK ClientMessage received, but locking is disabled.\n",
- progname, (verbose_p ? "## " : ""));
- else if (locked_p)
- fprintf (stderr,
- "%s: %sLOCK ClientMessage received while already locked.\n",
- progname, (verbose_p ? "## " : ""));
- else
- {
- locked_p = True;
- if (verbose_p)
- printf ("%s: LOCK ClientMessage received;%s locking.\n",
- progname, until_idle_p ? " activating and" : "");
-
- if (lock_id) /* we're doing it now, so lose the timeout */
- {
- XtRemoveTimeOut (lock_id);
- lock_id = 0;
- }
-
- if (until_idle_p)
- {
- if (use_mit_saver_extension || use_sgi_saver_extension)
- {
- XForceScreenSaver (dpy, ScreenSaverActive);
- return False;
- }
- else
- {
- return True;
- }
- }
- }
-#endif
- }
- else
- {
- char *str;
- str = (type ? XGetAtomName(dpy, type) : 0);
- if (str)
- fprintf (stderr,
- "%s: %sunrecognised screensaver ClientMessage %s received\n",
- progname, (verbose_p ? "## " : ""), str);
- else
- fprintf (stderr,
- "%s: %sunrecognised screensaver ClientMessage 0x%x received\n",
- progname, (verbose_p ? "## " : ""),
- (unsigned int) event->xclient.data.l[0]);
- if (str) XFree (str);
- }
- return False;
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#if __STDC__
-# include <stdlib.h>
-# include <unistd.h>
-#endif
-
-#include <stdio.h>
-
-#if __STDC__
-# define P(x)x
-#else
-# define P(x)()
-# ifndef const
-# define const /**/
-# endif
-#endif
-
-#ifdef NO_MOTIF
-# define NO_DEMO_MODE
-
- /* #### If anyone ever finishes the Athena locking code, remove this.
- Until then, Locking requires Motif. */
-# ifndef NO_LOCKING
-# define NO_LOCKING
-# endif
-
-#endif
-
-extern char *progname, *progclass;
-extern char *screensaver_version;
-
-extern Display *dpy;
-extern Screen *screen;
-extern Visual *visual;
-extern int visual_depth;
-
-extern Bool verbose_p;
-
-extern FILE *real_stderr;
-extern FILE *real_stdout;
-
-extern void initialize_screensaver_window P((void));
-extern void raise_window P((Bool inhibit_fade, Bool between_hacks_p));
-extern void blank_screen P((void));
-extern void unblank_screen P((void));
-extern void restart_process P((void));
-
-extern void restore_real_vroot P((void));
-
-extern void spawn_screenhack P((Bool));
-extern void kill_screenhack P((void));
-
-extern Colormap copy_colormap P((Display *, Colormap, Colormap));
-extern void fade_colormap P((Display*,Colormap,Colormap,int,int,Bool,Bool));
-extern void blacken_colormap P((Display *, Colormap));
-
-extern int BadWindow_ehandler P((Display *dpy, XErrorEvent *error));
-
-extern char *timestring P((void));
-extern Bool window_exists_p P((Display *dpy, Window window));
+++ /dev/null
-.de EX \"Begin example
-.ne 5
-.if n .sp 1
-.if t .sp .5
-.nf
-.in +.5i
-..
-.de EE
-.fi
-.in -.5i
-.if n .sp 1
-.if t .sp .5
-..
-.TH XScreenSaver 1 "6-Jan-95" "X Version 11"
-.SH NAME
-xscreensaver - graphics hack and screen locker, launched when the user is idle
-.SH SYNOPSIS
-.B xscreensaver
-[\-display \fIhost:display.screen\fP] [\-timeout \fIint\fP] [\-cycle \fIint\fP] [\-nice \fIint\fP] [\-verbose] [\-silent] [\-lock] [\-no\-lock] [\-lock\-timeout \fIint\fP] [\-demo] [\-visual \fIvisual\fP] [\-install] [\-no\-install] [\-xidle\-extension] [\-no\-xidle\-extension] [\-sgi\-extension] [\-no\-sgi\-extension] [\-mit\-extension] [\-no\-mit\-extension] [\-xrm \fIresources\fP]
-.SH DESCRIPTION
-The \fIxscreensaver\fP program waits until the keyboard and mouse have been
-idle for a period, and then runs a graphics demo chosen at random. It
-turns off as soon as there is any mouse or keyboard activity.
-
-This program can lock your terminal in order to prevent others from using it,
-though its default mode of operation is merely to display pretty pictures on
-your screen when it is not in use.
-
-The benefit that this program has over the combination of the
-.BR xlock (1)
-and
-.BR xautolock (1)
-programs is the ease with which new graphics hacks can be installed. You
-don't need to recompile (or even re-run) this program to add a new display
-mode.
-.SH OPTIONS
-.I xscreensaver
-accepts the following options:
-.TP 8
-.B \-timeout \fIminutes\fP
-The screensaver will activate after the keyboard and mouse have been idle
-for this many minutes.
-.TP 8
-.B \-cycle \fIminutes\fP
-After the screensaver has been running for this many minutes, the currently
-running sub-process will be killed (with \fBSIGTERM\fP), and a new one
-started. If this is 0, then the sub-process will not be killed; only one
-demo will run until the screensaver is deactivated by user activity.
-.TP 8
-.B \-nice \fIinteger\fP
-The sub-processes created by \fIxscreensaver\fP will be ``niced'' to this
-level, so that they do not consume cycles that are needed elsewhere.
-.TP 8
-.B \-verbose
-Print diagnostics.
-.TP 8
-.B \-silent
-
-.TP 8
-.B \-xidle\-extension
-Use the \fBXIDLE\fP server extension to decide whether the user is idle.
-This is the default if \fIxscreensaver\fP has been compiled with support
-for this extension. On X11R4 or X11R5 systems, the XIdle method is faster
-and more reliable than what will be done otherwise, so use it if you can.
-.TP 8
-.B \-no\-xidle\-extension
-Don't use the \fBXIDLE\fP server extension.
-.TP 8
-.B \-sgi\-extension
-Use the SGI \fBSCREEN_SAVER\fP server extension to decide whether the user
-is idle. This is the default if \fIxscreensaver\fP has been compiled with
-support for this extension. On SGI systems, the \fBSCREEN_SAVER\fP
-method is faster and more reliable than what will be done otherwise, so use
-it if you can.
-.TP 8
-.B \-no\-sgi\-extension
-Don't use the SGI \fBSCREEN_SAVER\fP server extension.
-.TP 8
-.B \-mit\-extension
-Use the \fBMIT\-SCREEN\-SAVER\fP server extension to decide whether the user
-is idle. This is the default if \fIxscreensaver\fP has been compiled with
-support for this extension. This extension is flaky, so it's use is not
-really recommended.
-.TP 8
-.B \-no\-mit\-extension
-Don't use the \fBMIT\-SCREEN\-SAVER\fP server extension.
-.TP 8
-.B \-lock
-Enable locking: before the screensaver will turn off, it requires you to
-type the password of the person who launched the screensaver, or the root
-password. (Note: this doesn't work if the screensaver is launched
-by
-.BR xdm (1)
-because it can't know the user-id of the logged-in user.)
-.TP 8
-.B \-no\-lock
-Disable locking. This is the default.
-.TP 8
-.B \-lock\-timeout \fIminutes\fP
-This is how long after the screensaver activates that locking is enabled.
-For example, if this is 5, then any user activity within five minutes of
-the time when the screensaver activated will cause the screen to unblank
-without requiring a password. After 5 minutes, a password will be
-required. The default is 0, meaning that if locking is enabled, then
-a password will be required as soon as the screensaver activates.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are:
-.RS 8
-.TP 8
-.B best
-Use the visual which supports the most writable color cells; this is
-the default.
-.TP 8
-.B default
-Use the screen's default visual (the visual of the root window.) This is
-not necessarily the most colorful visual, which is why it is not the default.
-.TP 8
-.I class
-One of \fBStaticGray\fP, \fBStaticColor\fP, \fBTrueColor\fP, \fBGrayScale\fP,
-\fBPseudoColor\fP, or \fBDirectColor\fP. Selects the deepest visual of
-the given class.
-.TP 8
-.I number
-A number (decimal or hex) is interpreted as a visual id number, as reported
-by the
-.BR xdpyinfo (1)
-program; in this way you can select a shallower visual if desired.
-.RE
-.TP 8
-.B \-no\-install
-Use the default colormap. This is the default.
-.TP 8
-.B \-install
-Install a private colormap while the screensaver is on, so that the graphics
-hacks can get as many colors as possible.
-.TP 8
-.B \-demo
-Enter the interactive demo mode immediately after startup. Normally
-demo mode is invoked via the
-.BR xscreensaver\-command (1)
-program.
-.SH X RESOURCES
-\fIxscreensaver\fP understands the following resources:
-.PP
-.TP 8
-.B timeout \fR(class \fBTime\fP)
-Same as the \fI\-timeout\fP command-line option. Default 10 minutes.
-.TP 8
-.B cycle \fR(class \fBTime\fP)
-Same as the \fI\-cycle\fP command-line option. Default 10 minutes.
-.TP 8
-.B nice \fR(class \fBNice\fP)
-Same as the \fI\-nice\fP command-line option. Default 10.
-.TP 8
-.B verbose \fR(class \fBBoolean\fP)
-Same as the \fI\-verbose\fP command-line option.
-.TP 8
-.B xidle \fR(class \fBBoolean\fP)
-Same as the \fI\-xidle\fP command-line option.
-.TP 8
-.B lock \fR(class \fBBoolean\fP)
-Same as the \fI\-lock\fP command-line option.
-.TP 8
-.B lockTimeout \fR(class \fBTime\fP)
-Same as the \fI\-lock\-timeout\fP command-line option.
-.TP 8
-.B fade \fR(class \fBBoolean\fP)
-If this is true, then when the screensaver activates, the current contents
-of the screen will fade to black instead of simply winking out. This only
-works on displays with writable colormaps. Default true. A fade will also
-be done when switching graphics hacks (when the \fIcycle\fP timer expires.)
-.TP 8
-.B unfade \fR(class \fBBoolean\fP)
-If this is true, then when the screensaver deactivates, the original contents
-of the screen will fade in from black instead of appearing immediately. This
-only works on displays with writable colormaps, and if \fIfade\fP is true
-as well. Default false.
-.TP 8
-.B fadeSeconds \fR(class \fBTime\fP)
-If \fIfade\fP is true, this is how long the fade will be in
-seconds (default 1.)
-.TP 8
-.B fadeTicks \fR(class \fBInteger\fP)
-If \fIfade\fP is true, this is how many times a second the colormap will
-be changed to effect a fade. Higher numbers yield smoother fades, but
-may make the fades take longer if your server isn't fast enough to keep
-up. Default 75.
-.TP 8
-.B installColormap \fR(class \fBBoolean\fP)
-Same as the \fI\-install\fP command-line option. Default false.
-.TP 8
-.B passwdTimeout \fR(class \fBTime\fP)
-If \fIlock\fP is true, this is how many seconds the password dialog box
-should be left on the screen before giving up (default 30.) This should
-not be too large: the X server is grabbed for the duration that the password
-dialog box is up (for security purposes) and leaving the server grabbed for
-too long can cause problems.
-.TP 8
-.B visualID \fR(class \fBVisualID\fP)
-Same as the \fI\-visual\fP command-line option. Default \fBbest\fP.
-.TP 8
-.B captureStderr \fR(class \fBBoolean\fP)
-Whether \fIxscreensaver\fP should redirect its standard-error stream to the
-window itself. Since its nature is to take over the screen, you would not
-normally see error messages generated by the screensaver or the programs it
-runs; this resource will cause the output of all relevant programs to be
-drawn on the screensaver window itself instead of written to the controlling
-terminal of the screensaver driver process. Default: True.
-.TP 8
-.B captureStdout \fR(class \fBBoolean\fP)
-Like \fBcaptureStderr\fP but for the standard-output stream. Default: True.
-.TP 8
-.B font \fR(class \fBFont\fP)
-The font used for the stdout/stderr text, if \fBcaptureStdout\fP or
-\fBcaptureStderr\fP are true. Default \fB*\-medium\-r\-*\-140\-*\-m\-*\fP
-(a 14 point fixed-width font.)
-.TP 8
-.B textForeground \fR(class \fBForeground\fP)
-The foreground color used for the stdout/stderr text, if \fBcaptureStdout\fP
-or \fBcaptureStderr\fP are true. Default: Yellow.
-.TP 8
-.B textBackground \fR(class \fBBackground\fP)
-The background color used for the stdout/stderr text, if \fBcaptureStdout\fP
-or \fBcaptureStderr\fP are true. Default: Black.
-.TP 8
-.B programs \fR(class \fBPrograms\fP)
-The graphics hacks which \fIxscreensaver\fP runs when the user is idle,
-in addition to those specified in colorPrograms or monoPrograms (as
-appropriate.) The value of this resource is a string, one \fIsh\fP command
-per line. Each line must contain exactly one command -- no semicolons.
-
-When the screensaver starts up, one of these is selected at random, and
-run. After the \fIcycle\fP period expires, it is killed, and another
-is selected and run.
-
-If the value of this resource (and the applicable one of \fBcolorPrograms\fP
-or \fBmonoPrograms\fP) is empty, then no programs will be run; the screen
-will simply be made black.
-
-Note that you must escape the newlines; here is an example of how you
-might set this in your \fI.Xdefaults\fP file:
-.EX
-xscreensaver.programs: \\
- qix -root \\n\\
- ico -r -faces -sleep 1 -obj ico \\n\\
- xdaliclock -builtin2 -root \\n\\
- xwave -root
-.EE
-To use a program as a screensaver, two things are required: that that
-program draw on the root window (or be able to be configured to draw on
-the root window); and that that program understand ``virtual root''
-windows, as used by virtual window managers such as \fItvtwm\fP.
-
-It is quite easy to make programs understand virtual roots if they
-don't already: you merely need to include the file \fI"vroot.h"\fP in
-them after the standard X includes, and recompile. This file is distributed
-with X11r5, and is included with xscreensaver as well.
-.TP 8
-.B monoPrograms \fR(class \fBMonoPrograms\fP)
-This resource is appended to the value of the \fIprograms\fP resource if
-the display on which the screensaver is running is monochrome.
-.TP 8
-.B colorPrograms \fR(class \fBColorPrograms\fP)
-This resource is appended to the value of the \fIprograms\fP resource if
-the display on which the screensaver is running is not monochrome.
-.PP
-.RS 4
-\fBNOTE: this means that if you want to completely replace the list of
-programs which xscreensaver runs, you must set at least \fItwo\fP,
-possibly \fIthree\fP resources. It is not enough to just set
-the \fBprograms\fP resource -- you must also set \fBcolorPrograms\fP
-or \fBmonoPrograms\fP or both.\fP
-.RE
-.PP
-Normally you won't need to change the following resources:
-.TP 8
-.B bourneShell \fR(class \fBBourneShell\fP)
-The pathname of the shell that \fIxscreensaver\fP uses to start subprocesses.
-This must be whatever your local variant of \fB/bin/sh\fP is -- in particular,
-it must not be \fBcsh\fP.
-.TP 8
-.B windowCreationTimeout \fR(class \fBTime\fP)
-When server extensions are not in use, this controls the delay between when
-windows are created and when \fIxscreensaver\fP selects events on them.
-Default 30 seconds.
-.TP 8
-.B pointerPollTime \fR(class \fBTime\fP)
-When server extensions are not in use, this controls how
-frequently \fIxscreensaver\fP checks to see if the mouse position or buttons
-have changed. Default 5 seconds.
-.TP 8
-.B initialDelay \fR(class \fBTime\fP)
-When server extensions are not in use, \fIxscreensaver\fP will wait this many
-seconds before selecting events on existing windows, under the assumption that
-\fIxscreensaver\fP is started during your login procedure, and the window
-state may be in flux. Default 30 seconds.
-.SH "HOW IT WORKS"
-When it is time to activate the screensaver, a full-screen black window is
-created. This window is given the appropriate properties so that, to any
-subsequently-created programs, it will appear to be a ``virtual root''
-window. Because of this, any program which draws on the root window (and
-which understands virtual roots) can be used as a screensaver.
-.PP
-When the user becomes active again, the screensaver window is unmapped and
-the running subprocess is killed by sending it \fBSIGTERM\fP. This is also
-how the subprocesses are killed when the screensaver decides that it's time
-to run a different demo: the old one is killed and a new one is launched.
-.PP
-Before launching a subprocess, \fIxscreensaver\fP stores an appropriate value
-for \fB$DISPLAY\fP in the environment that the child will recieve. (This is
-so that if you start \fIxscreensaver\fP with a \fI-display\fP argument, the
-programs which \fIxscreensaver\fP launches will draw on the same display.)
-.PP
-When the screensaver turns off, or is killed, care is taken to restore
-the ``real'' virtual root window if there is one. Because of this, it is
-important that you not kill the screensaver process with \fIkill -9\fP if
-you are running a virtual-root window manager. If you kill it with \-9,
-you may need to restart your window manager to repair the damage. This
-isn't an issue if you aren't running a virtual-root window manager.
-.PP
-For all the gory details, see the commentary at the top of xscreensaver.c.
-.PP
-You can control a running screensaver process by using the
-.BR xscreensaver\-command (1)
-program (which see.)
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH USING XDM(1)
-You can run \fIxscreensaver\fP from your xdm session, so that the
-screensaver will run even when nobody is logged in on the console.
-Simply add \fB"xscreensaver &"\fP to your \fI/usr/lib/X11/xdm/Xsetup\fP
-file. Because \fIxdm\fP grabs the keyboard, keypresses will not make
-the screensaver deactivate, but any mouse activity will.
-.PP
-(If your system does not seem to be executing the \fIXsetup\fP file, you
-may need to configure it to do so -- the traditional way to do this is
-to make that file the value of the \fIDisplayManager*setup\fP resource
-in the \fIxdm-config\fP file. See the man page for
-.BR xdm (1)
-for more details.)
-.PP
-Users may want to add \fB"xscreensaver-command -restart"\fP to their
-startup scripts, so that the screensaver will be reinitialized with
-their private resource settings when they log in.
-.PP
-It is safe to run this program as root (as \fIxdm\fP is likely to do.) If
-run as root, \fIxscreensaver\fP changes its effective user and group ids to
-something safe (like \fI"nobody"\fP) before connecting to the X server
-or launching user-specified programs.
-.PP
-Locking doesn't work if the screensaver is launched by \fIxdm\fP. To get
-around this, you can run the screensaver from \fIxdm\fP without locking,
-and kill and restart it from your personal X startup script to enable
-locking.
-.SH DEMO MODE
-If \fIxscreensaver\fP receives the \fBDEMO\fP ClientMessage, it pops up
-a dialog box from which you can examine and experiment with the screensaver's
-client programs.
-.PP
-Clicking left on an element in the scrolling list will place the indicated
-program and its args in the text field to be edited. Edit the arguments and
-hit return to run the program with the parameters you have specified.
-.PP
-Double-clicking on an element in the scrolling list will run the indicated
-program immediately.
-.PP
-When a client program is launched, the dialog box is hidden. Clicking
-any mouse button will re-expose the dialog box (but will not kill the
-client program.)
-.TP 8
-.B Run Next
-Clicking this button will run the next program in the list after the
-currently-selected one, and will scroll around to the top when it reaches
-the bottom.
-.TP 8
-.B Run Previous
-Opposite of Run Next; at the top, it scrolls around to the bottom.
-.TP 8
-.B Edit Parameters
-This pops up a second dialog box, in which you have the option to
-interactively change most of the screensaver's operational parameters,
-such as its timeouts, and whether it should hack colormaps. Changing
-these parameters here will affect only the running \fIxscreensaver\fP
-process; to make the changes permanent, you need to edit your X resource
-file.
-.TP 8
-.B Exit Demo Mode
-Returns to normal screensaver operation.
-.TP 8
-.B Reinitialize
-Causes the screensaver process to exit and then restart with the same
-command-line arguments. This causes the X resource database to be
-re-read. This is just like the \fI\-restart\fP argument to
-.BR xscreensaver\-command (1)
-except that when executed from this button, the screensaver will
-automatically return to demo mode after restarting.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver\-command (1),
-.BR xlock (1),
-.BR xnlock (1),
-.BR xautolock (1),
-.BR xdm (1),
-.BR qix (1),
-.BR pyro (1),
-.BR helix (1),
-.BR rorschach (1),
-.BR hopalong (1),
-.BR attraction (1),
-.BR greynetic (1),
-.BR rocks (1),
-.BR noseguy (1),
-.BR blitspin (1),
-.BR imsmap (1),
-.BR slidescreen (1),
-.BR decayscreen (1),
-.BR hypercube (1),
-.BR flame (1),
-.BR bubbles (1),
-.BR maze (1),
-.BR ico (1),
-.BR xdaliclock (1),
-.BR xbouncebits (1),
-.BR xswarm (1),
-.BR xwave (1),
-.BR xfishtank (1)
-.SH BUGS
-If you think you have changed the \fBprograms\fP resource but the
-screensaver is ignoring it, you are confused -- you need to set
-the \fBcolorPrograms\fP and/or \fBmonoPrograms\fP resources as well.
-(This is not a bug, but I mention it here because people think that
-it is with great regularity.)
-.PP
-If you are not making use of one of the server extensions (\fBXIDLE\fP,
-\fBSCREEN_SAVER\fP, or \fBMIT-SCREEN-SAVER\fP), then it is possible, in rare
-situations, for \fIxscreensaver\fP to interfere with event propagation and make
-another X program malfunction. For this to occur, that other application
-would need to \fInot\fP select \fBKeyPress\fP events on its non-leaf windows
-within the first 30 seconds of their existence, but then select for them later.
-In this case, that client \fImight\fP fail to receive those events.
-This isn't very likely, since programs generally select a constant set
-of events immediately after creating their windows and then don't change
-them, but this is the reason that it's a good idea to install and use one
-of the server extensions instead, to work around this shortcoming in the
-X protocol.
-.PP
-Although this program ``nices'' the subprocesses that it starts,
-graphics-intensive subprograms can still overload the machine by causing
-the X server process itself (which is not ``niced'') to suck a lot of
-cycles. Care should be taken to slow down programs intended for use as
-screensavers by inserting strategic calls to
-.BR sleep (3)
-or
-.BR usleep (3)
-\.
-
-Also, it will cause your X server to be pretty much permanently swapped in.
-(but the same is true of any program that draws periodically, like xclock or
-xload.)
-.PP
-If the subprocess is drawing too quickly and the connection to the X
-server is a slow one (such as an X terminal running over a phone line) then
-the screensaver might not turn off right away when the user becomes active
-again (the
-.BR ico (1)
-demo has this problem if being run in full-speed mode). This can be
-alleviated by inserting strategic calls to
-.BR XSync (3)
-in code intended for use as a screensaver. This prevents too much graphics
-activity from being buffered up.
-.PP
-The screensaver only runs on the default screen of the display. If you have
-more than one screen, you can run multiple screensaver processes, one for
-each screen. This interacts poorly with locking. In an ideal world, the
-screensaver would save (and lock) both screens simultaniously, and any activity
-would restore both screens. It would be nice if one could run different hacks
-on each screen simultaniously. However, I don't have access to a multi-headed
-workstation, so it would be hard for me to implement something like this.
-.PP
-If you don't have Motif, you can't compile with support for locking or
-demo mode.
-.PP
-Locking doesn't work if the screensaver is launched by \fIxdm\fP.
-The reason for this is that when it is launched by \fIxdm\fP, the
-screensaver process is owned by some standard user id (such as \fIroot\fP
-or \fIdaemon\fP) instead of the user who is logged in on the console.
-In order for the screensaver to prompt for the password of the person
-who had logged in from \fIxdm\fP, it would need to know who that user was,
-and there is no reliable and safe way to figure that out. (And even if
-there was, there would be some other security issues here as well.)
-
-So if you want to use it as a locker, you must start it with your user id.
-If it has already been started by \fIxdm\fP, you can kill it with
-\fBxscreensaver-command -exit\fP, and then start it again as you.
-.PP
-If you get an error message like ``couldn't get password of foo'' then
-this probably means that you're on a system in which the
-.BR getpwent (3)
-library routine can only be effectively used by root. If this is the case,
-then \fIxscreensaver\fP must be installed as setuid to root. Care has
-been taken to make this a safe thing to do.
-.PP
-The \fBinstallColormap\fP option doesn't work very well with the
-.BR twm (1)
-window manager and its descendants. There is a race condition between the
-screensaver and this window manager, which can result in the screensaver's
-colormap not getting installed properly, meaning the graphics hacks will
-appear in essentially random colors. (If the screen goes white instead of
-black, this is probably why.) The
-.BR mwm (1)
-and
-.BR olwm (1)
-window managers don't seem to have this problem. The race condition exists
-because X apparently does not provide a way for an OverrideRedirect window to
-have its own colormap, short of grabbing the server (which is neither a good
-idea, nor really possible with the current design.) What happens is that, as
-soon as the screensaver installs its colormap, \fBtwm\fP responds to
-the \fBColormapNotify\fP event that is generated by re-instaling the default
-colormap. Apparently, \fBtwm\fP doesn't \fIalways\fP do this; it seems to do
-it regularly if the screensaver is activated from a menu item, but seems to
-not do it if the screensaver comes on of its own volition, or is activated
-from another console. Any thoughts on this problem are welcome...
-.PP
-Apparently there are some problems with ``XView'' programs getting confused
-and thinking that the screensaver window is the real root window even when
-the screensaver is not active: ClientMessages intended for the window manager
-are sent to the screensaver window instead. This could be solved by making
-xscreensaver forward all unrecognised ClientMessages to the real root window,
-but there may be other problems as well.
-.PP
-When using the \fBMIT-SCREEN-SAVER\fP extension in conjunction with
-the \fBfade\fP option, you may notice an unattractive flicker just before
-the fade begins. This is because the server maps a black window just before
-it tells the \fIxscreensaver\fP process to activate. The \fIxscreensaver\fP
-process immediately unmaps that window, but this results in a flicker. I
-haven't figured a way to get around this; it seems to be a fundamental
-property of the (mis-) design of this server extension.
-.PP
-There need to be a lot more graphics hacks. In particular, there should be
-a simulation of a Lavalite (tm).
-.SH UPGRADES
-The latest version can always be found at http://www.netscape.com/people/jwz/.
-There is also usually an up-to-date copy at ftp://ftp.x.org/.
-.SH COPYRIGHT
-Copyright \(co 1992, 1993, 1994, 1995, 1996 by Jamie Zawinski. Permission
-to use, copy, modify, distribute, and sell this software and its documentation
-for any purpose is hereby granted without fee, provided that the above
-copyright notice appear in all copies and that both that copyright notice
-and this permission notice appear in supporting documentation. No
-representations are made about the suitability of this software for any
-purpose. It is provided "as is" without express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
-Please let me know if you find any bugs or make any improvements.
-
-Thanks to David Wojtowicz for implementing \fIlockTimeout\fP.
-
-Thanks to Martin Kraemer for adding support for shadow passwords and
-locking-disabled diagnostics.
+++ /dev/null
-b exit
-b abort
-set args -geom =700x700+0+0
+++ /dev/null
-/*
- * Imakefile file for xscreensaver, Copyright (c) 1993, 1995 Jamie Zawinski.
- *
- * You should not need to edit this file; edit ../config.h instead.
- *
- */
-
-#include "../config.h"
-
-#ifdef HAVE_XPM
- /* Yeah, this means that all hacks link against libXpm even though only
- one hack actually uses it. It doesn't matter: it's a library. */
-# define XPMDEFS -DHAVE_XPM
-# define XPMLIB -lXpm
-#else
-# define XPMDEFS
-# define XPMLIB
-#endif
-
- STAR = *
- UTILS = ../utils
- INCLUDES = -I$(UTILS)
- DEFINES = R5ISMS XPMDEFS
-LOCAL_LIBRARIES = $(XMULIB) $(XTOOLLIB) XPMLIB $(EXTENSIONLIB) $(XLIB) -lm
- HACKS = attraction.c greynetic.c helix.c hopalong.c xroger-hack.c \
- noseguy.c pyro.c qix.c rocks.c rorschach.c blitspin.c \
- imsmap.c slidescreen.c decayscreen.c maze.c hypercube.c \
- halo.c flame.c pedal.c lmorph.c \
- bubbles.c bubbles.h bubbles_default.c
- MEN = attraction.man greynetic.man helix.man hopalong.man \
- noseguy.man pyro.man xroger.man qix.man rocks.man \
- rorschach.man blitspin.man imsmap.man slidescreen.man \
- decayscreen.man maze.man hypercube.man halo.man flame.man \
- pedal.man lmorph.man \
- bubbles.man bubbles.README
- TARFILES = README Imakefile screenhack.c $(HACKS) screenhack.h \
- vroot.h xlock.h default.xbm $(MEN) .gdbinit \
- noses/nose.$(STAR) \
- bubbles-tools/bubbles$(STAR) \
- bubbles-tools/xpm$(STAR) \
- bubbles-sources/$(STAR).pov \
- bubbles-samples/$(STAR).bub.gz
-
-all::
-
-echo_tarfiles:
- @echo $(TARFILES)
-
-#define ScreenhackTarget(p,ps,deps) @@\
-all:: p @@\
-p: deps screenhack.h ps.o $(DEPLIBS) @@\
- RemoveTargetProgram($@) @@\
- $(CCENVSETUP) \
- $(CC) -o $@ $(LDOPTIONS) deps ps.o $(LOCAL_LIBRARIES) $(LDLIBS) @@\
- @@\
-InstallProgram(p,$(BINDIR)) @@\
-InstallManPage(p,$(MANDIR)) @@\
-clean:: @@\
- $(RM) p
-
-HOBJS=screenhack.o $(UTILS)/resources.o $(UTILS)/visual.o \
- $(UTILS)/usleep.o $(UTILS)/yarandom.o
-
-ScreenhackTarget (qix, qix, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (helix, helix, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (pyro, pyro, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (attraction, attraction, $(HOBJS) $(UTILS)/hsv.o $(UTILS)/spline.o)
-ScreenhackTarget (rorschach, rorschach, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (hopalong, hopalong, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (xroger, xroger-hack, $(HOBJS) $(UTILS)/hsv.o $(UTILS)/xroger.o)
-ScreenhackTarget (rocks, rocks, $(HOBJS))
-ScreenhackTarget (noseguy, noseguy, $(HOBJS))
-ScreenhackTarget (blitspin, blitspin, $(HOBJS))
-ScreenhackTarget (greynetic, greynetic, $(HOBJS))
-ScreenhackTarget (slidescreen, slidescreen, $(HOBJS) $(UTILS)/grabscreen.o)
-ScreenhackTarget (decayscreen, decayscreen, $(HOBJS) $(UTILS)/grabscreen.o)
-ScreenhackTarget (imsmap, imsmap, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (maze, maze, $(HOBJS) $(UTILS)/xroger.o)
-ScreenhackTarget (hypercube, hypercube, $(HOBJS))
-ScreenhackTarget (halo, halo, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (flame, flame, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (pedal, pedal, $(HOBJS) $(UTILS)/hsv.o)
-ScreenhackTarget (lmorph, lmorph, $(HOBJS))
-ScreenhackTarget (bubbles, bubbles, bubbles_default.o $(HOBJS))
+++ /dev/null
-
-This directory contains various graphics hacks. These are independent from
-the xscreensaver program (in the ../driver/ directory) but some of them use
-the utility functions found in the ../utils/ directory.
-
-If you have compilation problems, check the parameters in ../config.h.
-
-The file xlock.h makes it really easy to turn `xlock' modules into standalone
-programs that can be used with xscreensaver; check it out.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* Simulation of a pair of quasi-gravitational fields, maybe sorta kinda
- a little like the strong and weak electromagnetic forces. Derived from
- a Lispm screensaver by John Pezaris <pz@mit.edu>. Mouse control and
- viscosity added by "Philip Edward Cutone, III" <pc2d+@andrew.cmu.edu>.
-
- John sez:
-
- The simulation started out as a purely accurate gravitational simulation,
- but, with constant simulation step size, I quickly realized the field being
- simulated while grossly gravitational was, in fact, non-conservative. It
- also had the rather annoying behavior of dealing very badly with colliding
- orbs. Therefore, I implemented a negative-gravity region (with two
- thresholds; as I read your code, you only implemented one) to prevent orbs
- from every coming too close together, and added a viscosity factor if the
- speed of any orb got too fast. This provides a nice stable system with
- interesting behavior.
-
- I had experimented with a number of fields including the van der Waals
- force (very interesting orbiting behavior) and 1/r^3 gravity (not as
- interesting as 1/r^2). An even normal viscosity (rather than the
- thresholded version to bleed excess energy) is also not interesting.
- The 1/r^2, -1/r^2, -10/r^2 thresholds proved not only robust but also
- interesting -- the orbs never collided and the threshold viscosity fixed
- the non-conservational problem.
-
- Philip sez:
- > An even normal viscosity (rather than the thresholded version to
- > bleed excess energy) is also not interesting.
-
- unless you make about 200 points.... set the viscosity to about .8
- and drag the mouse through it. it makes a nice wave which travels
- through the field.
- */
-
-#include <stdio.h>
-#include <math.h>
-#include "screenhack.h"
-#include "spline.h"
-
-struct ball {
- float x, y;
- float vx, vy;
- float dx, dy;
- float mass;
- int size;
- XColor color;
- int hue;
-};
-
-static unsigned int default_fg_pixel;
-static struct ball *balls;
-static int npoints;
-static int threshold;
-static int delay;
-static int global_size;
-static int segments;
-static Bool glow_p;
-static Bool orbit_p;
-static XPoint *point_stack;
-static int point_stack_size, point_stack_fp, pixel_stack_fp, pixel_stack_size;
-static unsigned long *pixel_stack;
-static unsigned int color_shift;
-
-/*flip mods for mouse interaction*/
-static Bool mouse_p;
-int mouse_x, mouse_y, mouse_mass, root_x, root_y;
-static float viscosity;
-
-static enum object_mode {
- ball_mode, line_mode, polygon_mode, spline_mode, spline_filled_mode,
- tail_mode
-} mode;
-
-static enum color_mode {
- cycle_mode, random_mode
-} cmode;
-
-static GC draw_gc, erase_gc;
-
-#define MAX_SIZE 16
-
-#define min(a,b) ((a)<(b)?(a):(b))
-#define max(a,b) ((a)>(b)?(a):(b))
-
-static void
-init_balls (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- XWindowAttributes xgwa;
- XGCValues gcv;
- int xlim, ylim, midx, midy, r, vx, vy;
- double th;
- Colormap cmap;
- char *mode_str;
- XGetWindowAttributes (dpy, window, &xgwa);
- xlim = xgwa.width;
- ylim = xgwa.height;
- cmap = xgwa.colormap;
- midx = xlim/2;
- midy = ylim/2;
- r = get_integer_resource ("radius", "Integer");
- if (r <= 0 || r > min (xlim/2, ylim/2))
- r = min (xlim/2, ylim/2) - 50;
- vx = get_integer_resource ("vx", "Integer");
- vy = get_integer_resource ("vy", "Integer");
- npoints = get_integer_resource ("points", "Integer");
- if (npoints < 1)
- npoints = 3 + (random () % 5);
- balls = (struct ball *) malloc (npoints * sizeof (struct ball));
- segments = get_integer_resource ("segments", "Integer");
- if (segments < 0) segments = 1;
- threshold = get_integer_resource ("threshold", "Integer");
- if (threshold < 0) threshold = 0;
- delay = get_integer_resource ("delay", "Integer");
- if (delay < 0) delay = 0;
- global_size = get_integer_resource ("size", "Integer");
- if (global_size < 0) global_size = 0;
- glow_p = get_boolean_resource ("glow", "Boolean");
- orbit_p = get_boolean_resource ("orbit", "Boolean");
- color_shift = get_integer_resource ("colorShift", "Integer");
- if (color_shift >= 360) color_shift = 5;
-
- /*flip mods for mouse interaction*/
- mouse_p = get_boolean_resource ("mouse", "Boolean");
- mouse_mass = get_integer_resource ("mouseSize", "Integer");
- mouse_mass = mouse_mass * mouse_mass *10;
-
- viscosity = get_float_resource ("viscosity", "Float");
-
- mode_str = get_string_resource ("mode", "Mode");
- if (! mode_str) mode = ball_mode;
- else if (!strcmp (mode_str, "balls")) mode = ball_mode;
- else if (!strcmp (mode_str, "lines")) mode = line_mode;
- else if (!strcmp (mode_str, "polygons")) mode = polygon_mode;
- else if (!strcmp (mode_str, "tails")) mode = tail_mode;
- else if (!strcmp (mode_str, "splines")) mode = spline_mode;
- else if (!strcmp (mode_str, "filled-splines")) mode = spline_filled_mode;
- else {
- fprintf (stderr,
- "%s: mode must be balls, lines, tails, polygons, splines, or\n\
- filled-splines, not \"%s\"\n",
- progname, mode_str);
- exit (1);
- }
-
- mode_str = get_string_resource ("colorMode", "ColorMode");
- if (! mode_str) cmode = cycle_mode;
- else if (!strcmp (mode_str, "cycle")) cmode = cycle_mode;
- else if (!strcmp (mode_str, "random")) cmode = random_mode;
- else {
- fprintf (stderr, "%s: colorMode must be cycle or random, not \"%s\"\n",
- progname, mode_str);
- exit (1);
- }
-
- if (mode != ball_mode && mode != tail_mode) glow_p = False;
-
- if (mode == polygon_mode && npoints < 3)
- mode = line_mode;
-
- if (mode != ball_mode)
- {
- int size = (segments ? segments : 1);
- point_stack_size = size * (npoints + 1);
- point_stack = (XPoint *) calloc (point_stack_size, sizeof (XPoint));
- point_stack_fp = 0;
- if (segments > 0)
- pixel_stack_size = segments;
- else
- pixel_stack_size = (360 / color_shift);
- pixel_stack = (unsigned long *)
- calloc (pixel_stack_size, sizeof (unsigned int));
- pixel_stack_fp = 0;
- }
-
- gcv.line_width = (mode == tail_mode
- ? (global_size ? global_size : (MAX_SIZE * 2 / 3))
- : 1);
- gcv.cap_style = (mode == tail_mode ? CapRound : CapButt);
-
- gcv.foreground = default_fg_pixel =
- get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- draw_gc = XCreateGC (dpy, window, GCForeground|GCLineWidth|GCCapStyle, &gcv);
- gcv.foreground = get_pixel_resource ("background", "Background", dpy, cmap);
- erase_gc = XCreateGC (dpy, window, GCForeground|GCLineWidth|GCCapStyle,&gcv);
-
- if (!mono_p && mode != ball_mode)
- for (i = 0; i < pixel_stack_size; i++)
- {
- XColor color;
- color.pixel = default_fg_pixel;
- XQueryColor (dpy, cmap, &color);
- if (!XAllocColor (dpy, cmap, &color)) abort ();
- pixel_stack [i] = color.pixel;
- }
-
-#define rand_size() min (MAX_SIZE, 8 + (random () % (MAX_SIZE - 9)))
-
- if (orbit_p && !global_size)
- /* To orbit, all objects must be the same mass, or the math gets
- really hairy... */
- global_size = rand_size ();
-
- th = frand (M_PI+M_PI);
- for (i = 0; i < npoints; i++)
- {
- int new_size = (global_size ? global_size : rand_size ());
- balls [i].dx = 0;
- balls [i].dy = 0;
- balls [i].size = new_size;
- balls [i].mass = (new_size * new_size * 10);
- balls [i].x = midx + r * cos (i * ((M_PI+M_PI) / npoints) + th);
- balls [i].y = midy + r * sin (i * ((M_PI+M_PI) / npoints) + th);
- if (! orbit_p)
- {
- balls [i].vx = vx ? vx : ((6.0 - (random () % 11)) / 8.0);
- balls [i].vy = vy ? vy : ((6.0 - (random () % 11)) / 8.0);
- }
- balls [i].color.pixel = default_fg_pixel;
- balls [i].color.flags = DoRed | DoGreen | DoBlue;
- if (!mono_p)
- {
- if (i != 0 && (glow_p || mode != ball_mode))
- balls [i].hue = balls [0].hue;
- else
- balls [i].hue = random () % 360;
- hsv_to_rgb (balls [i].hue, 1.0, 1.0,
- &balls [i].color.red, &balls [i].color.green,
- &balls [i].color.blue);
- if (!XAllocColor (dpy, cmap, &balls [i].color))
- mono_p = True; /* just give up */
- }
- }
-
- if (orbit_p)
- {
- double a = 0;
- double v;
- double v_mult = get_float_resource ("vMult", "Float");
- if (v_mult == 0.0) v_mult = 1.0;
-
- for (i = 1; i < npoints; i++)
- {
- double _2ipi_n = (2 * i * M_PI / npoints);
- double x = r * cos (_2ipi_n);
- double y = r * sin (_2ipi_n);
- double distx = r - x;
- double dist2 = (distx * distx) + (y * y);
- double dist = sqrt (dist2);
- double a1 = ((balls[i].mass / dist2) *
- ((dist < threshold) ? -1.0 : 1.0) *
- (distx / dist));
- a += a1;
- }
- if (a < 0.0)
- {
- fprintf (stderr, "%s: domain error: forces on balls too great\n",
- progname);
- exit (-1);
- }
- v = sqrt (a * r) * v_mult;
- for (i = 0; i < npoints; i++)
- {
- double k = ((2 * i * M_PI / npoints) + th);
- balls [i].vx = -v * sin (k);
- balls [i].vy = v * cos (k);
- }
- }
-
- if (mono_p) glow_p = False;
- XClearWindow (dpy, window);
-}
-
-static void
-compute_force (i, dx_ret, dy_ret)
- int i;
- float *dx_ret, *dy_ret;
-{
- int j;
- float x_dist, y_dist, dist, dist2;
- *dx_ret = 0;
- *dy_ret = 0;
- for (j = 0; j < npoints; j++)
- {
- float x_dist, y_dist, dist, dist2;
-
- if (i == j) continue;
- x_dist = balls [j].x - balls [i].x;
- y_dist = balls [j].y - balls [i].y;
- dist2 = (x_dist * x_dist) + (y_dist * y_dist);
- dist = sqrt (dist2);
-
- if (dist > 0.1) /* the balls are not overlapping */
- {
- float new_acc = ((balls[j].mass / dist2) *
- ((dist < threshold) ? -1.0 : 1.0));
- float new_acc_dist = new_acc / dist;
- *dx_ret += new_acc_dist * x_dist;
- *dy_ret += new_acc_dist * y_dist;
- }
- else
- { /* the balls are overlapping; move randomly */
- *dx_ret += (frand (10.0) - 5.0);
- *dy_ret += (frand (10.0) - 5.0);
- }
- }
-
- if (mouse_p)
- {
- x_dist = mouse_x - balls [i].x;
- y_dist = mouse_y - balls [i].y;
- dist2 = (x_dist * x_dist) + (y_dist * y_dist);
- dist = sqrt (dist2);
-
- if (dist > 0.1) /* the balls are not overlapping */
- {
- float new_acc = ((mouse_mass / dist2) *
- ((dist < threshold) ? -1.0 : 1.0));
- float new_acc_dist = new_acc / dist;
- *dx_ret += new_acc_dist * x_dist;
- *dy_ret += new_acc_dist * y_dist;
- }
- else
- { /* the balls are overlapping; move randomly */
- *dx_ret += (frand (10.0) - 5.0);
- *dy_ret += (frand (10.0) - 5.0);
- }
- }
-}
-
-static void
-run_balls (dpy, window)
- Display *dpy;
- Window window;
-{
- int last_point_stack_fp = point_stack_fp;
- static int tick = 500, xlim, ylim;
- static Colormap cmap;
- int i;
-
- /*flip mods for mouse interaction*/
- Window root1, child1;
- int mask;
- if (mouse_p)
- {
- XQueryPointer(dpy, window, &root1, &child1,
- &root_x, &root_y, &mouse_x, &mouse_y, &mask);
- }
-
- if (tick++ == 500)
- {
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- tick = 0;
- xlim = xgwa.width;
- ylim = xgwa.height;
- cmap = xgwa.colormap;
- }
-
- /* compute the force of attraction/repulsion among all balls */
- for (i = 0; i < npoints; i++)
- compute_force (i, &balls[i].dx, &balls[i].dy);
-
- /* move the balls according to the forces now in effect */
- for (i = 0; i < npoints; i++)
- {
- float old_x = balls[i].x;
- float old_y = balls[i].y;
- float new_x, new_y;
- int size = balls[i].size;
- balls[i].vx += balls[i].dx;
- balls[i].vy += balls[i].dy;
-
- /* don't let them get too fast: impose a terminal velocity
- (actually, make the medium have friction) */
- if (balls[i].vx > 10)
- {
- balls[i].vx *= 0.9;
- balls[i].dx = 0;
- }
- else if (viscosity != 1)
- {
- balls[i].vx *= viscosity;
- }
-
- if (balls[i].vy > 10)
- {
- balls[i].vy *= 0.9;
- balls[i].dy = 0;
- }
- else if (viscosity != 1)
- {
- balls[i].vy *= viscosity;
- }
-
- balls[i].x += balls[i].vx;
- balls[i].y += balls[i].vy;
-
- /* bounce off the walls */
- if (balls[i].x >= (xlim - balls[i].size))
- {
- balls[i].x = (xlim - balls[i].size - 1);
- if (balls[i].vx > 0)
- balls[i].vx = -balls[i].vx;
- }
- if (balls[i].y >= (ylim - balls[i].size))
- {
- balls[i].y = (ylim - balls[i].size - 1);
- if (balls[i].vy > 0)
- balls[i].vy = -balls[i].vy;
- }
- if (balls[i].x <= 0)
- {
- balls[i].x = 0;
- if (balls[i].vx < 0)
- balls[i].vx = -balls[i].vx;
- }
- if (balls[i].y <= 0)
- {
- balls[i].y = 0;
- if (balls[i].vy < 0)
- balls[i].vy = -balls[i].vy;
- }
-
- new_x = balls[i].x;
- new_y = balls[i].y;
-
- /* make color saturation be related to particle acceleration. */
- if (glow_p)
- {
- float limit = 0.5;
- double s, v, fraction;
- float vx = balls [i].dx;
- float vy = balls [i].dy;
- XColor new_color;
- if (vx < 0) vx = -vx;
- if (vy < 0) vy = -vy;
- fraction = vx + vy;
- if (fraction > limit) fraction = limit;
-
- s = 1 - (fraction / limit);
- v = 1.0;
-
- s = (s * 0.75) + 0.25;
-
- hsv_to_rgb (balls [i].hue, s, v,
- &new_color.red, &new_color.green, &new_color.blue);
- if (XAllocColor (dpy, cmap, &new_color))
- {
- XFreeColors (dpy, cmap, &balls [i].color.pixel, 1, 0);
- balls [i].color = new_color;
- }
- }
-
- if (mode == ball_mode)
- {
- if (!mono_p)
- XSetForeground (dpy, draw_gc, balls [i].color.pixel);
- XFillArc (dpy, window, erase_gc, (int) old_x, (int) old_y,
- size, size, 0, 360*64);
- XFillArc (dpy, window, draw_gc, (int) new_x, (int) new_y,
- size, size, 0, 360*64);
- }
- if (mode != ball_mode)
- {
- point_stack [point_stack_fp].x = new_x;
- point_stack [point_stack_fp].y = new_y;
- point_stack_fp++;
- }
- }
-
- /* draw the lines or polygons after computing all points */
- if (mode != ball_mode)
- {
- point_stack [point_stack_fp].x = balls [0].x; /* close the polygon */
- point_stack [point_stack_fp].y = balls [0].y;
- point_stack_fp++;
- if (point_stack_fp == point_stack_size)
- point_stack_fp = 0;
- else if (point_stack_fp > point_stack_size) /* better be aligned */
- abort ();
- if (!mono_p)
- {
- XColor color2, desired;
- color2 = balls [0].color;
- switch (cmode)
- {
- case cycle_mode:
- cycle_hue (&color2, color_shift);
- break;
- case random_mode:
- color2.red = random () % 65535;
- color2.green = random () % 65535;
- color2.blue = random () % 65535;
- break;
- default:
- abort ();
- }
-
- desired = color2;
- if (XAllocColor (dpy, cmap, &color2))
- {
- /* XAllocColor returns the actual RGB that the hardware let us
- allocate. Restore the requested values into the XColor struct
- so that limited-resolution hardware doesn't cause cycle_hue to
- get "stuck". */
- color2.red = desired.red;
- color2.green = desired.green;
- color2.blue = desired.blue;
- }
- else
- {
- color2 = balls [0].color;
- if (!XAllocColor (dpy, cmap, &balls [0].color))
- abort ();
- }
- pixel_stack [pixel_stack_fp++] = balls [0].color.pixel;
- if (pixel_stack_fp >= pixel_stack_size)
- pixel_stack_fp = 0;
- XFreeColors (dpy, cmap, pixel_stack + pixel_stack_fp, 1, 0);
- balls [0].color = color2;
- XSetForeground (dpy, draw_gc, balls [0].color.pixel);
- }
- }
-
- switch (mode)
- {
- case ball_mode:
- break;
- case line_mode:
- if (segments > 0)
- XDrawLines (dpy, window, erase_gc, point_stack + point_stack_fp,
- npoints + 1, CoordModeOrigin);
- XDrawLines (dpy, window, draw_gc, point_stack + last_point_stack_fp,
- npoints + 1, CoordModeOrigin);
- break;
- case polygon_mode:
- if (segments > 0)
- XFillPolygon (dpy, window, erase_gc, point_stack + point_stack_fp,
- npoints + 1, (npoints == 3 ? Convex : Complex),
- CoordModeOrigin);
- XFillPolygon (dpy, window, draw_gc, point_stack + last_point_stack_fp,
- npoints + 1, (npoints == 3 ? Convex : Complex),
- CoordModeOrigin);
- break;
- case tail_mode:
- {
- int i;
- for (i = 0; i < npoints; i++)
- {
- int index = point_stack_fp + i;
- int next_index = (index + (npoints + 1)) % point_stack_size;
- XDrawLine (dpy, window, erase_gc,
- point_stack [index].x,
- point_stack [index].y,
- point_stack [next_index].x,
- point_stack [next_index].y);
-
- index = last_point_stack_fp + i;
- next_index = (index - (npoints + 1)) % point_stack_size;
- if (next_index < 0) next_index += point_stack_size;
- if (point_stack [next_index].x == 0 &&
- point_stack [next_index].y == 0)
- continue;
- XDrawLine (dpy, window, draw_gc,
- point_stack [index].x,
- point_stack [index].y,
- point_stack [next_index].x,
- point_stack [next_index].y);
- }
- }
- break;
- case spline_mode:
- case spline_filled_mode:
- {
- int i;
- static spline *s = 0;
- if (! s) s = make_spline (npoints);
- if (segments > 0)
- {
- for (i = 0; i < npoints; i++)
- {
- s->control_x [i] = point_stack [point_stack_fp + i].x;
- s->control_y [i] = point_stack [point_stack_fp + i].y;
- }
- compute_closed_spline (s);
- if (mode == spline_filled_mode)
- XFillPolygon (dpy, window, erase_gc, s->points, s->n_points,
- (s->n_points == 3 ? Convex : Complex),
- CoordModeOrigin);
- else
- XDrawLines (dpy, window, erase_gc, s->points, s->n_points,
- CoordModeOrigin);
- }
- for (i = 0; i < npoints; i++)
- {
- s->control_x [i] = point_stack [last_point_stack_fp + i].x;
- s->control_y [i] = point_stack [last_point_stack_fp + i].y;
- }
- compute_closed_spline (s);
- if (mode == spline_filled_mode)
- XFillPolygon (dpy, window, draw_gc, s->points, s->n_points,
- (s->n_points == 3 ? Convex : Complex),
- CoordModeOrigin);
- else
- XDrawLines (dpy, window, draw_gc, s->points, s->n_points,
- CoordModeOrigin);
- }
- break;
- default:
- abort ();
- }
-
- XSync (dpy, True);
-}
-
-\f
-char *progclass = "Attraction";
-
-char *defaults [] = {
- "Attraction.background: black", /* to placate SGI */
- "Attraction.foreground: white",
- "*mode: balls",
- "*points: 0",
- "*size: 0",
- "*threshold: 100",
- "*delay: 10000",
- "*glow: false",
- "*mouseSize: 10",
- "*mouse: false",
- "*viscosity: 1",
- "*orbit: false",
- "*colorShift: 3",
- "*segments: 100",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-mode", ".mode", XrmoptionSepArg, 0 },
- { "-points", ".points", XrmoptionSepArg, 0 },
- { "-threshold", ".threshold", XrmoptionSepArg, 0 },
- { "-segments", ".segments", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-size", ".size", XrmoptionSepArg, 0 },
- { "-color-mode", ".colorMode", XrmoptionSepArg, 0 },
- { "-color-shift", ".colorShift", XrmoptionSepArg, 0 },
- { "-radius", ".radius", XrmoptionSepArg, 0 },
- { "-vx", ".vx", XrmoptionSepArg, 0 },
- { "-vy", ".vy", XrmoptionSepArg, 0 },
- { "-vmult", ".vMult", XrmoptionSepArg, 0 },
- { "-mouse-size", ".mouseSize", XrmoptionSepArg, 0 },
- { "-mouse", ".mouse", XrmoptionNoArg, "true" },
- { "-nomouse", ".mouse", XrmoptionNoArg, "false" },
- { "-viscosity", ".viscosity", XrmoptionSepArg, 0 },
- { "-glow", ".glow", XrmoptionNoArg, "true" },
- { "-noglow", ".glow", XrmoptionNoArg, "false" },
- { "-orbit", ".orbit", XrmoptionNoArg, "true" }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_balls (dpy, window);
- while (1)
- {
- run_balls (dpy, window);
- if (delay) usleep (delay);
- }
-}
+++ /dev/null
-.de EX \"Begin example
-.ne 5
-.if n .sp 1
-.if t .sp .5
-.nf
-.in +.5i
-..
-.de EE
-.fi
-.in -.5i
-.if n .sp 1
-.if t .sp .5
-..
-.TH XScreenSaver 1 "14-Dec-95" "X Version 11"
-.SH NAME
-attraction - interactions of opposing forces
-.SH SYNOPSIS
-.B attraction
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-points \fIint\fP] [\-threshold \fIint\fP] [\-mode balls | lines | polygons | splines | filled-splines | tails ] [\-color-mode cycle | random] [\-size \fIint\fP] [\-segments \fIint\fP] [\-delay \fIusecs\fP] [\-color-shift \fIdegrees\fP] [\-radius \fIint\fP] [\-vx \fIint\fP] [\-vy \fIint\fP] [\-glow] [\-noglow] [\-orbit] [\-viscosity \fIfloat\fP] [\-mouse] [\-no-mouse] [\-mouse-size]
-.SH DESCRIPTION
-The \fIattraction\fP program has several visually different modes of
-operation, all of which are based on the interactions of a set of control
-points which attract each other up to a certain distance, and then begin
-to repel each other. The attraction/repulsion is proportional to the
-distance between any two particles.
-.SH OPTIONS
-.I attraction
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-points integer
-How many control points should be used, or 0 to select the number randomly.
-Default 0. Between 3 and 15 works best.
-.TP 8
-.B \-threshold integer
-The distance (in pixels) from each particle at which the attractive force
-becomes repulsive. Default 100.
-.TP 8
-.B \-mode "balls | lines | polygons | tails | splines | filled-splines"
-In \fIballs\fP mode (the default) the control points are drawn as filled
-circles. The larger the circle, the more massive the particle.
-
-In \fIlines\fP mode, the control points are connected by straight lines;
-the effect is something like \fIqix\fP.
-
-In \fIpolygons\fP mode, the control points are connected by straight
-lines, and filled in. This is most interesting in color.
-
-In \fIsplines\fP mode, a closed spline is interpolated from the control
-points.
-
-In \fIfilled-splines\fP mode, the splines are filled in instead of being
-outlines. This is most interesting in color.
-
-In \fItails\fP mode, the path which each particle follows is indicated
-by a worm-like trail, whose length is controlled by the \fIsegments\fP
-parameter.
-.TP 8
-.B \-color-mode cycle | random
-Whether colors should cycle through the spectrum, or be picked randomly.
-.TP 8
-.B \-size integer
-The size of the balls in pixels, or 0, meaning to select the sizes
-randomly (the default.) If this is specified, then all balls will be
-the same size. This option has an effect in all modes, since the ``size''
-of the balls controls their mass.
-.TP 8
-.B \-segments integer
-If in \fIlines\fP or \fIpolygons\fP mode, how many sets of line segments
-or polygons should be drawn. Default 100. This has no effect in \fIballs\fP
-mode. If \fIsegments\fP is 0, then no segments will ever be erased (this
-is only useful in color.)
-.TP 8
-.B \-delay microseconds
-How much of a delay should be introduced between steps of the animation.
-Default 10000, or about 0.01 seconds.
-.TP 8
-.B \-color-shift degrees
-If on a color display, the color of the line segments or polygons will
-cycle through the spectrum. This specifies how far the hue of each segment
-should be from the next, in degrees on the HSV wheel. Default 3.
-This has no effect in \fIballs\fP mode.
-.TP 8
-.B \-radius
-The size in pixels of the circle on which the points are initially positioned.
-The default is slightly smaller than the size of the window.
-.TP 8
-.B \-glow
-This is consulted only in \fIballs\fP mode. If this is specified, then
-the saturation of the colors of the points will vary according to their
-current acceleration. This has the effect that the balls flare brighter
-when they are reacting to each other most strongly.
-
-In \fIglow\fP mode, all of the balls will be drawn the same (random)
-color, modulo the saturation shifts. In non-glow mode, the balls will
-each be drawn in a random color that doesn't change.
-.TP 8
-.B \-noglow
-Don't do ``glowing.'' This is the default.
-.TP 8
-.B \-vx pixels
-.TP 8
-.B \-vy pixels
-Initial velocity of the balls. This has no effect in \fB\-orbit\fP mode.
-.TP 8
-.B \-orbit
-Make the initial force on each ball be tangential to the circle on which
-they are initially placed, with the right velocity to hold them in orbit
-about each other. After a while, roundoff errors will cause the orbit
-to decay.
-.TP 8
-.B \-vmult float
-In orbit mode, the initial velocity of the balls is multiplied by this;
-a number less than 1 will make the balls pull closer together, and a larger
-number will make them move apart. The default is 1, meaning stability.
-.TP 8
-.B \-viscosity float
-This sets the viscosity of the hypothetical fluid through which the control
-points move; the default is 1, meaning no resistance. Values higher than 1
-aren't interesting; lower values cause less motion.
-
-One interesting thing to try is
-.EX
-attraction -viscosity 0.8 -points 75 \\
- -mouse -geometry =500x500
-.EE
-Give it a few seconds to settle down into a stable clump, and then move
-the mouse through it to make "waves".
-.TP 8
-.B \-mouse
-This will cause the mouse to be considered a control point; it will not be
-drawn, but it will influence the other points, so you can wave the mouse
-and influence the images being created.
-.TP 8
-.B \-no-mouse
-Turns off \fB\-mouse\fP.
-.TP 8
-.B \-mouse-size integer
-In \fB\-mouse\fP mode, this sets the mass of the mouse (analagously to the
-\fB\-size\fP parameter.)
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992, 1993 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
-
-Viscosity and mouse support by Philip Edward Cutone, III.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* Rotate a bitmap using using bitblts.
- The bitmap must be square, and must be a power of 2 in size.
- This was translated from SmallTalk code which appeared in the
- August 1981 issue of Byte magazine.
-
- The input bitmap may be non-square, it is padded and centered
- with the background color. Another way would be to subdivide
- the bitmap into square components and rotate them independently
- (and preferably in parallel), but I don't think that would be as
- interesting looking.
-
- It's too bad almost nothing uses blitter hardware these days,
- or this might actually win.
- */
-
-#include "screenhack.h"
-#include <stdio.h>
-
-#ifdef HAVE_XPM
-# include <X11/xpm.h>
-# ifndef PIXEL_ALREADY_TYPEDEFED
-# define PIXEL_ALREADY_TYPEDEFED /* Sigh, Xmu/Drawing.h needs this... */
-# endif
-#endif
-
-#include <X11/Xmu/Drawing.h>
-
-#include "default.xbm"
-
-static Display *dpy;
-static Window window;
-static unsigned int size;
-static Pixmap self, temp, mask;
-static GC SET, CLR, CPY, IOR, AND, XOR;
-static GC gc;
-static int delay, delay2;
-static Pixmap bitmap;
-static int depth;
-static unsigned int fg, bg;
-
-static void rotate(), init (), display ();
-
-#define copy_all_to(from, xoff, yoff, to, gc) \
- XCopyArea (dpy, (from), (to), (gc), 0, 0, \
- size-(xoff), size-(yoff), (xoff), (yoff))
-
-#define copy_all_from(to, xoff, yoff, from, gc) \
- XCopyArea (dpy, (from), (to), (gc), (xoff), (yoff), \
- size-(xoff), size-(yoff), 0, 0)
-
-static void
-rotate ()
-{
- int qwad; /* fuckin' C, man... who needs namespaces? */
- XFillRectangle (dpy, mask, CLR, 0, 0, size, size);
- XFillRectangle (dpy, mask, SET, 0, 0, size>>1, size>>1);
- for (qwad = size>>1; qwad > 0; qwad>>=1)
- {
- if (delay) usleep (delay);
- copy_all_to (mask, 0, 0, temp, CPY); /* 1 */
- copy_all_to (mask, 0, qwad, temp, IOR); /* 2 */
- copy_all_to (self, 0, 0, temp, AND); /* 3 */
- copy_all_to (temp, 0, 0, self, XOR); /* 4 */
- copy_all_from (temp, qwad, 0, self, XOR); /* 5 */
- copy_all_from (self, qwad, 0, self, IOR); /* 6 */
- copy_all_to (temp, qwad, 0, self, XOR); /* 7 */
- copy_all_to (self, 0, 0, temp, CPY); /* 8 */
- copy_all_from (temp, qwad, qwad, self, XOR); /* 9 */
- copy_all_to (mask, 0, 0, temp, AND); /* A */
- copy_all_to (temp, 0, 0, self, XOR); /* B */
- copy_all_to (temp, qwad, qwad, self, XOR); /* C */
- copy_all_from (mask, qwad>>1, qwad>>1, mask, AND); /* D */
- copy_all_to (mask, qwad, 0, mask, IOR); /* E */
- copy_all_to (mask, 0, qwad, mask, IOR); /* F */
- display (self);
- }
-}
-
-static void
-read_bitmap (bitmap_name, widthP, heightP)
- char *bitmap_name;
- int *widthP, *heightP;
-{
-#ifdef HAVE_XPM
- XpmAttributes xpmattrs;
- int result;
- xpmattrs.valuemask = 0;
- bitmap = 0;
-
-#ifdef XpmCloseness
- xpmattrs.valuemask |= XpmCloseness;
- xpmattrs.closeness = 40000;
-#endif
-
- result = XpmReadFileToPixmap (dpy, window, bitmap_name, &bitmap, 0,
- &xpmattrs);
- switch (result)
- {
- case XpmColorError:
- fprintf (stderr, "%s: warning: xpm color substitution performed\n",
- progname);
- /* fall through */
- case XpmSuccess:
- *widthP = xpmattrs.width;
- *heightP = xpmattrs.height;
- break;
- case XpmFileInvalid:
- case XpmOpenFailed:
- bitmap = 0;
- break;
- case XpmColorFailed:
- fprintf (stderr, "%s: xpm: color allocation failed\n", progname);
- exit (-1);
- case XpmNoMemory:
- fprintf (stderr, "%s: xpm: out of memory\n", progname);
- exit (-1);
- default:
- fprintf (stderr, "%s: xpm: unknown error code %d\n", progname, result);
- exit (-1);
- }
- if (! bitmap)
-#endif
- {
- int xh, yh;
- Pixmap b2;
- bitmap = XmuLocateBitmapFile (DefaultScreenOfDisplay (dpy), bitmap_name,
- 0, 0, widthP, heightP, &xh, &yh);
- if (! bitmap)
- {
- fprintf (stderr, "%s: couldn't find bitmap %s\n", progname,
- bitmap_name);
- exit (1);
- }
- b2 = XmuCreatePixmapFromBitmap (dpy, window, bitmap, *widthP, *heightP,
- depth, fg, bg);
- XFreePixmap (dpy, bitmap);
- bitmap = b2;
- }
-}
-
-static void
-init ()
-{
- XWindowAttributes xgwa;
- Colormap cmap;
- XGCValues gcv;
- int width, height;
- unsigned int real_size;
- char *bitmap_name;
- int i;
-
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- depth = xgwa.depth;
-
- fg = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- bg = get_pixel_resource ("background", "Background", dpy, cmap);
- delay = get_integer_resource ("delay", "Integer");
- delay2 = get_integer_resource ("delay2", "Integer");
- if (delay < 0) delay = 0;
- if (delay2 < 0) delay2 = 0;
- bitmap_name = get_string_resource ("bitmap", "Bitmap");
- if (! bitmap_name || !*bitmap_name)
- bitmap_name = "(default)";
-
- if (!strcmp (bitmap_name, "(default)"))
- {
- width = logo_width;
- height = logo_height;
- bitmap = XCreatePixmapFromBitmapData (dpy, window, (char *) logo_bits,
- width, height, fg, bg, depth);
- }
- else
- {
- read_bitmap (bitmap_name, &width, &height);
- }
-
- real_size = (width > height) ? width : height;
-
- size = real_size;
- /* semi-sleazy way of doing (setq size (expt 2 (ceiling (log size 2)))). */
- for (i = 31; i > 0; i--)
- if (size & (1<<i)) break;
- if (size & (~(1<<i)))
- size = (size>>i)<<(i+1);
- self = XCreatePixmap (dpy, window, size, size, depth);
- temp = XCreatePixmap (dpy, window, size, size, depth);
- mask = XCreatePixmap (dpy, window, size, size, depth);
- gcv.foreground = (depth == 1 ? 1 : (~0));
- gcv.function=GXset; SET = XCreateGC(dpy,self,GCFunction|GCForeground,&gcv);
- gcv.function=GXclear;CLR = XCreateGC(dpy,self,GCFunction|GCForeground,&gcv);
- gcv.function=GXcopy; CPY = XCreateGC(dpy,self,GCFunction|GCForeground,&gcv);
- gcv.function=GXor; IOR = XCreateGC(dpy,self,GCFunction|GCForeground,&gcv);
- gcv.function=GXand; AND = XCreateGC(dpy,self,GCFunction|GCForeground,&gcv);
- gcv.function=GXxor; XOR = XCreateGC(dpy,self,GCFunction|GCForeground,&gcv);
-
- gcv.foreground = gcv.background = bg;
- gc = XCreateGC (dpy, window, GCForeground|GCBackground, &gcv);
- /* Clear self to the background color (not to 0, which CLR does.) */
- XFillRectangle (dpy, self, gc, 0, 0, size, size);
- XSetForeground (dpy, gc, fg);
-
- XCopyArea (dpy, bitmap, self, CPY, 0, 0, width, height,
- (size - width)>>1, (size - height)>>1);
-}
-
-static void
-display (pixmap)
- Pixmap pixmap;
-{
- XWindowAttributes xgwa;
- static int last_w = 0, last_h = 0;
- XGetWindowAttributes (dpy, window, &xgwa);
- if (xgwa.width != last_w || xgwa.height != last_h)
- {
- XClearWindow (dpy, window);
- last_w = xgwa.width;
- last_h = xgwa.height;
- }
-#ifdef HAVE_XPM
- if (depth != 1)
- XCopyArea (dpy, pixmap, window, gc, 0, 0, size, size,
- (xgwa.width-size)>>1, (xgwa.height-size)>>1);
- else
-#endif
- XCopyPlane (dpy, pixmap, window, gc, 0, 0, size, size,
- (xgwa.width-size)>>1, (xgwa.height-size)>>1, 1);
-/*
- XDrawRectangle (dpy, window, gc,
- ((xgwa.width-size)>>1)-1, ((xgwa.height-size)>>1)-1,
- size+2, size+2);
-*/
- XSync (dpy, True);
-}
-
-\f
-char *progclass = "BlitSpin";
-
-char *defaults [] = {
- "BlitSpin.background: black", /* to placate SGI */
- "BlitSpin.foreground: white",
- "*delay: 500000",
- "*delay2: 500000",
- "*bitmap: (default)",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-delay2", ".delay2", XrmoptionSepArg, 0 },
- { "-bitmap", ".bitmap", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (d, w)
- Display *d;
- Window w;
-{
- dpy = d;
- window = w;
- init ();
- while (1)
- {
- rotate ();
- if (delay2) usleep (delay2);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "17-aug-92" "X Version 11"
-.SH NAME
-blitspin - rotate a bitmap in an interesting way
-.SH SYNOPSIS
-.B blitspin
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-bitmap \fIfilename\fP] [\-delay \fIusecs\fP] [\-delay2 \fIusecs\fP]
-.SH DESCRIPTION
-The \fIblitspin\fP program repeatedly rotates a bitmap by 90 degrees by
-using logical operations: the bitmap is divided into quadrants, and the
-quadrants are shifted clockwise. Then the same thing is done again with
-progressively smaller quadrants, except that all sub-quadrants of a
-given size are rotated in parallel. So this takes \fBO(16*log2(N))\fP
-blits of size NxN, with the limitation that the image must be square,
-and the size must be a power of 2.
-.SH OPTIONS
-.I blitspin
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-bitmap \fIfilename\fP
-The file name of a bitmap to rotate. It need not be square: it
-will be padded with the background color. If unspecified or the
-string \fI(default)\fP, a builtin bitmap is used.
-
-If support for the \fIXPM\fP library was enabled at compile-time,
-the specified file may be in \fIXPM\fP format as well as \fIXBM\fP, and
-thus may be a color image.
-
-The \fB*bitmapFilePath\fP resource will be searched if the bitmap
-name is not a fully-qualified pathname.
-.PP
-.TP 8
-.B \-delay microseconds
-How long to delay between steps of the rotation process, in microseconds.
-Default is 500000, one-half second.
-.PP
-.TP 8
-.B \-delay2 microseconds
-How long to delay between each 90-degree rotation, in microseconds.
-Default is 500000, one-half second.
-.B DISPLAY
-to get the default host and display number.
-.SH ENVIRONMENT
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992, 1993 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 17-aug-92.
-
-Based on SmallTalk code which appeared in the August 1981 issue of Byte
-magazine.
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Blood_Marble
- scale <2, 2, 2>
- rotate <0, 20, 0> }
- finish { Dull }
-}
-
-light_source {<6, 1, 0> color White}
-/* light_source {<6.1, 1, 0> color White} */
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Blue_Agate
- scale <0.7, 0.7, 0.7> }
- finish { phong 1 }
-}
-
-light_source {<6, 1, 0> color White}
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Glass
- scale <0.7, 0.7, 0.7>
- rotate y*clock
- normal {bumps 0.4 scale 0.1}
- finish { Shiny }
-# finish { phong 0.4 }
- }
-}
-
-light_source {<6, 7, 0> color White}
-light_source {<6.1, 1, 0> color Blue}
+++ /dev/null
-#include "colors.inc"
-#include "shapes.inc"
-#include "textures.inc"
-
-/* The following make the field of view as wide as it is high
- * Thus, you should have the -W and -H command line options
- * equal to each other. */
-camera {
- location <5.8, 0, 0>
- up <0, 1, 0>
- right <1, 0, 0>
- look_at <0, 0, 0>
-}
-
-sphere {
- <0,0,0>, 2.5
- texture { Jade
- scale <0.7, 0.7, 0.7>
- rotate y*clock }
- finish { phong 0.4 }
-}
-
-light_source {<6, 1, 0> color White}
-light_source {<6.1, 1, 0> color White}
+++ /dev/null
-#!/usr/bin/perl
-#
-# $Id: bubblestodefault,v 1.1 1996/09/08 01:35:51 jwz Exp $
-#
-#----------------------------------------------------------------------------
-# Copyright (C) 1995-1996 James Macnicol
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by the
-# Free Software Foundation; either version 2, or (at your option) any later
-# version.
-#
-# This program is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
-# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# for more details.
-#-----------------------------------------------------------------------------
-#
-# Contact me (J.Macnicol@student.anu.edu.au) if you have problems.
-#
-# [ The moral of this story is use a version of rm which safely backs up
-# files when you delete them in case you do something stupid like
-# "rm * xpm" which trashed all the scripts in this directory so I had
-# to write them again. Grrrrrr..... ]
-#
-#-----------------------------------------------------------------------------
-#
-# This script takes a set of XPM files (from povbubbles, for example)
-# whose names are listed in file with extension .names (of same format
-# as output by povbubbles) and puts them together into a file which can
-# be used in place of the source file bubbles_default.c which comes with
-# bubbles/xscreensaver.
-#
-# To use it, provide as an argument the base-name of the .names file,
-# i.e. if you ran povbubbles on the file foo.pov by typing "povbubbles foo"
-# then this created a file "foo.names" so you can now make a new
-# bubbles_default.c by typing "bubblestodefault foo".
-#
-
-sub die_help {
- print STDERR "Usage: $0 [-help] base-name\n";
- print STDERR " -help gives this message.\n";
- print STDERR " base-name is the name of the file used to generate\n";
- print STDERR " the XPM files, e.g. if you invoked povbubbles with\n";
- print STDERR " \"povbubbles foo\"\n";
- print STDERR " then you should invoke $0 with\n";
- die(" \"$0 foo\"\n");
-}
-
-sub die_usage {
- die "Usage: $0 [-help] base-name\n";
-}
-
-$infile = undef;
-
-# Process command line arguments
-while ($op = shift) {
- if ($op eq "-help") {
- &die_help;
- } else {
- $infile = $op;
- # Ignore further arguments
- break;
- }
-}
-if ($infile eq undef) {
- &die_usage;
-}
-
-$namesfile = $infile . ".names";
-
-if (! -f $namesfile) {
- die("File list $namesfile doesn't exist\n");
-}
-
-if (-f "bubbles_default.c") {
- print "Backing up bubbles_default.c...\n";
- system("mv -f bubbles_default.c bubbles_default.c.bak");
-}
-
-open(OUT, ">bubbles_default.c") || die("Couldn't open bubbles_default.c\n");
-print OUT "#include <stdio.h>\n";
-print OUT "#include \"bubbles.h\"\n";
-print OUT "\n";
-print OUT "#ifndef NO_DEFAULT_BUBBLE\n";
-print OUT "\n";
-
-open(NAMES, $namesfile) || die ("Couldn't open $namesfile\n");
-$numbubbles = 0;
-while (<NAMES>) {
- if (/\s*(\S+)\:(\S+)\s*/) {
- $filename = $1;
- $xpmname = $2;
- $xpmlist = $xpmlist . $xpmname . ", ";
- open(CAT, $filename) || die("Couldn't open file $filename listed in\
-$namesfile\n");
- while (<CAT>) {
- print OUT;
- }
- close(CAT);
- $numbubbles++;
- } else {
- print STDERR "Can't understand the line \"$_\"\n";
- print STDERR " in $namesfile. Ignoring...\n";
- }
-}
-print OUT "char **default_bubbles[] = {$xpmlist";
-print OUT "(char **)0};\n";
-print OUT "\n";
-print OUT "int num_default_bubbles = $numbubbles;\n";
-print OUT "\n";
-print OUT "#endif /* NO_DEFAULT_BUBBLE */\n";
-
-close(NAMES);
-close(OUT);
+++ /dev/null
-#!/usr/bin/perl
-#
-# $Id: bubblestofile,v 1.1 1996/09/08 01:35:52 jwz Exp $
-#
-#----------------------------------------------------------------------------
-# Copyright (C) 1995-1996 James Macnicol
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by the
-# Free Software Foundation; either version 2, or (at your option) any later
-# version.
-#
-# This program is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
-# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# for more details.
-#-----------------------------------------------------------------------------
-#
-# Contact me (J.Macnicol@student.anu.edu.au) if you have problems.
-#
-# [ The moral of this story is use a version of rm which safely backs up
-# files when you delete them in case you do something stupid like
-# "rm * xpm" which trashed all the scripts in this directory so I had
-# to write them again. Grrrrrr..... ]
-#
-#-----------------------------------------------------------------------------
-#
-# This script takes a set of XPM files (from povbubbles, for example)
-# whose names are listed in file with extension .names (of same format
-# as output by povbubbles) and puts them together into a file which can
-# loaded with the -file option or place in a directory suitable for
-# use with the -directory option to bubbles. Note that neither of these
-# options are available if you have just compiled bubbles as provided.
-# You must edit bubbles.h to enable these. Files generated by this script
-# have by default the extension ".bub".
-#
-# To use it, provide as an argument the base-name of the .names file,
-# i.e. if you ran povbubbles on the file foo.pov by typing "povbubbles foo"
-# then this created a file "foo.names" so you can now make the loadable file
-# "foo.bub" by typing "bubblestofile foo".
-#
-
-sub die_help {
- print STDERR "Usage: $0 [-help] base-name\n";
- print STDERR " -help\n";
- print STDERR " gives this message.\n";
- print STDERR " base-name is the name of the file used to generate\n";
- print STDERR " the XPM files, e.g. if you invoked povbubbles with\n";
- print STDERR " \"povbubbles foo\"\n";
- print STDERR " then you should invoke $0 with\n";
- die(" \"$0 foo\"\n");
-}
-
-sub die_usage {
- die "Usage: $0 [-help] base-name\n";
-}
-
-$infile = undef;
-
-# Process command line arguments
-while ($op = shift) {
- if ($op eq "-help") {
- &die_help;
- } else {
- $infile = $op;
- # Ignore further arguments
- break;
- }
-}
-if ($infile eq undef) {
- &die_usage;
-}
-
-$namesfile = $infile . ".names";
-$outfile = $infile . ".bub";
-
-if (! -f $namesfile) {
- die("File list $namesfile doesn't exist\n");
-}
-
-if (-f $outfile) {
- print "Backing up $outfile\n";
- system("mv -f $outfile $outfile.bak");
-}
-
-open(OUT, ">$outfile") || die("Couldn't open $outfile\n");
-open(NAMES, $namesfile) || die ("Couldn't open $namesfile\n");
-$numbubbles = 0;
-while (<NAMES>) {
- if (/\s*(\S+)\:(\S+)\s*/) {
- $filename = $1;
- $xpmname = $2;
- open(CAT, $filename) || die("Couldn't open file $filename listed in\
-$namesfile\n");
- while (<CAT>) {
- print OUT;
- }
- close(CAT);
- } else {
- print STDERR "Can't understand the line \"$_\"\n";
- print STDERR " in $namesfile. Ignoring...\n";
- }
-}
-close(NAMES);
-close(OUT);
-
-
+++ /dev/null
-#!/usr/bin/perl
-#----------------------------------------------------------------------------
-# Copyright (C) 1995-1996 James Macnicol
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by the
-# Free Software Foundation; either version 1, or (at your option) any later
-# version.
-#
-# This program is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
-# or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# for more details.
-#-----------------------------------------------------------------------------
-#
-# Prints to the stdout a file suitable for use as bubbles_default.c for the
-# bubbles screensaver (i.e. the default bubble which is compiled into the
-# executable). A list of XPMs is expected as input, e.g. output from the
-# pov2xpm script in this directory.
-#
-# Remember to change the path to your perl executable at the top of the
-# script if it is wrong.
-#
-# Examples of usage:
-#
-# pov2xpm sample.pov | xpm2default > bubbles_default.c
-#
-# A new set of bubbles is first created with pov2xpm then passed to this
-# script which places the C wrapper around the data and finally dumps the
-# output into bubbles_default.c.
-#
-# xpm2default < sample.xpm > bubbles_default.c
-#
-# Same as the previous example except the XPM data came from a file rather
-# than a pipe.
-#
-$numargs = @ARGV;
-print "#include \"bubbles.h\"\n";
-print "\n";
-print "#ifndef NO_DEFAULT_BUBBLE\n";
-print "\n";
-print "char *default_ball_data[] = {\n";
-while (<STDIN>) {
- chop;
- s/"/\\"/g;
- print "\"$_\",\n";
-}
-print "(char *)0\n";
-print "};\n";
-print "\n";
-print "#endif\n";
+++ /dev/null
-First of all, you should read and possibly change the options in
-bubbles.h. Things should work without you having to change anything.
-
-Most of the stuff below is of no use to you if you do not have the
-XPM library and thus cannot use rendered bubbles. The same goes for
-monochrome displays, whether you have XPM or not.
-
-The most interesting #define here is BUBBLES_IO. If this is set then
-the -file and -directory options become available to you, which means
-that you can use bubbles with the program other than just the one that
-is used by default (see below). The problem is that there is code in
-the routines that implement this which arenot portable across the
-various flavours of UNIX. Therefore, this #define is not set out of
-the box. Chances are that it will work for you fine, however. I have
-personally seen it work under Linux 1.3.x and Solaris 2.x. IRIX has
-problems, from what I hear. If you do need to hack the code in order
-to get these features to work, please send e-mail to the address at
-the bottom of this file and detail your changes. They will be
-incorporated in a future release.
-
-If you are compiling with the XPM library you have the option of
-putting in or leaving out a "default" bubble in your binary, i.e. if
-no -file or -directory options are specified on the command line then
-this bubble will be used. Things are setup to include this by
-default, so that people can happily run the program without there
-being any compulsory options. If you use very large bubbles or are
-low on memory you might like to take the option of not compiling in
-the default bubble and thus saving some space should you wish to use
-more than one bubble (to make life more interesting, or whatever).
-This can be done by removing the comments around #define
-NO_DEFAULT_BUBBLE in bubbles.h.
-
-If you are hacking the bubbles code then you might like to switch on
-extra checks and messages with the DEBUG flag in bubbles.h, but
-otherwise you can leave it commented out. The sanity checks enables
-there will slow things down.
-
-There are also some configuration options to help you compile and run
-bubbles properly. These are explained in bubbles.h. All changes
-affecting portability will end up in here. If you need to change
-anything to get bubbles to compile on your system, please tell me what
-they are.
-
-Apart from the source files, there are also some other directories
-here which contain things you might use if loading bubbles at runtime
-or developing new ones :
-
-
-bubbles-tools/
- Contains several perl scripts to help you make new
-sets of bubbles easily. povbubbles runs povray on a scene description
-file and outputs a series of XPM files which you can then postprocess
-if need be. To turn these files into a new instance of the default
-bubble source file bubbles_default.c, use the script bubblestodefault.
-To put all the files together into a single file which can be loaded
-with the -file or -directory options (if available), use the script
-bubblestofile.
-
- Read the comments at the top of each script to find out more.
-
-bubbles-samples/
- This directory contains some compressed bubbles
-files which can be used with the -directory option (or the -file
-option on individual files there). The files will be automatically
-uncompressed before use.
-
-bubbles-sources/
- The povray sources used to make some of the bubbles
-in the bubbles-samples directory. You can use these as templates for
-making new bubbles.
-
-
-I'm not much good with povray so the examples are probably pretty
-boring. If you make some nice bubbles yourself, I'd like to see them.
-Send your _sources_ to J.Macnicol@student.anu.edu.au (please don't
-fill my inbox with XPM files, there is a limit on the amount of
-waiting e-mail I can have).
-
-
-Enjoy.
-
-
---
-James Macnicol
-e-mail: J.Macnicol@student.anu.edu.au
-http://goblet.anu.edu.au/~m9305357/home.html
+++ /dev/null
-/* bubbles.c - frying pan / soft drink in a glass simulation */
-
-/*$Id: bubbles.c,v 1.1 1996/09/08 01:35:40 jwz Exp $*/
-
-/*
- * Copyright (C) 1995-1996 James Macnicol
- *
- * This program is free software; you can redistribute it and/or modify
- * it under the terms of the GNU General Public License as published by the
- * Free Software Foundation; either version 2, or (at your option) any later
- * version.
- *
- * This program is distributed in the hope that it will be useful, but
- * WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTIBILITY
- * or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * for more details.
- */
-
-/*
- * I got my original inspiration for this by looking at the bottom of a
- * frying pan while something was cooking and watching the little bubbles
- * coming off the bottom of the pan as the oil was boiling joining together
- * to form bigger bubbles and finally to *pop* and disappear. I had some
- * time on my hands so I wrote this little xscreensaver module to imitate
- * it. Now that it's done it reminds me more of the bubbles you get in
- * a glass of fizzy soft drink.....
- *
- * The problem seemed to be that the position/size etc. of all the bubbles
- * on the screen had to be remembered and searched through to find when
- * bubbles hit each other and combined. To do this more efficiently, the
- * window/screen is divided up into a square mesh of side length mesh_length
- * and separate lists of bubbles contained in each cell of the mesh are
- * kept. Only the cells in the immediate vicinity of the bubble in question
- * are searched. This should make things more efficient although the whole
- * thing seems to use up too much CPU, but then I'm using an ancient PC so
- * perhaps it's not surprising .
- * (Six months after I wrote the above I now have a Pentium with PCI graphics
- * and things are _much_ nicer.)
- *
- * Author: James Macnicol
- * Internet E-mail : J.Macnicol@student.anu.edu.au
- */
-
-#include "bubbles.h"
-
-#ifdef BUBBLES_IO
-#include <dirent.h>
-#include <fcntl.h>
-#include <sys/types.h>
-#endif /* BUBBLES_IO */
-
-#include <limits.h>
-#include <math.h>
-#include <signal.h>
-#include <stdio.h>
-#include <stdlib.h>
-#include <string.h>
-#include <sys/wait.h>
-#include <unistd.h>
-#include "screenhack.h"
-#include "../utils/yarandom.h"
-
-#ifdef HAVE_XPM
-#include <X11/xpm.h>
-#endif
-
-/*
- * Public variables
- */
-
-#ifndef NO_DEFAULT_BUBBLE
-extern int num_default_bubbles;
-extern char **default_bubbles[];
-#endif /* NO_DEFAULT_BUBBLE */
-
-char *progclass = "Bubbles";
-
-char *defaults [] = {
- "*background: black",
- "*foreground: white",
- "*simple: false",
- "*broken: false",
- "*delay: 2000",
-#ifdef BUBBLES_IO
- "*file: (default)",
- "*directory: (default)",
-#endif /* BUBBLES_IO */
- "*quiet: false",
- "*nodelay: false",
- "*3D: false",
- "*geometry: 400x300",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-simple", ".simple", XrmoptionNoArg, "true" },
-#ifdef HAVE_XPM
- { "-broken", ".broken", XrmoptionNoArg, "true" },
-#endif /* HAVE_XPM */
- { "-quiet", ".quiet", XrmoptionNoArg, "true" },
- { "-nodelay", ".nodelay", XrmoptionNoArg, "true" },
- { "-3D", ".3D", XrmoptionNoArg, "true" },
-#ifdef BUBBLES_IO
- { "-file", ".file", XrmoptionSepArg, 0 },
- { "-directory", ".directory", XrmoptionSepArg, 0 },
-#endif /* BUBBLES_IO */
- { "-delay", ".delay", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-/*
- * Private variables
- */
-
-static Bubble **mesh;
-static int mesh_length;
-static int mesh_width;
-static int mesh_height;
-static int mesh_cells;
-
-static int **adjacent_list;
-
-static int screen_width;
-static int screen_height;
-static int screen_depth;
-static unsigned int default_fg_pixel, default_bg_pixel;
-/*
- * I know it's not elegant to save this stuff in global variables
- * but we need it for the signal handler.
- */
-static Display *defdsp;
-static Window defwin;
-static Colormap defcmap;
-
-/* For simple mode only */
-static int bubble_min_radius;
-static int bubble_max_radius;
-static long *bubble_areas;
-static GC draw_gc, erase_gc;
-
-#ifdef HAVE_XPM
-static int num_bubble_pixmaps;
-static Bubble_Step **step_pixmaps;
-#ifdef BUBBLES_IO
-static char *pixmap_file;
-#endif /* BUBBLES_IO */
-static int use_default_bubble;
-#endif /* HAVE_XPM */
-
-/* Options stuff */
-#ifdef HAVE_XPM
-static Bool simple = False;
-#else
-static Bool simple = True;
-#endif
-static Bool broken = False;
-static Bool quiet = False;
-static Bool threed = False;
-static int delay;
-
-/*
- * To prevent forward references, some stuff is up here
- */
-
-static long
-calc_bubble_area(r)
- int r;
-/* Calculate the area of a bubble of radius r */
-{
-#ifdef DEBUG
- printf("%d %g\n", r,
- 10.0 * PI * (double)r * (double)r * (double)r);
-#endif /* DEBUG */
- if (threed)
- return (long)(10.0 * PI * (double)r * (double)r * (double)r);
- else
- return (long)(10.0 * PI * (double)r * (double)r);
-}
-
-static void *
-xmalloc(size)
- size_t size;
-/* Safe malloc */
-{
- void *ret;
-
- if ((ret = malloc(size)) == NULL) {
- fprintf(stderr, "%s: out of memory\n", progname);
- exit(1);
- }
- return ret;
-}
-
-#ifdef DEBUG
-static void
-die_bad_bubble(bb)
- Bubble *bb;
-/* This is for use with GDB */
-{
- fprintf(stderr, "Bad bubble detected at 0x%x!\n", (int)bb);
- exit(1);
-}
-#endif
-
-static int
-null_bubble(bb)
- Bubble *bb;
-/* Returns true if the pointer passed is NULL. If not then this checks to
-see if the bubble is valid (i.e. the (x,y) position is valid and the magic
-number is set correctly. This only a sanity check for debugging and is
-turned off if DEBUG isn't set. */
-{
- if (bb == (Bubble *)NULL)
- return 1;
-#ifdef DEBUG
- if ((bb->cell_index < 0) || (bb->cell_index > mesh_cells)) {
- fprintf(stderr, "cell_index = %d\n", bb->cell_index);
- die_bad_bubble(bb);
- }
- if (bb->magic != BUBBLE_MAGIC) {
- fprintf(stderr, "Magic = %d\n", bb->magic);
- die_bad_bubble(bb);
- }
- if (simple) {
- if ((bb->x < 0) || (bb->x > screen_width) ||
- (bb->y < 0) || (bb->y > screen_height) ||
- (bb->radius < bubble_min_radius) || (bb->radius >
- bubble_max_radius)) {
- fprintf(stderr,
- "radius = %d, x = %d, y = %d, magic = %d, \
-cell index = %d\n", bb->radius, bb->x, bb->y, bb->magic, bb->cell_index);
- die_bad_bubble(bb);
- }
-#ifdef HAVE_XPM
- } else {
- if ((bb->x < 0) || (bb->x > screen_width) ||
- (bb->y < 0) || (bb->y > screen_height) ||
- (bb->radius < step_pixmaps[0]->radius) ||
- (bb->radius > step_pixmaps[num_bubble_pixmaps-1]->radius)) {
- fprintf(stderr,
- "radius = %d, x = %d, y = %d, magic = %d, \
-cell index = %d\n", bb->radius, bb->x, bb->y, bb->magic, bb->cell_index);
- die_bad_bubble(bb);
- }
-#endif /* HAVE_XPM */
- }
-#endif /* DEBUG */
- return 0;
-}
-
-#ifdef DEBUG
-static void
-print_bubble_list(bb)
- Bubble *bb;
-/* Print list of where all the bubbles are. For debugging purposes only. */
-{
- if (! null_bubble(bb)) {
- printf(" (%d, %d) %d\n", bb->x, bb->y, bb->radius);
- print_bubble_list(bb->next);
- }
-}
-#endif /* DEBUG */
-
-static void
-add_bubble_to_list(list, bb)
- Bubble **list;
- Bubble *bb;
-/* Take a pointer to a list of bubbles and stick bb at the head of the
- list. */
-{
- Bubble *head = *list;
-
- if (null_bubble(head)) {
- bb->prev = (Bubble *)NULL;
- bb->next = (Bubble *)NULL;
- } else {
- bb->next = head;
- bb->prev = (Bubble *)NULL;
- head->prev = bb;
- }
- *list = bb;
-}
-
-
-/*
- * Mesh stuff
- */
-
-
-static void
-init_mesh()
-/* Setup the mesh of bubbles */
-{
- int i;
-
- mesh = (Bubble **)xmalloc(mesh_cells * sizeof(Bubble *));
- for (i = 0; i < mesh_cells; i++)
- mesh[i] = (Bubble *)NULL;
-}
-
-static int
-cell_to_mesh(x, y)
- int x;
- int y;
-/* convert cell coordinates to mesh index */
-{
-#ifdef DEBUG
- if ((x < 0) || (y < 0)) {
- fprintf(stderr, "cell_to_mesh: x = %d, y = %d\n", x, y);
- exit(1);
- }
-#endif
- return ((mesh_width * y) + x);
-}
-
-static void
-mesh_to_cell(mi, cx, cy)
- int mi;
- int *cx;
- int *cy;
-/* convert mesh index into cell coordinates */
-{
- *cx = mi % mesh_width;
- *cy = mi / mesh_width;
-}
-
-static int
-pixel_to_mesh(x, y)
- int x;
- int y;
-/* convert screen coordinates into mesh index */
-{
- return cell_to_mesh((x / mesh_length), (y / mesh_length));
-}
-
-static int
-verify_mesh_index(x, y)
- int x;
- int y;
-/* check to see if (x,y) is in the mesh */
-{
- if ((x < 0) || (y < 0) || (x >= mesh_width) || (y >= mesh_height))
- return (-1);
- return (cell_to_mesh(x, y));
-}
-
-#ifdef DEBUG
-static void
-print_adjacents(adj)
- int *adj;
-/* Print a list of the cells calculated above. For debugging only. */
-{
- int i;
-
- printf("(");
- for (i = 0; i < 8; i++)
- printf("%d ", adj[i]);
- printf(")\n");
-}
-#endif /* DEBUG */
-
-static void
-add_to_mesh(bb)
- Bubble *bb;
-/* Add the given bubble to the mesh by sticking it on the front of the
-list. bb is already allocated so no need to malloc() anything, just
-adjust pointers. */
-{
-#ifdef DEBUG
- if (null_bubble(bb)) {
- fprintf(stderr, "Bad bubble passed to add_to_mesh()!\n");
- exit(1);
- }
-#endif /* DEBUG */
-
- add_bubble_to_list(&mesh[bb->cell_index], bb);
-}
-
-#ifdef DEBUG
-static void
-print_mesh()
-/* Print the contents of the mesh */
-{
- int i;
-
- for (i = 0; i < mesh_cells; i++) {
- if (! null_bubble(mesh[i])) {
- printf("Mesh cell %d\n", i);
- print_bubble_list(mesh[i]);
- }
- }
-}
-
-static void
-valid_mesh()
-/* Check to see if the mesh is Okay. For debugging only. */
-{
- int i;
- Bubble *b;
-
- for (i = 0; i < mesh_cells; i++) {
- b = mesh[i];
- while (! null_bubble(b))
- b = b->next;
- }
-}
-
-static int
-total_bubbles()
-/* Count how many bubbles there are in total. For debugging only. */
-{
- int rv = 0;
- int i;
- Bubble *b;
-
- for (i = 0; i < mesh_cells; i++) {
- b = mesh[i];
- while (! null_bubble(b)) {
- rv++;
- b = b->next;
- }
- }
-
- return rv;
-}
-#endif /* DEBUG */
-
-static void
-calculate_adjacent_list()
-/* Calculate the list of cells adjacent to a particular cell for use
- later. */
-{
- int i;
- int ix, iy;
-
- adjacent_list = (int **)xmalloc(mesh_cells * sizeof(int *));
- for (i = 0; i < mesh_cells; i++) {
- adjacent_list[i] = (int *)xmalloc(9 * sizeof(int));
- mesh_to_cell(i, &ix, &iy);
- adjacent_list[i][0] = verify_mesh_index(--ix, --iy);
- adjacent_list[i][1] = verify_mesh_index(++ix, iy);
- adjacent_list[i][2] = verify_mesh_index(++ix, iy);
- adjacent_list[i][3] = verify_mesh_index(ix, ++iy);
- adjacent_list[i][4] = verify_mesh_index(ix, ++iy);
- adjacent_list[i][5] = verify_mesh_index(--ix, iy);
- adjacent_list[i][6] = verify_mesh_index(--ix, iy);
- adjacent_list[i][7] = verify_mesh_index(ix, --iy);
- adjacent_list[i][8] = i;
- }
-}
-
-static void
-adjust_areas()
-/* Adjust areas of bubbles so we don't get overflow in weighted_mean() */
-{
- double maxvalue;
- long maxarea;
- long factor;
- int i;
-
-#ifdef HAVE_XPM
- if (simple)
- maxarea = bubble_areas[bubble_max_radius+1];
- else
- maxarea = step_pixmaps[num_bubble_pixmaps]->area;
-#else
- maxarea = bubble_areas[bubble_max_radius+1];
-#endif /* HAVE_XPM */
- maxvalue = (double)screen_width * 2.0 * (double)maxarea;
- factor = (long)ceil(maxvalue / (double)LONG_MAX);
- if (factor > 1) {
- /* Overflow will occur in weighted_mean(). We must divide areas
- each by factor so it will never do so. */
-#ifdef HAVE_XPM
- if (simple) {
- for (i = bubble_min_radius; i <= bubble_max_radius+1; i++) {
- bubble_areas[i] /= factor;
- if (bubble_areas[i] == 0)
- bubble_areas[i] = 1;
- }
- } else {
- for (i = 0; i <= num_bubble_pixmaps; i++) {
-#ifdef DEBUG
- printf("area = %ld", step_pixmaps[i]->area);
-#endif /* DEBUG */
- step_pixmaps[i]->area /= factor;
- if (step_pixmaps[i]->area == 0)
- step_pixmaps[i]->area = 1;
-#ifdef DEBUG
- printf("-> %ld\n", step_pixmaps[i]->area);
-#endif /* DEBUG */
- }
- }
-#else
- for (i = bubble_min_radius; i <= bubble_max_radius+1; i++) {
- bubble_areas[i] /= factor;
- if (bubble_areas[i] == 0)
- bubble_areas[i] = 1;
- }
-#endif /* HAVE_XPM */
- }
-#ifdef DEBUG
- printf("maxarea = %ld\n", maxarea);
- printf("maxvalue = %g\n", maxvalue);
- printf("LONG_MAX = %ld\n", LONG_MAX);
- printf("factor = %ld\n", factor);
-#endif /* DEBUG */
-}
-
-/*
- * Bubbles stuff
- */
-
-static Bubble *
-new_bubble()
-/* Add a new bubble at some random position on the screen of the smallest
-size. */
-{
- Bubble *rv = (Bubble *)xmalloc(sizeof(Bubble));
-
- /* Can't use null_bubble() here since magic number hasn't been set */
- if (rv == (Bubble *)NULL) {
- fprintf(stderr, "Ran out of memory!\n");
- exit(1);
- }
-
- if (simple) {
- rv->radius = bubble_min_radius;
- rv->area = bubble_areas[bubble_min_radius];
-#ifdef HAVE_XPM
- } else {
- rv->step = 0;
- rv->radius = step_pixmaps[0]->radius;
- rv->area = step_pixmaps[0]->area;
-#endif /* HAVE_XPM */
- }
- rv->visible = 0;
- rv->magic = BUBBLE_MAGIC;
- rv->x = ya_random() % screen_width;
- rv->y = ya_random() % screen_height;
- rv->cell_index = pixel_to_mesh(rv->x, rv->y);
-
- return rv;
-}
-
-static void
-show_bubble(bb)
- Bubble *bb;
-/* paint the bubble on the screen */
-{
- if (null_bubble(bb)) {
- fprintf(stderr, "NULL bubble passed to show_bubble\n");
- exit(1);
- }
-
- if (! bb->visible) {
- bb->visible = 1;
-
- if (simple) {
- XDrawArc(defdsp, defwin, draw_gc, (bb->x - bb->radius),
- (bb->y - bb->radius), bb->radius*2, bb->radius*2, 0,
- 360*64);
- } else {
-#ifdef HAVE_XPM
- XSetClipOrigin(defdsp, step_pixmaps[bb->step]->draw_gc,
- (bb->x - bb->radius),
- (bb->y - bb->radius));
-
- XCopyArea(defdsp, step_pixmaps[bb->step]->ball, defwin,
- step_pixmaps[bb->step]->draw_gc,
- 0, 0, (bb->radius * 2),
- (bb->radius * 2),
- (bb->x - bb->radius),
- (bb->y - bb->radius));
-#endif /* HAVE_XPM */
- }
- }
-}
-
-static void
-hide_bubble(bb)
- Bubble *bb;
-/* erase the bubble */
-{
- if (null_bubble(bb)) {
- fprintf(stderr, "NULL bubble passed to hide_bubble\n");
- exit(1);
- }
-
- if (bb->visible) {
- bb->visible = 0;
-
- if (simple) {
- XDrawArc(defdsp, defwin, erase_gc, (bb->x - bb->radius),
- (bb->y - bb->radius), bb->radius*2, bb->radius*2, 0,
- 360*64);
- } else {
-#ifdef HAVE_XPM
- if (! broken) {
- XSetClipOrigin(defdsp, step_pixmaps[bb->step]->erase_gc,
- (bb->x - bb->radius), (bb->y - bb->radius));
-
- XFillRectangle(defdsp, defwin, step_pixmaps[bb->step]->erase_gc,
- (bb->x - bb->radius),
- (bb->y - bb->radius),
- (bb->radius * 2),
- (bb->radius * 2));
- }
-#endif /* HAVE_XPM */
- }
- }
-}
-
-static void
-delete_bubble_in_mesh(bb, keep_bubble)
- Bubble *bb;
- int keep_bubble;
-/* Delete an individual bubble, adjusting list of bubbles around it.
- If keep_bubble is true then the bubble isn't actually deleted. We
- use this to allow bubbles to change mesh cells without reallocating,
- (it needs this when two bubbles collide and the centre position is
- recalculated, and this may stray over a mesh boundary). */
-{
- if ((!null_bubble(bb->prev)) && (!null_bubble(bb->next))) {
- bb->prev->next = bb->next;
- bb->next->prev = bb->prev;
- } else if ((!null_bubble(bb->prev)) &&
- (null_bubble(bb->next))) {
- bb->prev->next = (Bubble *)NULL;
- bb->next = mesh[bb->cell_index];
- } else if ((null_bubble(bb->prev)) &&
- (!null_bubble(bb->next))) {
- bb->next->prev = (Bubble *)NULL;
- mesh[bb->cell_index] = bb->next;
- bb->next = mesh[bb->cell_index];
- } else {
- /* Only item on list */
- mesh[bb->cell_index] = (Bubble *)NULL;
- }
- if (! keep_bubble)
- free(bb);
-}
-
-static unsigned long
-ulongsqrint(x)
- int x;
-/* Saves ugly inline code */
-{
- return ((unsigned long)x * (unsigned long)x);
-}
-
-static Bubble *
-get_closest_bubble(bb)
- Bubble *bb;
-/* Find the closest bubble touching the this bubble, NULL if none are
- touching. */
-{
- Bubble *rv = (Bubble *)NULL;
- Bubble *tmp;
- unsigned long separation2, touchdist2;
- int dx, dy;
- unsigned long closest2 = ULONG_MAX;
- int i;
-
-#ifdef DEBUG
- if (null_bubble(bb)) {
- fprintf(stderr, "NULL pointer 0x%x passed to get_closest_bubble()!",
- (int)bb);
- exit(1);
- }
-#endif /* DEBUG */
-
- for (i = 0; i < 9; i++) {
- /* There is a bug here where bb->cell_index is negaitve.. */
-#ifdef DEBUG
- if ((bb->cell_index < 0) || (bb->cell_index >= mesh_cells)) {
- fprintf(stderr, "bb->cell_index = %d\n", bb->cell_index);
- exit(1);
- }
-#endif /* DEBUG */
-/* printf("%d,", bb->cell_index); */
- if (adjacent_list[bb->cell_index][i] != -1) {
- tmp = mesh[adjacent_list[bb->cell_index][i]];
- while (! null_bubble(tmp)) {
- if (tmp != bb) {
- dx = tmp->x - bb->x;
- dy = tmp->y - bb->y;
- separation2 = ulongsqrint(dx) + ulongsqrint(dy);
- /* Add extra leeway so circles _never_ overlap */
- touchdist2 = ulongsqrint(tmp->radius + bb->radius + 2);
- if ((separation2 <= touchdist2) && (separation2 <
- closest2)) {
- rv = tmp;
- closest2 = separation2;
- }
- }
- tmp = tmp->next;
- }
- }
- }
-
- return rv;
-}
-
-#ifdef DEBUG
-static void
-ldr_barf()
-{
-}
-#endif /* DEBUG */
-
-static long
-long_div_round(num, dem)
- long num;
- long dem;
-{
- long divvie, moddo;
-
-#ifdef DEBUG
- if ((num < 0) || (dem < 0)) {
- fprintf(stderr, "long_div_round: %ld, %ld\n", num, dem);
- ldr_barf();
- exit(1);
- }
-#endif /* DEBUG */
-
- divvie = num / dem;
- moddo = num % dem;
- if (moddo > (dem / 2))
- ++divvie;
-
-#ifdef DEBUG
- if ((divvie < 0) || (moddo < 0)) {
- fprintf(stderr, "long_div_round: %ld, %ld\n", divvie, moddo);
- ldr_barf();
- exit(1);
- }
-#endif /* DEBUG */
-
- return divvie;
-}
-
-static int
-weighted_mean(n1, n2, w1, w2)
- int n1;
- int n2;
- long w1;
- long w2;
-/* Mean of n1 and n2 respectively weighted by weights w1 and w2. */
-{
-#ifdef DEBUG
- if ((w1 <= 0) || (w2 <= 0)) {
- fprintf(stderr, "Bad weights passed to weighted_mean() - \
-(%d, %d, %ld, %ld)!\n", n1, n2, w1, w2);
- exit(1);
- }
-#endif /* DEBUG */
- return ((int)long_div_round((long)n1 * w1 + (long)n2 * w2,
- w1 + w2));
-}
-
-static int
-bubble_eat(diner, food)
- Bubble *diner;
- Bubble *food;
-/* The diner eats the food. Returns true (1) if the diner still exists */
-{
- int i;
- int newmi;
-
-#ifdef DEBUG
- if ((null_bubble(diner)) || (null_bubble(food))) {
- fprintf(stderr, "Bad bubbles passed to bubble_eat()!\n");
- exit(1);
- }
-#endif /* DEBUG */
-
- /* We hide the diner even in the case that it doesn't grow so that
- if the food overlaps its boundary it is replaced. This could
- probably be solved by letting bubbles eat others which are close
- but not quite touching. It's probably worth it, too, since we
- would then not have to redraw bubbles which don't change in
- size. */
-
- hide_bubble(diner);
- hide_bubble(food);
- diner->x = weighted_mean(diner->x, food->x, diner->area, food->area);
- diner->y = weighted_mean(diner->y, food->y, diner->area, food->area);
- newmi = pixel_to_mesh(diner->x, diner->y);
- diner->area += food->area;
- delete_bubble_in_mesh(food, DELETE_BUBBLE);
-
- if ((simple) && (diner->area > bubble_areas[bubble_max_radius])) {
- delete_bubble_in_mesh(diner, DELETE_BUBBLE);
- return 0;
- }
-#ifdef HAVE_XPM
- if ((! simple) && (diner->area >
- step_pixmaps[num_bubble_pixmaps]->area)) {
- delete_bubble_in_mesh(diner, DELETE_BUBBLE);
- return 0;
- }
-#endif /* HAVE_XPM */
-
- if (simple) {
- if (diner->area > bubble_areas[diner->radius + 1]) {
- /* Move the bubble to a new radius */
- i = diner->radius;
- while (diner->area > bubble_areas[i+1])
- ++i;
- diner->radius = i;
- }
- show_bubble(diner);
-#ifdef HAVE_XPM
- } else {
- if (diner->area > step_pixmaps[diner->step+1]->area) {
- i = diner->step;
- while (diner->area > step_pixmaps[i+1]->area)
- ++i;
- diner->step = i;
- diner->radius = step_pixmaps[diner->step]->radius;
- }
- show_bubble(diner);
-#endif /* HAVE_XPM */
- }
-
- /* Now adjust locations and cells if need be */
- if (newmi != diner->cell_index) {
- delete_bubble_in_mesh(diner, KEEP_BUBBLE);
- diner->cell_index = newmi;
- add_to_mesh(diner);
- }
-
- return 1;
-}
-
-static int
-merge_bubbles(b1, b2)
- Bubble *b1;
- Bubble *b2;
-/* These two bubbles merge into one. If the first one wins out return
-1 else return 2. If there is no winner (it explodes) then return 0 */
-{
- int b1size, b2size;
-
- b1size = b1->area;
- b2size = b2->area;
-
-#ifdef DEBUG
- if ((null_bubble(b1) || null_bubble(b2))) {
- fprintf(stderr, "NULL bubble passed to merge_bubbles()!\n");
- exit(1);
- }
-#endif /* DEBUG */
-
- if (b1 == b2) {
- hide_bubble(b1);
- delete_bubble_in_mesh(b1, DELETE_BUBBLE);
- return 0;
- }
-
- if (b1size > b2size) {
- switch (bubble_eat(b1, b2)) {
- case 0:
- return 0;
- break;
- case 1:
- return 1;
- break;
- default:
- break;
- }
- } else if (b1size < b2size) {
- switch (bubble_eat(b2, b1)) {
- case 0:
- return 0;
- break;
- case 1:
- return 2;
- break;
- default:
- break;
- }
- } else {
- if ((ya_random() % 2) == 0) {
- switch (bubble_eat(b1, b2)) {
- case 0:
- return 0;
- break;
- case 1:
- return 1;
- break;
- default:
- break;
- }
- } else {
- switch (bubble_eat(b2, b1)) {
- case 0:
- return 0;
- break;
- case 1:
- return 2;
- break;
- default:
- break;
- }
- }
- }
- fprintf(stderr, "An error occurred in merge_bubbles()\n");
- exit(1);
-}
-
-static void
-insert_new_bubble(tmp)
- Bubble *tmp;
-/* Calculates which bubbles are eaten when a new bubble tmp is
- inserted. This is called recursively in case when a bubble grows
- it eats others. Careful to pick out disappearing bubbles. */
-{
- Bubble *nextbub;
- Bubble *touch;
-
-#ifdef DEBUG
- if (null_bubble(tmp)) {
- fprintf(stderr, "Bad bubble passed to insert_new_bubble()!\n");
- exit(1);
- }
-#endif /* DEBUG */
-
- nextbub = tmp;
- touch = get_closest_bubble(nextbub);
- while (! null_bubble(touch)) {
- switch (merge_bubbles(nextbub, touch)) {
- case 2:
- /* touch ate nextbub and survived */
- nextbub = touch;
- break;
- case 1:
- /* nextbub ate touch and survived */
- break;
- case 0:
- /* somebody ate someone else but they exploded */
- nextbub = (Bubble *)NULL;
- break;
- default:
- /* something went wrong */
- fprintf(stderr, "Error occurred in insert_new_bubble()\n");
- exit(1);
- }
- /* Check to see if there are any other bubbles still in the area
- and if we need to do this all over again for them. */
- if (! null_bubble(nextbub))
- touch = get_closest_bubble(nextbub);
- else
- touch = (Bubble *)NULL;
- }
-}
-
-#ifdef DEBUG
-static int
-get_length_of_bubble_list(bb)
- Bubble *bb;
-{
- Bubble *tmp = bb;
- int rv = 0;
-
- while (! null_bubble(tmp)) {
- rv++;
- tmp = tmp->next;
- }
-
- return rv;
-}
-#endif /* DEBUG */
-
-/*
- * Pixmap stuff used regardless of whether file I/O is available. Must
- * still check for XPM, though!
- */
-
-#ifdef HAVE_XPM
-
-static void
-free_pixmaps()
-/* Free resources associated with XPM */
-{
- int i;
-
-#ifdef DEBUG
- if (simple) {
- fprintf(stderr, "free_pixmaps() called in simple mode\n");
- exit(1);
- }
- printf("free_pixmaps()\n");
-#endif /* DEBUG */
-
- for(i = 0; i < (num_bubble_pixmaps - 1); i++) {
- XFreePixmap(defdsp, step_pixmaps[i]->ball);
- XFreePixmap(defdsp, step_pixmaps[i]->shape_mask);
- XFreeGC(defdsp, step_pixmaps[i]->draw_gc);
- XFreeGC(defdsp, step_pixmaps[i]->erase_gc);
- XFreeColors(defdsp, defcmap, step_pixmaps[i]->xpmattrs.pixels,
- step_pixmaps[i]->xpmattrs.npixels, 0);
- XpmFreeAttributes(&step_pixmaps[i]->xpmattrs);
- }
-}
-
-static void
-onintr(a)
- int a;
-/* This gets called when SIGINT or SIGTERM is received */
-{
- free_pixmaps();
- exit(0);
-}
-
-#ifdef DEBUG
-static void
-onsegv(a)
- int a;
-/* Called when SEGV detected. Hmmmmm.... */
-{
- fflush(stdout);
- fprintf(stderr, "SEGV detected! : %d\n", a);
- exit(1);
-}
-#endif /* DEBUG */
-
-
-/*
- * Pixmaps without file I/O (but do have XPM)
- */
-
-static void
-pixmap_sort(head, numelems)
- Bubble_Step **head;
- int numelems;
-/* Couldn't get qsort to work right with this so I wrote my own. This puts
-the numelems length array with first element at head into order of radius.
-*/
-{
- Bubble_Step tmp;
- Bubble_Step *least = 0;
- int minradius = INT_MAX;
- int i;
-
- for (i = 0; i < numelems; i++) {
- if (head[i]->radius < minradius) {
- least = head[i];
- minradius = head[i]->radius;
- }
- }
- if (*head != least) {
- memcpy(&tmp, least, sizeof(Bubble_Step));
- memcpy(least, *head, sizeof(Bubble_Step));
- memcpy(*head, &tmp, sizeof(Bubble_Step));
- }
-
- if (numelems > 2)
- pixmap_sort(&head[1], numelems-1);
-}
-
-static int
-extrapolate(i1, i2)
- int i1;
- int i2;
-{
- return (i2 + (i2 - i1));
-}
-
-static void
-make_pixmap_array(list)
- Bubble_Step *list;
-/* From a linked list of bubbles construct the array step_pixmaps */
-{
- Bubble_Step *tmp = list;
- int ind;
-#ifdef DEBUG
- int prevrad = -1;
-#endif
-
- if (list == (Bubble_Step *)NULL) {
- fprintf(stderr, "NULL list passed to make_pixmap_array\n");
- exit(1);
- }
-
- num_bubble_pixmaps = 1;
- while(tmp->next != (Bubble_Step *)NULL) {
- tmp = tmp->next;
- ++num_bubble_pixmaps;
- }
-
- if (num_bubble_pixmaps < 2) {
- fprintf(stderr, "Must be at least two bubbles in file\n");
- exit(1);
- }
-
- step_pixmaps = (Bubble_Step **)xmalloc((num_bubble_pixmaps + 1) *
- sizeof(Bubble_Step *));
-
- /* Copy them blindly into the array for sorting. */
- ind = 0;
- tmp = list;
- do {
- step_pixmaps[ind++] = tmp;
- tmp = tmp->next;
- } while(tmp != (Bubble_Step *)NULL);
-
- /* We make another bubble beyond the ones with pixmaps so that the final
- bubble hangs around and doesn't pop immediately. It's radius and area
- are found by extrapolating from the largest two bubbles with pixmaps. */
-
- step_pixmaps[num_bubble_pixmaps] =
- (Bubble_Step *)xmalloc(sizeof(Bubble_Step));
- step_pixmaps[num_bubble_pixmaps]->radius = INT_MAX;
-
- pixmap_sort(step_pixmaps, (num_bubble_pixmaps + 1));
-
-#ifdef DEBUG
- if (step_pixmaps[num_bubble_pixmaps]->radius != INT_MAX) {
- fprintf(stderr, "pixmap_sort() screwed up make_pixmap_array\n");
- }
-#endif /* DEBUG */
-
- step_pixmaps[num_bubble_pixmaps]->radius =
- extrapolate(step_pixmaps[num_bubble_pixmaps-2]->radius,
- step_pixmaps[num_bubble_pixmaps-1]->radius);
- step_pixmaps[num_bubble_pixmaps]->area =
- calc_bubble_area(step_pixmaps[num_bubble_pixmaps]->radius);
-
-
-#ifdef DEBUG
- /* Now check for correct order */
- for (ind = 0; ind < num_bubble_pixmaps; ind++) {
- if (prevrad > 0) {
- if (step_pixmaps[ind]->radius < prevrad) {
- fprintf(stderr, "Pixmaps not in ascending order of radius\n");
- exit(1);
- }
- }
- prevrad = step_pixmaps[ind]->radius;
- }
-#endif /* DEBUG */
-}
-
-#ifndef NO_DEFAULT_BUBBLE
-static void
-make_pixmap_from_default(pixmap_data, bl)
- char **pixmap_data;
- Bubble_Step *bl;
-/* Read pixmap data which has been compiled into the program and a pointer
- to which has been passed.
-
- This is virtually copied verbatim from make_pixmap_from_file() above and
-changes made to either should be propagated onwards! */
-{
- int result;
- XGCValues gcv;
-
-#ifdef DEBUG
- if (pixmap_data == (char **)0) {
- fprintf(stderr, "make_pixmap_from_default(): NULL passed\n");
- exit(1);
- }
-#endif
-
- if (bl == (Bubble_Step *)NULL) {
- fprintf(stderr, "NULL pointer passed to make_pixmap()\n");
- exit(1);
- }
-
- bl->xpmattrs.closeness = 40000;
- bl->xpmattrs.valuemask = XpmColormap | XpmCloseness;
- bl->xpmattrs.colormap = defcmap;
-
- /* This is the only line which is different from make_pixmap_from_file() */
- result = XpmCreatePixmapFromData(defdsp, defwin, pixmap_data, &bl->ball,
- &bl->shape_mask, &bl->xpmattrs);
-
- switch(result) {
- case XpmColorError:
- fprintf(stderr, "xpm: color substitution performed\n");
- /* fall through */
- case XpmSuccess:
- bl->radius = MAX(bl->xpmattrs.width, bl->xpmattrs.height) / 2;
- bl->area = calc_bubble_area(bl->radius);
- break;
- case XpmColorFailed:
- fprintf(stderr, "xpm: color allocation failed\n");
- exit(1);
- case XpmNoMemory:
- fprintf(stderr, "xpm: out of memory\n");
- exit(1);
- default:
- fprintf(stderr, "xpm: unknown error code %d\n", result);
- exit(1);
- }
-
- gcv.plane_mask = AllPlanes;
- gcv.foreground = default_fg_pixel;
- gcv.function = GXcopy;
- bl->draw_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv);
- XSetClipMask(defdsp, bl->draw_gc, bl->shape_mask);
-
- gcv.foreground = default_bg_pixel;
- gcv.function = GXcopy;
- bl->erase_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv);
- XSetClipMask(defdsp, bl->erase_gc, bl->shape_mask);
-}
-
-static void
-default_to_pixmaps(void)
-/* Make pixmaps out of default ball data stored in bubbles_default.c */
-{
- int i;
- Bubble_Step *pixmap_list = (Bubble_Step *)NULL;
- Bubble_Step *newpix, *tmppix;
- char **pixpt;
-
- /* Make sure pixmaps are freed when program is terminated */
- /* This is when I hit ^C */
- if (signal(SIGINT, SIG_IGN) != SIG_IGN)
- signal(SIGINT, onintr);
- /* xscreensaver sends SIGTERM */
- if (signal(SIGTERM, SIG_IGN) != SIG_IGN)
- signal(SIGTERM, onintr);
-#ifdef DEBUG
- if (signal(SIGSEGV, SIG_IGN) != SIG_IGN) {
- printf("Setting signal handler for SIGSEGV\n");
- signal(SIGSEGV, onsegv);
- } else {
- printf("Didn't set signal hanlder for SIGSEGV\n");
- }
-#endif /* DEBUG */
-
- for (i = 0; i < num_default_bubbles; i++) {
- pixpt = default_bubbles[i];
- newpix = (Bubble_Step *)xmalloc(sizeof(Bubble_Step));
- make_pixmap_from_default(pixpt, newpix);
- /* Now add to list */
- if (pixmap_list == (Bubble_Step *)NULL) {
- pixmap_list = newpix;
- } else {
- tmppix = pixmap_list;
- while (tmppix->next != (Bubble_Step *)NULL)
- tmppix = tmppix->next;
- tmppix->next = newpix;
- }
- newpix->next = (Bubble_Step *)NULL;
- }
-
- /* Finally construct step_pixmaps[] */
- make_pixmap_array(pixmap_list);
-}
-
-#endif /* NO_DEFAULT_BUBBLE */
-
-#endif /* HAVE_XPM */
-
-/*
- * File I/O stuff
- */
-
-#ifdef BUBBLES_IO
-
-static DIR *
-my_opendir(name)
- char *name;
-/* Like opendir() but checks for things so we don't have to do it multiple
-times in the code. */
-{
- DIR *rv;
-
- if (name == (char *)NULL) {
- fprintf(stderr, "NULL directory name\n");
- return (DIR *)NULL;
- }
-
- if ((rv = opendir(name)) == NULL) {
- perror(name);
- return (DIR *)NULL;
- }
-
- return rv;
-}
-
-static int
-regular_file(name)
- char *name;
-/* Check to see if we can use the named file. This was broken under Linux
-1.3.45 but seems to be okay under 1.3.54. The parameter "name" was being
-trashed if the file didn't exist. Yeah, I know 1.3.x are development
-kernels....
-*/
-{
- int fd;
-
- if ((fd = open(name, O_RDONLY)) == -1) {
- perror(name);
- return 0;
- } else {
- close(fd);
- return 1;
- }
-}
-
-static char *
-get_random_name(dir)
- char *dir;
-/* Pick an appropriate file at random out of the files in the directory dir */
-{
- STRUCT_DIRENT *dp;
- DIR *dfd;
- int numentries = 0;
- int entnum;
- int x;
- char buf[PATH_BUF_SIZE];
- char *rv;
-
- if ((dfd = my_opendir(dir)) == (DIR *)NULL)
- return (char *)NULL;
-
- while ((dp = readdir(dfd)) != NULL) {
- if ((strcmp(DIRENT_NAME, ".") == 0) || (strcmp(DIRENT_NAME, "..") == 0))
- continue;
- if ((strlen(dir)+strlen(DIRENT_NAME)+2) > 1024) {
- fprintf(stderr, "name %s/%s too long\n", dir, DIRENT_NAME);
- continue;
- }
- if (sprintf(buf, "%s/%s", dir, DIRENT_NAME) > (PATH_BUF_SIZE-1)) {
- fprintf(stderr, "path buffer overflowed in get_random_name()\n");
- continue;
- }
- if (regular_file(buf))
- ++numentries;
- }
- closedir(dfd);
- if (numentries == 0) {
- fprintf(stderr, "No suitable files found in %s\n", dir);
- return (char *)NULL;
- }
- entnum = ya_random() % numentries;
- x = 0;
-
- if ((dfd = my_opendir(dir)) == (DIR *)NULL)
- return (char *)NULL;
- while ((dp = readdir(dfd)) != NULL) {
- if ((strcmp(DIRENT_NAME, ".") == 0) || (strcmp(DIRENT_NAME, "..") == 0))
- continue;
- if ((strlen(dir)+strlen(DIRENT_NAME)+2) > 1024) {
- /* We warned about this previously */
- continue;
- }
- if (sprintf(buf, "%s/%s", dir, DIRENT_NAME) > (PATH_BUF_SIZE-1)) {
- fprintf(stderr, "path buffer overflowed in get_random_name()\n");
- continue;
- }
- if (regular_file(buf)) {
- if (x == entnum) {
- rv = (char *)xmalloc(1024 * sizeof(char));
- strcpy(rv, buf);
- closedir(dfd);
- return rv;
- }
- ++x;
- }
- }
- /* We've screwed up if we reach here - someone must have deleted all the
- files while we were counting them... */
- fprintf(stderr, "get_random_name(): Oops!\n");
- exit(1);
-}
-
-static int
-read_line(fd, buf, bufsize)
- int fd;
- char **buf;
- int bufsize;
-/* A line is read from fd until a '\n' is found or EOF is reached. (*buf)
-is initially of length bufsize and is extended by bufsize chars if need
-be (for as many times as it takes). */
-{
- char x;
- int pos = 0;
- int size = bufsize;
- int rv;
- char *newbuf;
-
- while (1) {
- rv = read(fd, &x, 1);
- if (rv == -1) {
- perror("read_line(): ");
- return IO_ERROR;
- } else if (rv == 0) {
- (*buf)[pos] = '\0';
- return EOF_REACHED;
- } else if (x == '\n') {
- (*buf)[pos] = '\0';
- return LINE_READ;
- } else {
- (*buf)[pos++] = x;
- if (pos == (size - 1)) {
- /* We've come to the end of the space */
- newbuf = (char *)xmalloc((size+bufsize) * sizeof(char));
- strncpy(newbuf, *buf, (size - 1));
- free(*buf);
- *buf = newbuf;
- size += bufsize;
- }
- }
- }
-}
-
-static int
-create_temp_file(name)
- char **name;
-/* Create a temporary file in /tmp and return a filedescriptor to it */
-{
- int rv;
-
- if (*name != (char *)NULL)
- free(*name);
-
- if ((*name = tempnam("/tmp", "abxdfes")) == (char *)NULL) {
- fprintf(stderr, "Couldn't make new temporary file\n");
- exit(1);
- }
-/* printf("Temp file created : %s\n", *name); */
- if ((rv = creat(*name, 0644)) == -1) {
- fprintf(stderr, "Couldn't open temporary file\n");
- exit(1);
- }
-
- return rv;
-}
-
-
-#ifdef BUBBLES_IO
-static void
-make_pixmap_from_file(fname, bl)
- char *fname;
- Bubble_Step *bl;
-/* Read the pixmap in file fname into structure bl which must already
- be allocated. */
-{
- int result;
- XGCValues gcv;
-
- if (bl == (Bubble_Step *)NULL) {
- fprintf(stderr, "NULL pointer passed to make_pixmap()\n");
- exit(1);
- }
-
- bl->xpmattrs.closeness = 40000;
- bl->xpmattrs.valuemask = XpmColormap | XpmCloseness;
- bl->xpmattrs.colormap = defcmap;
-
- result = XpmReadFileToPixmap(defdsp, defwin, fname, &bl->ball,
- &bl->shape_mask, &bl->xpmattrs);
-
- switch(result) {
- case XpmColorError:
- fprintf(stderr, "xpm: color substitution performed\n");
- /* fall through */
- case XpmSuccess:
- bl->radius = MAX(bl->xpmattrs.width, bl->xpmattrs.height) / 2;
- bl->area = calc_bubble_area(bl->radius);
- break;
- case XpmColorFailed:
- fprintf(stderr, "xpm: color allocation failed\n");
- exit(1);
- case XpmNoMemory:
- fprintf(stderr, "xpm: out of memory\n");
- exit(1);
- default:
- fprintf(stderr, "xpm: unknown error code %d\n", result);
- exit(1);
- }
-
- gcv.plane_mask = AllPlanes;
- gcv.foreground = default_fg_pixel;
- gcv.function = GXcopy;
- bl->draw_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv);
- XSetClipMask(defdsp, bl->draw_gc, bl->shape_mask);
-
- gcv.foreground = default_bg_pixel;
- gcv.function = GXcopy;
- bl->erase_gc = XCreateGC (defdsp, defwin, GCForeground, &gcv);
- XSetClipMask(defdsp, bl->erase_gc, bl->shape_mask);
-}
-#endif /* BUBBLES_IO */
-
-static void
-read_file_to_pixmaps(fname)
- char *fname;
-/* Read the pixmaps contained in the file fname into memory. THESE SHOULD
-BE UNCOMPRESSED AND READY TO GO! */
-{
- int fd, tmpfd=0, rv;
- int inxpm = 0;
- int xpmseen = 0;
- char *buf = (char *)NULL;
- char *tmpname = (char *)NULL;
- Bubble_Step *pixmap_list = (Bubble_Step *)NULL;
- Bubble_Step *newpix, *tmppix;
-
- /* We first create a linked list of pixmaps before allocating
- memory for the array */
-
- if ((fd = open(fname, O_RDONLY)) == -1) {
- fprintf(stderr, "Couldn't open %s\n", fname);
- exit(1);
- }
-
- /* Make sure pixmaps are freed when program is terminated */
- /* This is when I hit ^C */
- if (signal(SIGINT, SIG_IGN) != SIG_IGN)
- signal(SIGINT, onintr);
- /* xscreensaver sends SIGTERM */
- if (signal(SIGTERM, SIG_IGN) != SIG_IGN)
- signal(SIGTERM, onintr);
-#ifdef DEBUG
- if (signal(SIGSEGV, SIGN_IGN) != SIG_IGN)
- signal(SIGSEGV, onsegv);
-#endif /* DEBUG */
-
- while (1) {
- if (inxpm == 2)
- break;
-
- buf = (char *)malloc(READ_LINE_BUF_SIZE * sizeof(char));
-
- switch ((rv = read_line(fd, &buf, READ_LINE_BUF_SIZE))) {
- case IO_ERROR:
- fprintf(stderr, "An I/O error occurred\n");
- exit(1);
- case EOF_REACHED:
- if (inxpm) {
- fprintf(stderr, "EOF occurred inside an XPM block\n");
- exit(1);
- } else
- inxpm = 2;
- break;
- case LINE_READ:
- if (inxpm) {
- if (strncmp("};", buf, 2) == 0) {
- inxpm = 0;
- write(tmpfd, buf, strlen(buf));
- write(tmpfd, "\n", 1);
- close(tmpfd);
- /* Now process the tmpfile */
- newpix = (Bubble_Step *)xmalloc(sizeof(Bubble_Step));
- make_pixmap_from_file(tmpname, newpix);
- /* Now add to list */
- if (pixmap_list == (Bubble_Step *)NULL) {
- pixmap_list = newpix;
- } else {
- tmppix = pixmap_list;
- while (tmppix->next != (Bubble_Step *)NULL)
- tmppix = tmppix->next;
- tmppix->next = newpix;
- }
- newpix->next = (Bubble_Step *)NULL;
- unlink(tmpname);
- } else {
- write(tmpfd, buf, strlen(buf));
- write(tmpfd, "\n", 1);
- }
- } else {
- if (strncmp("/* XPM */", buf, 9) == 0) {
- tmpfd = create_temp_file(&tmpname);
-/* This proves XPM's performance is kinda pathetic */
-#ifdef DEBUG
- printf("New XPM detected : %s, fd=%d\n", tmpname, tmpfd);
-#endif /* DEBUG */
- inxpm = 1;
- xpmseen = 1;
- }
- write(tmpfd, buf, strlen(buf));
- write(tmpfd, "\n", 1);
- }
- break;
- default:
- fprintf(stderr, "read_line returned unknown code %d\n", rv);
- exit(1);
- }
-
- free(buf);
- }
-
- close(fd);
- if (buf != (char *)NULL)
- free(buf);
- if (tmpname != (char *)NULL)
- free(tmpname);
-
- if (! xpmseen) {
- fprintf(stderr, "There was no XPM data in the file %s\n", fname);
- exit(1);
- }
-
- /* Finally construct step_pixmaps[] */
- make_pixmap_array(pixmap_list);
-}
-
-static void
-shell_exec(command)
- char *command;
-/* Forks a shell to execute "command" then waits for command to finish */
-{
- int pid, status, wval;
-
- switch(pid=fork()) {
- case 0:
- if (execlp(BOURNESH, BOURNESH, "-c", command, (char *)NULL) == -1) {
- fprintf(stderr, "Couldn't exec shell %s\n", BOURNESH);
- exit(1);
- }
- /* fall through if execlp() fails */
- case -1:
- /* Couldn't fork */
- perror(progname);
- exit(1);
- default:
- while ((wval = wait(&status)) != pid)
- if (wval == -1) {
- perror(progname);
- exit(1);
- }
- }
-}
-
-static void
-uncompress_file(current, namebuf)
- char *current;
- char *namebuf;
-/* If the file current is compressed (i.e. its name ends in .gz or .Z,
-no check is made to see if it is actually a compressed file...) then a
-new temporary file is created for it and it is decompressed into there,
-returning the name of the file to namebuf, else current is returned in
-namebuf */
-{
- int fd;
- char *tname = (char *)NULL;
- char argbuf[COMMAND_BUF_SIZE];
-
- if (((strlen(current) >=4) &&
- (strncmp(¤t[strlen(current)-3], ".gz", 3) == 0)) ||
- ((strlen(current) >=3) &&
- (strncmp(¤t[strlen(current)-2], ".Z", 2) == 0))) {
- fd = create_temp_file(&tname);
- /* close immediately but don't unlink so we should have a zero length
- file in /tmp which we can append to */
- close(fd);
- if (sprintf(argbuf, "%s -dc %s > %s", GZIP, current, tname) >
- (COMMAND_BUF_SIZE-1)) {
- fprintf(stderr, "command buffer overflowed in uncompress_file()\n");
- exit(1);
- }
- shell_exec(argbuf);
- strcpy(namebuf, tname);
- } else {
- strcpy(namebuf, current);
- }
- return;
-}
-
-#endif /* BUBBLES_IO */
-
-/*
- * Main stuff
- */
-
-
-static void
-get_resources(dpy)
- Display *dpy;
-/* Get the appropriate X resources and warn about any inconsistencies. */
-{
- Bool nodelay;
-#ifdef BUBBLES_IO
-#ifdef HAVE_XPM
- char *dirname;
-#else
- char *foo, *bar;
-#endif /* HAVE_XPM */
-#endif /* BUBBLES_IO */
-
- threed = get_boolean_resource("3D", "Boolean");
- quiet = get_boolean_resource("quiet", "Boolean");
- simple = get_boolean_resource("simple", "Boolean");
- /* Forbid rendered bubbles on monochrome displays */
- if ((mono_p) && (! simple)) {
- if (! quiet)
- fprintf(stderr, "Rendered bubbles not supported on monochrome \
-displays\n");
- simple = True;
- }
- delay = get_integer_resource("delay", "Integer");
- nodelay = get_boolean_resource("nodelay", "Boolean");
- if (nodelay)
- delay = 0;
- if (delay < 0)
- delay = 0;
-
- default_fg_pixel = get_pixel_resource ("foreground", "Foreground", dpy,
- DefaultColormap(dpy,
- DefaultScreen(dpy)));
- default_bg_pixel = get_pixel_resource ("background", "Background", dpy,
- DefaultColormap(dpy,
- DefaultScreen(dpy)));
-
- if (simple) {
- /* This is easy */
- broken = get_boolean_resource("broken", "Boolean");
- if (broken)
- if (! quiet)
- fprintf(stderr, "-broken not available in simple mode\n");
- } else {
-#ifndef HAVE_XPM
- simple = 1;
-#else
- broken = get_boolean_resource("broken", "Boolean");
-#ifdef BUBBLES_IO
- pixmap_file = get_string_resource("file", "File");
- dirname = get_string_resource("directory", "Directory");
-#ifdef NO_DEFAULT_BUBBLE
- /* Must specify -file or -directory if no default bubble compiled in */
- if (strcmp(pixmap_file, "(default)") != 0) {
- } else if (strcmp(dirname, "(default)") != 0) {
- if ((pixmap_file = get_random_name(dirname)) == (char *)NULL) {
- /* Die if we can't open directory - make it consistent with -file
- when it fails, rather than falling back to default. */
- exit(1);
- }
- } else {
- fprintf(stderr, "No default bubble compiled in - use -file or \
--directory\n");
- exit(1);
- }
-#else
- if (strcmp(pixmap_file, "(default)") != 0) {
- } else if (strcmp(dirname, "(default)") != 0) {
- if ((pixmap_file = get_random_name(dirname)) == (char *)NULL) {
- exit(1);
- }
- } else {
- /* Use default bubble */
- use_default_bubble = 1;
- }
-#endif /* NO_DEFAULT_BUBBLE */
-#else
- use_default_bubble = 1;
-#endif /* BUBBLES_IO */
-#endif /* HAVE_XPM */
- }
-}
-
-static void
-init_bubbles (dpy, window)
- Display *dpy;
- Window window;
-{
- XGCValues gcv;
- XWindowAttributes xgwa;
- int i;
-#ifdef BUBBLES_IO
- char uncompressed[1024];
-#endif /* BUBBLES_IO */
-
- defdsp = dpy;
- defwin = window;
-
- ya_rand_init(0);
-
- get_resources(dpy);
-
- XGetWindowAttributes (dpy, window, &xgwa);
-
-#ifdef DEBUG
- printf("sizof(int) on this platform is %d\n", sizeof(int));
- printf("sizof(long) on this platform is %d\n", sizeof(long));
-#endif /* DEBUG */
-
- screen_width = xgwa.width;
- screen_height = xgwa.height;
- screen_depth = xgwa.depth;
- defcmap = xgwa.colormap;
-
- if (simple) {
- /* These are pretty much plucked out of the air */
- bubble_min_radius = (int)(0.006*(double)(MIN(screen_width,
- screen_height)));
- bubble_max_radius = (int)(0.045*(double)(MIN(screen_width,
- screen_height)));
- /* Some trivial values */
- if (bubble_min_radius < 1)
- bubble_min_radius = 1;
- if (bubble_max_radius <= bubble_min_radius)
- bubble_max_radius = bubble_min_radius + 1;
-
- mesh_length = (2 * bubble_max_radius) + 3;
-
- /* store area of each bubble of certain radius as number of 1/10s of
- a pixel area. PI is defined in <math.h> */
- bubble_areas = (long *)xmalloc((bubble_max_radius + 2) * sizeof(int));
- for (i = 0; i < bubble_min_radius; i++)
- bubble_areas[i] = 0;
- for (i = bubble_min_radius; i <= (bubble_max_radius+1); i++)
- bubble_areas[i] = calc_bubble_area(i);
-
- mesh_length = (2 * bubble_max_radius) + 3;
- } else {
-#ifndef HAVE_XPM
- fprintf(stderr, "Bug: simple mode code not set but HAVE_XPM not \
-defined\n");
- exit(1);
-#else
- /* Make sure all #ifdef sort of things have been taken care of in
- get_resources(). */
- if (use_default_bubble) {
-#ifdef NO_DEFAULT_BUBBLE
- fprintf(stderr, "Bug: use_default_bubble and NO_DEFAULT_BUBBLE both \
-defined\n");
- exit(1);
-#else
- default_to_pixmaps();
-#endif /* NO_DEFAULT_BUBBLE */
-
- /* Set mesh length */
- mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3;
- } else {
-#ifdef BUBBLES_IO
- if (! regular_file(pixmap_file)) {
- /* perror() in regular_file printed error message */
- exit(1);
- }
- uncompress_file(pixmap_file, uncompressed);
- read_file_to_pixmaps(uncompressed);
- if (strcmp(pixmap_file, uncompressed))
- unlink(uncompressed);
-
- mesh_length = (2 * step_pixmaps[num_bubble_pixmaps-1]->radius) + 3;
-#else
- fprintf(stderr, "Bug: use_default_bubble is not defined yet I/O is not \
-compiled in\n");
- exit(1);
-#endif /* BUBBLES_IO */
- }
-#endif /* HAVE_XPM */
-
- /* Am I missing something in here??? */
- }
-
- mesh_width = (screen_width / mesh_length) + 1;
- mesh_height = (screen_height / mesh_length) + 1;
- mesh_cells = mesh_width * mesh_height;
- init_mesh();
-
- calculate_adjacent_list();
-
- adjust_areas();
-
- /* Graphics contexts for simple mode */
- if (simple) {
- gcv.foreground = default_fg_pixel;
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- gcv.foreground = default_bg_pixel;
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- }
-
- XClearWindow (dpy, window);
-}
-
-static void
-bubbles (dpy, window)
- Display *dpy;
- Window window;
-{
- Bubble *tmp;
-
- tmp = new_bubble();
- add_to_mesh(tmp);
- insert_new_bubble(tmp);
-
- XSync (dpy, True);
-}
-
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_bubbles (dpy, window);
- while (1) {
- bubbles (dpy, window);
- if (delay)
- usleep(delay);
- }
-}
-
+++ /dev/null
-/* bubbles.h - definitions for bubbles screensaver */
-
-/* $Id: bubbles.h,v 1.1 1996/09/08 01:35:40 jwz Exp $ */
-
-#ifndef _BUBBLES_H_
-#define _BUBBLES_H_
-
-#ifdef HAVE_XPM
-#include <X11/xpm.h>
-#endif
-
-/***************************************************************************
- * Options you might like to change to affect the program's behaviour *
- ***************************************************************************/
-
-/*
- * Uncommenting the following will enable support for reading bubbles from
- * files (using the -file and -directory options to bubbles). This is
- * disabled by default since such operations are inherently non-portable
- * and we want the program to compile on as many systems as possible.
- *
- * If you uncomment this and you figure out how to get it working, please
- * let me (J.Macnicol@student.anu.edu.au) know. Diffs against the standard
- * distribution would be appreciated. Possible sources of problems are
- * dirent and possibly the use of tmpnam().
- */
-
-/* #define BUBBLES_IO */
-
-/*
- * The following only makes sense if BUBBLES_IO above is defined.
- *
- * Uncomment the following if you always want to use the -file or
- * -directory options on the command line and never to use a default bubble
- * compiled into the program. This way you would save memory and disk space
- * since if you do use -file or -directory only one bubble will be loaded
- * into memory at any one time (and remember the default bubble is really
- * uncompressed, unlike bubbles in files which can be compressed). This
- * is disabled by default only so people running the program for the first
- * time with no knowldege of the command line options don't get error
- * messages ;)
- *
- * NOTE: You will still need to have a bubbles_default.c file, else the
- * build sequence will fail. Well constructed bubbles_default.c files
- * have #ifdef's which simply exclude everything else in the file at
- * compile time. The bubblestodefault script does this.
- */
-
-/* #define NO_DEFAULT_BUBBLE */
-
-/*
- * This turns on any debugging messages and sanity checks. Hopefully you
- * won't need this :) It slows things down a bit, too.
- *
- * NOTE: If you uncomment this you will get some messages about unused
- * functions when you compile. You can ignore these - they refer to
- * convenient checking routines which simply aren't called but are left
- * in case someone wants to use them.
- */
-
-/* #define DEBUG */
-
-/***************************************************************************
- * Things you might need to change to get things working right *
- ***************************************************************************/
-
-/*
- * Name of the gzip binary. You shouldn't need to change this unless it's
- * not in your PATH when the program is run, in which case you will need to
- * substitute the full path here. Keep the double quotes else things won't
- * compile!
- */
-
-#define GZIP "gzip"
-
-/*
- * Likewise for the Bourne shell.
- */
-
-#define BOURNESH "sh"
-
-/*
- * The name of the directory entry structure is different under Linux
- * (under which this code is being developed) than other systems. The case
- * alternate form here is that given in Kernighan & Ritchie's C book (which
- * must be authoratitive, no?)
- *
- * 04/07/96 : People will have to hack this to get it working on some
- * systems. I believe it doesn't work on SGI, for example.
- */
-
-#ifdef _POSIX_SOURCE
-#define STRUCT_DIRENT struct dirent
-#else
-#define STRUCT_DIRENT Dirent
-#endif
-
-/*
- * The naming of fields in struct dirent also seems to differ from system to
- * system. This may have to be extended to make things truly portable.
- * What we want here is the name field from a dirent struct pointed to
- * by "dp".
- *
- * 04/07/96 : See above. This may need to be changed too.
- */
-
-#ifdef _POSIX_SOURCE
-#define DIRENT_NAME dp->d_name
-#else
-#define DIRENT_NAME dp->name
-#endif
-
-/*
- * I don't know why this isn't defined.
- */
-#ifdef linux
-extern char *tempnam(char *, char *);
-#endif
-
-/****************************************************************************
- * Buffer lengths and things you probably won't need to touch *
- ****************************************************************************/
-
-/* Maximum length of a full path name we can deal with */
-#define PATH_BUF_SIZE 1024
-
-/* Size of string passed to shell as command */
-#define COMMAND_BUF_SIZE 2500
-
-/* Size increments for read_line() buffers */
-#define READ_LINE_BUF_SIZE 24
-
-/****************************************************************************
- * End of options *
- ****************************************************************************/
-
-/* Some machines define M_PI and not PI. If they don't define either, use
-own own. Really, the accuracy of this is _not_ very important. */
-#ifndef PI
-#define PI M_PI
-#ifndef M_PI
-#define M_PI 3.1415926535
-#endif
-#endif
-
-/* for delete_bubble_in_mesh() */
-#define DELETE_BUBBLE 0
-#define KEEP_BUBBLE 1
-
-/* Status codes for read_line */
-#define LINE_READ 0
-#define EOF_REACHED 1
-#define IO_ERROR 2
-
-/*
- * Magic number for Bubble struct, in case it's trashed when debugging code
- * (which happened to me often.... :(
- */
-
-#define BUBBLE_MAGIC 5674
-
-/* Useful macros */
-#define MAX(A, B) ((A) > (B) ? (A) : (B))
-#define MIN(A, B) ((A) < (B) ? (A) : (B))
-
-/* How we represent bubbles */
-struct bub {
- int radius;
- int step; /* for rendered bubbles */
- long area;
- int x;
- int y;
- int magic;
- int cell_index;
- int visible;
- struct bub *next;
- struct bub *prev;
-};
-
-typedef struct bub Bubble;
-
-/*
- * How we represent pixmaps of rendered bubbles. Because the range of radii
- * available may not be continuous, we call each a step (for the lack of a
- * better name...)
- */
-
-#ifdef HAVE_XPM
-struct bub_step {
- int radius;
- long area;
- Pixmap ball, shape_mask;
- GC draw_gc, erase_gc;
- XpmAttributes xpmattrs;
- struct bub_step *next;
-};
-
-typedef struct bub_step Bubble_Step;
-#endif /* HAVE_XPM */
-
-/* Make sure default bubble isn't compiled when we don't have XPM
-Disable file I/O code too. */
-#ifndef HAVE_XPM
-#define NO_DEFAULT_BUBBLE
-#ifdef BUBBLES_IO
-#undef BUBBLES_IO
-#endif /* BUBBLES_IO */
-#endif /* HAVE_XPM */
-
-/* Make sure default bubble is compiled in when we have XPM and no file I/O */
-#ifdef HAVE_XPM
-#ifndef BUBBLES_IO
-#undef NO_DEFAULT_BUBBLE
-#endif /* BUBBLES_IO */
-#endif /* HAVE_XPM */
-
-#endif /* _BUBBLES_H_ */
+++ /dev/null
-.de EX \"Begin example
-.ne 5
-.if n .sp 1
-.if t .sp .5
-.nf
-.in +.5i
-..
-.de EE
-.fi
-.in -.5i
-.if n .sp 1
-.if t .sp .5
-..
-.TH XScreenSaver 1 "14-Dec-95" "X Version 11"
-.SH NAME
-bubbles - frying pan / soft drink simulation
-.SH SYNOPSIS
-.B bubbles
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-simple] [\-broken] [\-3D] [\-file filename] [\-directory directoryname]
-.SH DESCRIPTION
-\fIBubbles\fP sprays lots of little random bubbles all over the window which
-then grow until they reach their maximum size and go pop. The inspiration
-for this was watching little globules of oil on the bottom of a frying pan
-and it also looks a little like bubbles in fizzy soft drink. The default
-mode uses fancy ray-traced bubbles but there is also a mode which just draws
-circles in case the default mode is too taxing on your hardware.
-.SH OPTIONS
-Depending on how your
-.I bubbles
-was compiled, it accepts the following options:
-.TP 8
-.B \-foreground
-Colour of circles if \fI\-simple\fP mode is selected.
-.TP 8
-.B \-background
-Colour of window background.
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-delay microseconds
-How much of a delay should be introduced between steps of the animation.
-Default 1, or about 1 microsecond. Actually, this is the delay between each
-group of 15 new bubbles since such a delay between each step results in a
-very slow animation rate.
-.TP 8
-.B \-nodelay
-Same as \fI\-delay 0\fP.
-.TP 8
-.B \-simple
-Don't use the default fancy pixmap bubbles. Just draw circles instead.
-This may give more bearable performance if your hardware wasn't made for
-this sort of thing.
-.TP 8
-.B \-broken
-Don't hide bubbles when they pop. This was a bug during development
-but the results were actually quite attractive. (This option is only
-available if you have the XPM library available and the imake generated
-Makefile has defined HAVE_XPM).
-.TP 8
-.B \-3D
-Normally, the simulation is done completely in two dimensions. When a
-bubble swallows up another bubble, the areas of each are added to get
-the area of the resulting bubble. This option changes the algorithm
-to instead add volume (imagining each to be a sphere in 3D space). The
-whole thing looks more realistic but I find it attracts attention to
-the flickering of each bubble as they are move and are redrawn. Your
-mileage may vary.
-.TP 8
-.B \-file filename
-Use the pixmap definitions in the given file, instead of the default (if
-one is compiled in). This is ignored if \fI\-simple\fP is specified. If
-the file is compressed (either with compress or gzip), it is decompressed
-before use. (This option only works if you have XPM compiled into your
-binary and you have compiled with BUBBLES_IO set in bubbles.h. This is
-\fBnot\fP the default).
-.TP 8
-.B \-directory directoryname
-Similar to \fI-file\fP except the file is taken randomly from the
-contents of the specified directory. (Again, this option is only available
-if you have XPM and BUBBLES_IO was set when compiling. See above).
-.TP 8
-.B \-quiet
-Don't print messages explaining why one or several command line options
-were ignored. This is disabled by default.
-.SH NOTES
-If you find the pace of things too slow, remember that there is a delay
-even though you specify no \fI\-delay\fP option. Try using \fI\-nodelay\fP
-although beware of the effects of irritation of other users if you're on a
-shared system as you bleed their CPU time away.
-
-Some tools to assist in creation of new bubbles are included in the source
-distribution. These can either be loaded with the \fI\-file\fP or
-\fI\-directory\fP options (if available) or they can be used in place
-of the distributed default bubble (bubble_default.c).
-You might like to copy these scripts to a permanent location and
-use them. Read bubbles.README.
-
-Rendered bubbles are not supported on monochrome displays. I'm not
-convinced that small bubbles, even dithered properly are going to look
-like anything more than a jumble of random dots.
-.SH BUGS
-There is a delay before something appears on the screen when using
-rendered bubbles. The XPM library seems to take a \fBlong\fP time to make
-pixmaps out of raw data. This can be irritating on slower systems.
-
-The movement of the bubbles looks jerky if an incomplete set of bubbles
-is used.
-
-The hide/display algorithm could do with some work to avoid flickering
-when \fI\-nodelay\fP is set.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH DISTRIBUTION POLICY
-This work is Copyright \(co 1995, 1996 by James Macnicol. Distribution is
-allowed under the terms of the GNU General Public License. Look at the
-sources for the legalese.
-.SH AUTHOR
-James Macnicol <J.Macnicol@student.anu.edu.au>.
+++ /dev/null
-#include <stdio.h>
-#include "bubbles.h"
-
-#ifndef NO_DEFAULT_BUBBLE
-
-/* XPM */
-static char *glass1[] = {
-/* width height ncolors chars_per_pixel */
-"10 10 61 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #29293F",
-"`c c #2C2C63",
-"`d c #353579",
-"`e c #242447",
-"`f c #222245",
-"`g c #25253E",
-"`h c #1C1C3F",
-"`i c #2B2B47",
-"`j c #252544",
-"`k c #222251",
-"`l c #323264",
-"`m c #212146",
-"`n c #37374B",
-"`o c #22223D",
-"`p c #252536",
-"`q c #232337",
-"`r c #34346C",
-"`s c #303068",
-"`t c #26264A",
-"`u c #5D5D97",
-"`v c #363674",
-"`w c #2C2C6A",
-"`x c #2E2E5B",
-"`y c #242451",
-"`z c #343464",
-"a` c #3C3C6F",
-"aa c #353572",
-"ab c #38386B",
-"ac c #242454",
-"ad c #181831",
-"ae c #28285B",
-"af c #37377A",
-"ag c #20203F",
-"ah c #26265C",
-"ai c #4C4C60",
-"aj c #383874",
-"ak c #333379",
-"al c #444458",
-"am c #272756",
-"an c #32326E",
-"ao c #30306C",
-"ap c #40407F",
-"aq c #292944",
-"ar c #212150",
-"as c #323271",
-"at c #2D2D76",
-"au c #21213F",
-"av c #25255A",
-"aw c #35356D",
-"ax c #313169",
-"ay c #2C2C6E",
-"az c #18182C",
-"b` c #232344",
-"ba c #292961",
-"bb c #202037",
-"bc c #1C1C33",
-"bd c #242452",
-"be c #45456F",
-"bf c #242455",
-/* pixels */
-"``````aibebebeal````",
-"`````n`zaw`ua``l`n``",
-"```i`xab`wasaj`r`x`q",
-"``auaean`daf`vao`c`t",
-"```haxahayatakbaaeb`",
-"``adbfav`wapao`sam`m",
-"``azagaracaaae`k`fbc",
-"````bb`ybd`aar`e`o``",
-"```````paq`j`b`g````",
-"````````````````````"
-};
-/* XPM */
-static char *glass2[] = {
-/* width height ncolors chars_per_pixel */
-"12 12 75 2",
-/* colors */
-"`` c None",
-"`a c #25254C",
-"`b c #23234A",
-"`c c #212148",
-"`d c #2E2E62",
-"`e c #29293F",
-"`f c #272754",
-"`g c #414188",
-"`h c #20202C",
-"`i c #2E2E68",
-"`j c #242447",
-"`k c #25253E",
-"`l c #B9B9ED",
-"`m c #6767A3",
-"`n c #2B2B47",
-"`o c #29295C",
-"`p c #252544",
-"`q c #29295F",
-"`r c #1F1F3E",
-"`s c #2F2F68",
-"`t c #2D2D66",
-"`u c #30305F",
-"`v c #4C4C6D",
-"`w c #2B2B53",
-"`x c #2F2F6E",
-"`y c #34346C",
-"`z c #3B3B55",
-"a` c #303068",
-"aa c #2C2C64",
-"ab c #26264A",
-"ac c #5D5D97",
-"ad c #363674",
-"ae c #3C3C66",
-"af c #252556",
-"ag c #30306E",
-"ah c #3E3E54",
-"ai c #2C2C6A",
-"aj c #4C4C68",
-"ak c #20204A",
-"al c #2E2E5B",
-"am c #343464",
-"an c #16162C",
-"ao c #292938",
-"ap c #333384",
-"aq c #3C3C6F",
-"ar c #1E1E37",
-"as c #38386B",
-"at c #242454",
-"au c #31316E",
-"av c #181831",
-"aw c #232349",
-"ax c #272739",
-"ay c #23234C",
-"az c #37377A",
-"b` c #1E1E3D",
-"ba c #313174",
-"bb c #3C3C78",
-"bc c #383874",
-"bd c #1B1B33",
-"be c #40407F",
-"bf c #292944",
-"bg c #212150",
-"bh c #2D2D76",
-"bi c #191937",
-"bj c #313169",
-"bk c #22224D",
-"bl c #18182C",
-"bm c #2D2D65",
-"bn c #232344",
-"bo c #292961",
-"bp c #27275F",
-"bq c #242452",
-"br c #484868",
-"bs c #262657",
-"bt c #242455",
-/* pixels */
-"`````````vajajajbr``````",
-"````ahaeae`yacasaq`zah``",
-"`````w`f`dagacbb`y`u`u``",
-"```naybm`i`mbabcaaamawar",
-"``bf`ua`adbpaz`gai`ial`j",
-"``bnbgbjaz`xbhapboaa`uav",
-"``b`aybtbcaube`x`s`tbqbd",
-"``anbiakafbb`l`i`q`o`rbl",
-"`````rakbkaf`wbsay`c`k``",
-"````ao`pay`aatab`bar`h``",
-"````````ax`e`n`kax``````",
-"````````````````````````"
-};
-/* XPM */
-static char *glass3[] = {
-/* width height ncolors chars_per_pixel */
-"14 14 90 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #383858",
-"`c c #2E2E62",
-"`d c #292967",
-"`e c #3535A1",
-"`f c #272751",
-"`g c #23234D",
-"`h c #29293F",
-"`i c #353579",
-"`j c #272754",
-"`k c #20202C",
-"`l c #2E2E3D",
-"`m c #242447",
-"`n c #25253E",
-"`o c #3E3E67",
-"`p c #1C1C3F",
-"`q c #6767A3",
-"`r c #2B2B47",
-"`s c #29295C",
-"`t c #2B2B61",
-"`u c #29295F",
-"`v c #1F1F3E",
-"`w c #2F2F68",
-"`x c #2D2D66",
-"`y c #222251",
-"`z c #2D2D69",
-"a` c #33335B",
-"aa c #37374B",
-"ab c #22223D",
-"ac c #28285A",
-"ad c #2B2B53",
-"ae c #2C2C36",
-"af c #424266",
-"ag c #232337",
-"ah c #525265",
-"ai c #32326A",
-"aj c #1B1B2F",
-"ak c #303068",
-"al c #232351",
-"am c #363674",
-"an c #3C3C66",
-"ao c #252556",
-"ap c #27275B",
-"aq c #363663",
-"ar c #4C4C68",
-"as c #2E2E5B",
-"at c #29294C",
-"au c #27274A",
-"av c #252548",
-"aw c #16162C",
-"ax c #292938",
-"ay c #353572",
-"az c #38386B",
-"b` c #4C4C85",
-"ba c #2F2F83",
-"bb c #20203F",
-"bc c #313174",
-"bd c #333379",
-"be c #444458",
-"bf c #272756",
-"bg c #47477C",
-"bh c #32326E",
-"bi c #1B1B33",
-"bj c #30306C",
-"bk c #40407F",
-"bl c #23233E",
-"bm c #141422",
-"bn c #343473",
-"bo c #2D2D76",
-"bp c #2E2E6D",
-"bq c #40406E",
-"br c #21213F",
-"bs c #8080BA",
-"bt c #25255A",
-"bu c #1B1B39",
-"bv c #35356D",
-"bw c #262651",
-"bx c #18182C",
-"by c #373786",
-"bz c #2B2B63",
-"c` c #202037",
-"ca c #1C1C33",
-"cb c #242452",
-"cc c #484868",
-"cd c #1F1F43",
-"ce c #2C2C5D",
-"cf c #3535DD",
-"cg c #262657",
-"ch c #242455",
-/* pixels */
-"``````````arccaharcc````````",
-"``````bea``obqbqbqanafaa````",
-"`````ladaqbv`qbsbgai`ca``b``",
-"````a`a`asaib`bhb`bhakasau``",
-"``c``j`c`d`dbd`eb`am`wce`aca",
-"``bxasaobt`ibdbycf`iay`u`abx",
-"``bl`a`t`ubnbdbocfbcbt`cbwbu",
-"``bi`fch`sbhbkbabp`z`u`w`gaj",
-"``bm`a`a`u`xbjaibgbzcgbf`paw",
-"````agbralazap`t`ucbacbbaj``",
-"`````kbrcdcbcbcgbw`y`vab`k``",
-"``````axbrauatav`r`m`n`n````",
-"``````````ax`h`r`nae````````",
-"````````````````````````````"
-};
-/* XPM */
-static char *glass4[] = {
-/* width height ncolors chars_per_pixel */
-"20 20 151 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #29293F",
-"`j c #2C2C63",
-"`k c #2A2A61",
-"`l c #33334C",
-"`m c #353579",
-"`n c #272754",
-"`o c #20202C",
-"`p c #2E2E3D",
-"`q c #2E2E68",
-"`r c #242447",
-"`s c #2C2C66",
-"`t c #222245",
-"`u c #181824",
-"`v c #25253E",
-"`w c #B9B9ED",
-"`x c #1C1C3F",
-"`y c #6767A3",
-"`z c #2B2B47",
-"a` c #272743",
-"aa c #222248",
-"ab c #292931",
-"ac c #29295C",
-"ad c #1D1D39",
-"ae c #252544",
-"af c #2B2B61",
-"ag c #29295F",
-"ah c #1F1F3E",
-"ai c #2F2F68",
-"aj c #2D2D66",
-"ak c #30305F",
-"al c #2C2C5B",
-"am c #11111C",
-"an c #262655",
-"ao c #31316D",
-"ap c #4C4C6D",
-"aq c #222251",
-"ar c #323264",
-"as c #43436E",
-"at c #212146",
-"au c #37374B",
-"av c #22223D",
-"aw c #252536",
-"ax c #1D1D42",
-"ay c #2A2A5C",
-"az c #28285A",
-"b` c #2B2B53",
-"ba c #333372",
-"bb c #2F2F6E",
-"bc c #2B2B3F",
-"bd c #2C2C36",
-"be c #232337",
-"bf c #34346C",
-"bg c #525265",
-"bh c #32326A",
-"bi c #303068",
-"bj c #21214C",
-"bk c #2C2C64",
-"bl c #292957",
-"bm c #232351",
-"bn c #26264A",
-"bo c #2F2F60",
-"bp c #5D5D97",
-"bq c #363674",
-"br c #3C3C66",
-"bs c #252556",
-"bt c #30306E",
-"bu c #414178",
-"bv c #2C2C6A",
-"bw c #20204A",
-"bx c #2E2E5B",
-"by c #29294C",
-"bz c #242451",
-"c` c #27274A",
-"ca c #343464",
-"cb c #4F4F64",
-"cc c #252548",
-"cd c #292938",
-"ce c #333384",
-"cf c #3C3C6F",
-"cg c #353572",
-"ch c #1E1E37",
-"ci c #38386B",
-"cj c #414156",
-"ck c #242454",
-"cl c #181831",
-"cm c #232349",
-"cn c #272739",
-"co c #4C4C85",
-"cp c #2F2F83",
-"cq c #28285B",
-"cr c #36366C",
-"cs c #48486D",
-"ct c #23234C",
-"cu c #37377A",
-"cv c #20203F",
-"cw c #26265C",
-"cx c #313174",
-"cy c #4C4C60",
-"cz c #27273F",
-"d` c #3C3C78",
-"da c #48485C",
-"db c #383874",
-"dc c #333379",
-"dd c #444458",
-"de c #272756",
-"df c #32326E",
-"dg c #1B1B33",
-"dh c #1E1E2C",
-"di c #30306C",
-"dj c #40407F",
-"dk c #292944",
-"dl c #212150",
-"dm c #141422",
-"dn c #323271",
-"do c #2D2D76",
-"dp c #2E2E6D",
-"dq c #21213F",
-"dr c #8080BA",
-"ds c #23232D",
-"dt c #25255A",
-"du c #35356D",
-"dv c #191937",
-"dw c #262651",
-"dx c #313169",
-"dy c #2C2C6E",
-"dz c #22224D",
-"e` c #18182C",
-"ea c #373786",
-"eb c #232344",
-"ec c #2B2B63",
-"ed c #292961",
-"ee c #202037",
-"ef c #1C1C33",
-"eg c #242452",
-"eh c #45456F",
-"ei c #535380",
-"ej c #1F1F43",
-"ek c #2C2C5D",
-"el c #3535DD",
-"em c #262657",
-"en c #393963",
-"eo c #242455",
-/* pixels */
-"``````````````cycyapbgcbcybg````````````",
-"``````````dacycsehcsehapehcsddcj````````",
-"````````au`cenbraseicibucicibrendd``````",
-"``````auau`ccacidudrbpdrcfcrarakau`p````",
-"`````p`lbx`nbhbfdxcobpcodjdu`sakalb`bd``",
-"`````zbybxbocicgbvbbdn`ydbdfbfekbxbybe``",
-"``dh`r`rbl`faidydndn`hd`dnbtecafakdwah`o",
-"``dhdqejcqajdfcg`meacu`hbqdfdibi`jblbndh",
-"``ch`rbxemaidudnbq`geldcbqdbdn`jafbxbnav",
-"``dm`x`bdxdxcwbqdycpdocxdcbvedbkcqalebdg",
-"```uccctdzbsag`qbqdpeacxbtaidiagekdwcvdm",
-"``dmcl`xeoandtdfbv`wdjcediecbiaydectatch",
-"``amdvcm`xaf`kagaodi`qdbbaecanazejdvdv`u",
-"````e``xcvandlcqckdtcgagcq`qaqay`tbjef``",
-"````dsclaxbwdzdebsckb`acegbjeg`eaaadds``",
-"``````eeeeejbzanegdw`abmdl`b`rcnavaw````",
-"````````eeczbc`b`dby`dbya``eae`iaw``````",
-"``````````bdawa`dkc`aeae`i`i`vab````````",
-"``````````````bd`pcdcdbdcdbd````````````",
-"````````````````````````````````````````"
-};
-/* XPM */
-static char *glass5[] = {
-/* width height ncolors chars_per_pixel */
-"24 24 164 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #272754",
-"`p c #414188",
-"`q c #20202C",
-"`r c #2E2E3D",
-"`s c #1C1C28",
-"`t c #2E2E68",
-"`u c #242447",
-"`v c #2C2C66",
-"`w c #181824",
-"`x c #25253E",
-"`y c #161622",
-"`z c #B9B9ED",
-"a` c #3E3E67",
-"aa c #1C1C3F",
-"ab c #6767A3",
-"ac c #2B2B47",
-"ad c #222248",
-"ae c #292931",
-"af c #29295C",
-"ag c #252544",
-"ah c #1E1E47",
-"ai c #2B2B61",
-"aj c #29295F",
-"ak c #1F1F3E",
-"al c #2F2F68",
-"am c #2D2D66",
-"an c #30305F",
-"ao c #2C2C5B",
-"ap c #11111C",
-"aq c #262655",
-"ar c #31316D",
-"as c #4C4C6D",
-"at c #323264",
-"au c #2D2D69",
-"av c #33335B",
-"aw c #212146",
-"ax c #37374B",
-"ay c #22223D",
-"az c #252536",
-"b` c #1D1D42",
-"ba c #28285A",
-"bb c #2B2B53",
-"bc c #333372",
-"bd c #2F2F6E",
-"be c #2C2C36",
-"bf c #424266",
-"bg c #232337",
-"bh c #2F2FB0",
-"bi c #34346C",
-"bj c #525265",
-"bk c #32326A",
-"bl c #1B1B2F",
-"bm c #3B3B55",
-"bn c #303068",
-"bo c #21214C",
-"bp c #2C2C64",
-"bq c #292957",
-"br c #26264A",
-"bs c #202044",
-"bt c #5D5D97",
-"bu c #2B2B5C",
-"bv c #363674",
-"bw c #3C3C66",
-"bx c #252556",
-"by c #30306E",
-"bz c #3E3E54",
-"c` c #2C2C6A",
-"ca c #25252E",
-"cb c #27275B",
-"cc c #363663",
-"cd c #4C4C68",
-"ce c #20204A",
-"cf c #2E2E5B",
-"cg c #29294C",
-"ch c #242451",
-"ci c #27274A",
-"cj c #343464",
-"ck c #252548",
-"cl c #16162C",
-"cm c #292938",
-"cn c #333384",
-"co c #3C3C6F",
-"cp c #353572",
-"cq c #1E1E37",
-"cr c #38386B",
-"cs c #414156",
-"ct c #242454",
-"cu c #31316E",
-"cv c #181831",
-"cw c #232349",
-"cx c #272739",
-"cy c #4C4C85",
-"cz c #2F2F83",
-"d` c #28285B",
-"da c #292952",
-"db c #48486D",
-"dc c #23234C",
-"dd c #37377A",
-"de c #1E1E3D",
-"df c #26265C",
-"dg c #313174",
-"dh c #4C4C60",
-"di c #27273F",
-"dj c #3C3C78",
-"dk c #48485C",
-"dl c white",
-"dm c #383874",
-"dn c #333379",
-"do c #444458",
-"dp c #272756",
-"dq c #1B1B33",
-"dr c #1E1E2C",
-"ds c #30306C",
-"dt c #40407F",
-"du c #292944",
-"dv c #212150",
-"dw c #23233E",
-"dx c #343473",
-"dy c #323271",
-"dz c #2D2D76",
-"e` c #2E2E6D",
-"ea c #40406E",
-"eb c #21213F",
-"ec c #8080BA",
-"ed c #23232D",
-"ee c #25255A",
-"ef c #35356D",
-"eg c #191937",
-"eh c #262651",
-"ei c #313169",
-"ej c #2C2C6E",
-"ek c #22224D",
-"el c #18182C",
-"em c #373786",
-"en c #2D2D65",
-"eo c #232344",
-"ep c #2B2B63",
-"eq c #292961",
-"er c #27275F",
-"es c #1C1C33",
-"et c #242452",
-"eu c #45456F",
-"ev c #484868",
-"ew c #1F1F43",
-"ex c #2C2C5D",
-"ey c #3535DD",
-"ez c #262657",
-"f` c #393963",
-"fa c #242455",
-/* pixels */
-"``````````````````dkdhbjbjbjbjdh````````````````",
-"``````````````csasascdevcdascddbevdh````````````",
-"``````````dodobfa`dbeubfeueueacrbfbfcsax````````",
-"````````bzcsbwf`bwcrbicobteccratcof`bmbzbz``````",
-"```````n`navavanefcjbibt`zcrcobicratccf``nax````",
-"``````acbbao`oat`fambycobtdldjbkbialan`can`n````",
-"````dicg`icj`fbi`fefdyauarabbybiefbnaicfbbcg`x``",
-"````ac`udcbqenbk`tdyabczdgdxdmdtbpcpcjeicwcgcq``",
-"```wdq`acfaiefcpe`bydn`hcyeydmc`ambcef`fcf`u`y`s",
-"```ydudaandfbnaubvdgerbhdd`h`pdyc`cu`tezcf`b`ubl",
-"``elad`abqezbndmdsbccncnczeydnbvdmdxamep`fcgcv`w",
-"```weoetdv`leidfdd`gbddzdzdncncneqeebpexan`ucvap",
-"``elcwdaexehd`epaubd`hdz`hcz`gdycucueeba`oekcl`w",
-"``eldebsdcbxfaeedmejcuemdtcnbdbyalafambuet`bdq`w",
-"```yclakboce`fbx`mcper`veccyauei`mbncbaqdpdaesap",
-"````clakegbsceetbxdsdjdt`zbt`tctajdvafahakayel``",
-"````eldqdeebetboenepetezbnbxencb`lbaeteoaabldr``",
-"``````blakb`ceetekambxctbbafezctdcbo`eew`xcq````",
-"``````ed`qakbsawekchchchetd``jboceaddwcxesed````",
-"````````cmazag`xdcek`bchctetbrci`deocqbg`q``````",
-"```````````qbgayckaybr`uacek`beo`x`xazca````````",
-"``````````````aecxdi`kagacag`xcxcxcm````````````",
-"``````````````````ca`rcmbebebeae````````````````",
-"````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass6[] = {
-/* width height ncolors chars_per_pixel */
-"30 30 181 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #3535A1",
-"`h c #23234D",
-"`i c #29293F",
-"`j c #2C2C63",
-"`k c #2A2A61",
-"`l c #33334C",
-"`m c #353579",
-"`n c #272754",
-"`o c #20202C",
-"`p c #2E2E3D",
-"`q c #1C1C28",
-"`r c #2E2E68",
-"`s c #242447",
-"`t c #2C2C66",
-"`u c #222245",
-"`v c #181824",
-"`w c #25253E",
-"`x c #161622",
-"`y c #B9B9ED",
-"`z c #3E3E67",
-"a` c #1C1C3F",
-"aa c #6767A3",
-"ab c #2B2B47",
-"ac c #272743",
-"ad c #292931",
-"ae c #29295C",
-"af c #1D1D39",
-"ag c #252544",
-"ah c #1E1E47",
-"ai c #2B2B61",
-"aj c #29295F",
-"ak c #1F1F3E",
-"al c #2F2F68",
-"am c #2D2D66",
-"an c #30305F",
-"ao c #2C2C5B",
-"ap c #11111C",
-"aq c #262655",
-"ar c #31316D",
-"as c #4C4C6D",
-"at c #222251",
-"au c #323264",
-"av c #2D2D69",
-"aw c #33335B",
-"ax c #43436E",
-"ay c #2B2B67",
-"az c #212146",
-"b` c #37374B",
-"ba c #22223D",
-"bb c #252536",
-"bc c #1D1D42",
-"bd c #28285A",
-"be c #2B2B53",
-"bf c #333372",
-"bg c #2F2F6E",
-"bh c #2C2C36",
-"bi c #424266",
-"bj c #232337",
-"bk c #2F2FB0",
-"bl c #34346C",
-"bm c #525265",
-"bn c #32326A",
-"bo c #1B1B2F",
-"bp c #3B3B55",
-"bq c #303068",
-"br c #21214C",
-"bs c #2C2C64",
-"bt c #292957",
-"bu c #232351",
-"bv c #26264A",
-"bw c #2F2F60",
-"bx c #202044",
-"by c #5D5D97",
-"bz c #2B2B5C",
-"c` c #363674",
-"ca c #3C3C66",
-"cb c #252556",
-"cc c #30306E",
-"cd c #3E3E54",
-"ce c #414178",
-"cf c #2C2C6A",
-"cg c #2F2F4F",
-"ch c #25252E",
-"ci c #27275B",
-"cj c #363663",
-"ck c #4C4C68",
-"cl c #20204A",
-"cm c #2E2E5B",
-"cn c #29294C",
-"co c #242451",
-"cp c #27274A",
-"cq c #343464",
-"cr c #4F4F64",
-"cs c #252548",
-"ct c #16162C",
-"cu c #292938",
-"cv c #333384",
-"cw c #3C3C6F",
-"cx c #353572",
-"cy c #1E1E37",
-"cz c #38386B",
-"d` c #414156",
-"da c #242454",
-"db c #31316E",
-"dc c #181831",
-"dd c #232349",
-"de c #272739",
-"df c #393979",
-"dg c #4C4C85",
-"dh c #2F2F83",
-"di c #28285B",
-"dj c #292952",
-"dk c #36366C",
-"dl c #48486D",
-"dm c #23234C",
-"dn c #37377A",
-"do c #20203F",
-"dp c #1E1E3D",
-"dq c #26265C",
-"dr c #313174",
-"ds c #4C4C60",
-"dt c #27273F",
-"du c #3C3C78",
-"dv c #48485C",
-"dw c white",
-"dx c #383874",
-"dy c #333379",
-"dz c #444458",
-"e` c #272756",
-"ea c #47477C",
-"eb c #32326E",
-"ec c #1E1E2C",
-"ed c #30306C",
-"ee c #40407F",
-"ef c #292944",
-"eg c #212150",
-"eh c #23233E",
-"ei c #141422",
-"ej c #343473",
-"ek c #323271",
-"el c #2D2D76",
-"em c #2E2E6D",
-"en c #40406E",
-"eo c #21213F",
-"ep c #272731",
-"eq c #8080BA",
-"er c #23232D",
-"es c #25255A",
-"et c #1B1B39",
-"eu c #35356D",
-"ev c #191937",
-"ew c #262651",
-"ex c #313169",
-"ey c #2C2C6E",
-"ez c #22224D",
-"f` c #18182C",
-"fa c #373786",
-"fb c #2D2D65",
-"fc c #232344",
-"fd c #2B2B63",
-"fe c #292961",
-"ff c #27275F",
-"fg c #202037",
-"fh c #1C1C33",
-"fi c #242452",
-"fj c #45456F",
-"fk c #484868",
-"fl c #535380",
-"fm c #1F1F43",
-"fn c #2C2C5D",
-"fo c #353573",
-"fp c #262657",
-"fq c #393963",
-"fr c #242455",
-/* pixels */
-"````````````````````````bmbmbmbmbmbmbm``````````````````````",
-"``````````````````dscrasasascrckasasasfkckbm````````````````",
-"````````````````dsdsdzbifjfjfjfjaxaxfjfjckdzdv``````````````",
-"````````````d`dvfqdzenfkfjencaendlaxaxcabibi`zdvb```````````",
-"``````````cd`zaw`cfqcacaceflczbydg`zencjcwca`cbpbpcd````````",
-"````````d`cdb``cawcqczdkeubycwbyczdwcwczcqaucaawb`b`b```````",
-"````````b``lcmcqaoczaublbndgeqdfeqczdgbn`jcmanfnawcg`l``````",
-"``````cu`w`wcmcmcqblardxeu`yceareqdueualbleuexdjcmbeba`p````",
-"````chabcg`acmbwbqczaiebcfdfdgekeqdudxebcxblbncmcm`ababjer``",
-"`````o`aeodmaobdalbn`rcfdf`mdhdrdyeaejdubscxffbwbwdd`b`w`q``",
-"````fhbadjcmbq`jcxcxekemeydr`gdy`geeekek`t`rexe`e``ndjdcdc``",
-"```q`veocnbtdialbleb`rfo`medfadnelbkc`bffeedeufn`jcmfmbvfg`x",
-"``ecbo`sbze`feaeayexavbgej`gbkdyeydhdudnemdbfdal`kfna``udc`v",
-"```xeieodjbtfpexfbc`avekbg`gbkelfa`g`gdxcxcfdxamfpbtcpfcdoap",
-"```vcya`btegex`kbldqdncfeycvdyelcv`gdycvfefeebaedianfmfcdc`q",
-"``fhcyetahfncobdbs`tbncfdybgcf`gdhcfavavav`tfraifnbtbteteoei",
-"```xdpaz`bbtcl`fesfbedfdekelbkdhaaavbgcf`jfe`fesbwez`bbxdcei",
-"```xfhdcbx`hfratbresfdedcfee`meedffded`t`tbqdiaee``nazazdcap",
-"`````vdp`sew`bbqaifpfpdbbsccdxdfekbyee`j`jdialbzfidmazafct``",
-"`````vbodpevbcaqbdatcb`tfdamar`ydg`taicbaje`dadaahaketevbo``",
-"`````qf`bjakdobdezegfbaidacibncxdgbddiajalatfibz`ubccyfh`q``",
-"``````chbjbcbcfmbdaediatcbfpfpajfpdaesfpbudmco`h`eewfhf`````",
-"`````````ocydp`waz`e`baqfiesfpdjfpfiaidacpewah`wafdpbb``````",
-"````````chfgfgfmddcofibdfi`bfi`ada`hegbu`h`seodtbafhec``````",
-"``````````cuepdo`wefdmfidd`b`hdae``bbvcn`dagakbabj`o````````",
-"````````````erbbdeefcsefcpabezcp`habef`sbx`wehbber``````````",
-"````````````````chbbba`ief`iacagabef`i`wba`wcu``````````````",
-"``````````````````chbb`p`p`w`w`pcu`p`icucuch````````````````",
-"````````````````````````adadcudeepadbh``````````````````````",
-"````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass7[] = {
-/* width height ncolors chars_per_pixel */
-"36 36 187 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #48486D",
-"dr c #23234C",
-"ds c #37377A",
-"dt c #1E1E3D",
-"du c #26265C",
-"dv c #313174",
-"dw c #4C4C60",
-"dx c #27273F",
-"dy c #3C3C78",
-"dz c #48485C",
-"e` c white",
-"ea c #383874",
-"eb c #333379",
-"ec c #444458",
-"ed c #272756",
-"ee c #47477C",
-"ef c #32326E",
-"eg c #1B1B33",
-"eh c #1E1E2C",
-"ei c #30306C",
-"ej c #40407F",
-"ek c #292944",
-"el c #212150",
-"em c #23233E",
-"en c #141422",
-"eo c #343473",
-"ep c #323271",
-"eq c #2D2D76",
-"er c #2E2E6D",
-"es c #40406E",
-"et c #21213F",
-"eu c #272731",
-"ev c #8080BA",
-"ew c #23232D",
-"ex c #25255A",
-"ey c #1B1B39",
-"ez c #35356D",
-"f` c #191937",
-"fa c #262651",
-"fb c #313169",
-"fc c #2C2C6E",
-"fd c #22224D",
-"fe c #18182C",
-"ff c #373786",
-"fg c #2D2D65",
-"fh c #232344",
-"fi c #2B2B63",
-"fj c #292961",
-"fk c #27275F",
-"fl c #202037",
-"fm c #1C1C33",
-"fn c #242452",
-"fo c #45456F",
-"fp c #484868",
-"fq c #535380",
-"fr c #1F1F43",
-"fs c #2C2C5D",
-"ft c #3535DD",
-"fu c #353573",
-"fv c #262657",
-"fw c #393963",
-"fx c #242455",
-/* pixels */
-"````````````````````````````````bsbsbsdwbs``````````````````````````````",
-"````````````````````````dwbsdwcqcxbscqdwcqcxdzcxbs``````````````````````",
-"````````````````````fpcxawcqawcqawawcqawfocqcqawfpcqcx``````````````````",
-"``````````````````ececfpfpbofodqdqdqesbababadqfobafpeccj````````````````",
-"``````````````dfeccjabcgesbobaabadcgabbaeefobaesbob`cgdfcjcj````````````",
-"````````````cjdfbvcgfwfwcgcgesbrevdbcdeeesdedbfwdbcgcpbvbvdfcj``````````",
-"``````````bdbvbvcg`ccpcwdecwayckcdeecddydcbrezdecpayfwb`ar`ncjbd````````",
-"```````````saecmcscpcscwbwaqayeaevfqdyckbtdefbcpeicscbcscpb`cmae````````",
-"`````````scvbjcmar`pcsfb`fbt`fcidmdecdcdefdyezaqbraz`farasasarek`s``````",
-"``````bnaecmdjayb`fscsbwaqfbbwdyaacddheacdfudbfbbrbtfbaqbzcsdpafcmcn````",
-"```````s`zbj`basfs`fbr`f`wdcepeqcfcdfue`dmdvcdbkbkbrfb`fbwbjcaaect`z````",
-"`````taeaoccdrcsfdfgbwbr`ubb`oadebdndvebe`eadsejbyavfgcwbtcsdjbjaeddbf``",
-"````eudidjbzdp`pbzbwbbefeperfjdabldadada`qcfdveofi`wfb`fay`ped`aeteg`k``",
-"`````yflfadpcsfs`lbrdcav`wcfeoepdsda`qbqebdydsepfiaveabwbz`maybc`abufe``",
-"````fmek`aararaiambwbyefcfcfbqfkeqejds`gft`qeofuclfkbw`ubibtcs`bcv`vfe``",
-"```ydi`v`xdpbzamaxaqfkavererbkfffcfc`hdaeqdscffudcclbkfgapanayaodpczeg`t",
-"``atbpao`adpbzdo`mfgbtepereperfcbqft`g`hffbqbkdlfucleiaqfbdg`bctfrfmfea`",
-"```yetfh`xdpelfbfsfbaz`mdsci`gblffdneqftebda`hdafjfjfgbybwdgardr`xdia`at",
-"``ateheycccredfsaxfgcibbeffjejdafc`g`heqblfjepclazazap`wfscbbz`jacfrflat",
-"``atczey`v`afsacfsdgco`lbb`gebffereqft`qffdaer`wfgfifififjbzcu`i`adda`at",
-"````a`dtcy`xdrcrexfxfvfgeabkbbdhffadejdndnblclepapdubhaqfvcefn`xdtegfe``",
-"````a`dieybxfnbx`jfsfxfkfgfgdheoev`qdncdfcdlfjfi`wfiapcuchaubzaceydiat``",
-"````atdifr`abz`bbzbranaifneifufidyckejepckffepfibyaianancu`bbgbgagegen``",
-"````atczegeyf`bgascrcrelchanefdyfieaaa`qaq`uexduanbhfxaicecraoemajfea```",
-"```````tfebedtccaled`dcoaqdoamdeaiandydyaifi`mfbaqfdfnbh`pagfrddfmfe````",
-"```````t`reydidjagbzaxchanfnaianchch`lbhcoaichauc`chdoelbgbgbcegfm`r````",
-"`````````reyaoacetcrfn`afd`ffvchc`fvbjaianfvco`bdrdgbz`e`vbe`zeyeg``````",
-"```````````regacem`vccfnbxc`cu`jbifnfvcoc`bi`ich`adjac`xflajemew````````",
-"``````````ewbpbpdtaobcbc`jchbic``ac``afafafnfd`jfncybcdxdkbedd`r````````",
-"````````````d`ddbeakfh`kdrfd`b`b`jcudged`bcacvct`dcyccddewd``r``````````",
-"``````````````eubndddxdxakaecvcaae`ecaagaecvafcabcfhbp`keucn````````````",
-"``````````````````d`flem`z`s`v`kbc`bekaeagaeetafekd`bmbf````````````````",
-"`````````````````````s`zdk`zae`kdxakaeekek`zekbfdkd`bn``````````````````",
-"````````````````````````bnbmd`dkdk`sbndxd`bmbfbnah``````````````````````",
-"````````````````````````````````cnbneu`sah``````````````````````````````",
-"````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass8[] = {
-/* width height ncolors chars_per_pixel */
-"44 44 189 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #36366C",
-"dr c #48486D",
-"ds c #23234C",
-"dt c #37377A",
-"du c #20203F",
-"dv c #1E1E3D",
-"dw c #26265C",
-"dx c #313174",
-"dy c #4C4C60",
-"dz c #27273F",
-"e` c #3C3C78",
-"ea c #48485C",
-"eb c white",
-"ec c #383874",
-"ed c #333379",
-"ee c #444458",
-"ef c #272756",
-"eg c #47477C",
-"eh c #32326E",
-"ei c #1B1B33",
-"ej c #1E1E2C",
-"ek c #30306C",
-"el c #40407F",
-"em c #292944",
-"en c #212150",
-"eo c #23233E",
-"ep c #141422",
-"eq c #343473",
-"er c #323271",
-"es c #2D2D76",
-"et c #2E2E6D",
-"eu c #40406E",
-"ev c #21213F",
-"ew c #272731",
-"ex c #8080BA",
-"ey c #23232D",
-"ez c #25255A",
-"f` c #1B1B39",
-"fa c #35356D",
-"fb c #191937",
-"fc c #262651",
-"fd c #313169",
-"fe c #2C2C6E",
-"ff c #22224D",
-"fg c #18182C",
-"fh c #373786",
-"fi c #2D2D65",
-"fj c #232344",
-"fk c #2B2B63",
-"fl c #292961",
-"fm c #27275F",
-"fn c #202037",
-"fo c #1C1C33",
-"fp c #242452",
-"fq c #45456F",
-"fr c #484868",
-"fs c #535380",
-"ft c #1F1F43",
-"fu c #2C2C5D",
-"fv c #3535DD",
-"fw c #353573",
-"fx c #262657",
-"fy c #393963",
-"fz c #242455",
-/* pixels */
-"````````````````````````````````````````````bs``````````````````````````````````````````",
-"````````````````````````````````dybseabsawbsbscxawcxbsdybs``````````````````````````````",
-"````````````````````````````eedycqcqcqdrcxawcqawawawawfrfrcxcq``````````````````````````",
-"````````````````````````eadyfrdybafrfqawawfqdrawawfrfrdrawcqeaeeee``````````````````````",
-"````````````````````eeeebofrboawbofqdrbadrfqeufqfqbababafqfrbobobocjee``````````````````",
-"``````````````````dfeebvfybvcgbaboeueueueuababfqdefqegeuabeufybocgdfeacj````````````````",
-"````````````````bvbo`nfydffybocgcgdedbegfsfqeuegexeudbdqdedbdeabfybvcjdfcj``````````````",
-"``````````````bdcjbvfyfyb`defyfydedbckexexebckdmaqdbdbdbayaydeaycpbvab`ccjbd````````````",
-"`````````````s`ccjb`b`b`b`ardededeaydcexadckaddbdbaadqdqbrbtbrayb`cpb``c`ccm`n``````````",
-"```````````n`n`ncmcsb`cpascpegfi`ucwbrcdcdebehaddbbrdmfaayaqcbb`arcscs`ccmb`ae`s````````",
-"``````````aeafcmaeasfu`paraycbbtfd`lavecckegcdcdaaec`qfa`ufa`f`ubwarbzb`cscs`kbm````````",
-"````````ewaectfjbzcsb`arcwbtdcapec`fdcaadmcd`ueqaddmekecav`fapbtecbwdparbjcmaoct`n``````",
-"````````bddzcmbjdparcscb`fdbfdfidcdlcieqbbdlciebexeletegbwbk`ubtbwfufucsdpcm`zctbm``````",
-"```````ycmdjdpctauaramefcsbwapehekereddleledcfdmdmdmerelecaqaqbrehcbbzarfc`vbjcyem`r````",
-"``````bpaobefjccbzasenbw`ufafdblcl`oeldldnbqededdtcdbkdldlet`lekamcbbw`fbjauctdp`zfn````",
-"`````yfoaj`bbzeodsfibhbrekavcfcletfldneddxeddadtdadmbkerercleh`ubwbwcbbzarbhdpfjdiei`t``",
-"````atfoemfcdpbzasfi`ffadcekbkazeqerbkerdadtdmfhbqdldleddxfkfdapdcfdfcam`pbz`e`ifoepa```",
-"````a`dd`v`bbzbjefdw`lbwbtehdceccf`hfeerbqfhedesbqfvdlcifwcifldhbrficbficsefcc`v`xajbp``",
-"````fnfgeo`vfubzbwdwco`ufm`m`ucfbler`ofh`hfveddndnbqdldldtcffmbkbwapbwaiefaybgctczfgei``",
-"`````yczacaodpbjayfxcobwapbkehdhblerdtdnfe`hbqfhbqfedtcfeqecaqeqbwfiapanbhbr`zdjbcaofo``",
-"````atczf``bbzbzbhax`laqbwaqdhciblfeclfhfhdafmbqdabqdacidldtdhflcf`wby`fauef`vccakev`y``",
-"``ata`fnagccbzenbhfiaifdehezdhdlet`geteddnbqesfvedbqesdndabbfmfmbtbyamfufuasbcccdidiepat",
-"````fgfgao`dbg`e`falcobwfkfmdh`o`gcidnesdn`gdabqed`geteretblekazfk`u`fdocb`j`abgf`ev`y``",
-"`````yeicv`v`b`pamfcbhfxfidwetazazdx`q`heted`qfveder`get`wciekehchcodgbhffefeffcczbu`y``",
-"````epdvfjfj`acubzenanbifxbyaqci`w`gereleddnesehdnazdxbkcl`wfmfm`f`lfmayenau`bfceidia```",
-"`````ybuev`xcc`j`pfzaxau`jezekcferblcifhfhdmdmdldtfmblekdhekaq`fbififzbzftbidudvdifgbu``",
-"````atfgfoaobgal`pc`auamaxcoekapdcfwaqe`edeldnele`ekelfm`manapaqficubi`pdjfcacf`bgdvep``",
-"`````ya`f`ag`bdpasbcfubraibifmfmdhcfanekdcdmdtdhflexblcifkbyfiaifian`pau`pagbgbceicza```",
-"``````epdif`dubcefbgauenaxfmco`f`mecekfied`uavexfkbbaqfmdwanapcubifxffbgacftbef`di`y````",
-"``````a`czbuf`ddddbcfffcfcdgdoancofdezbwecfkap`wehaifmbtfiandwaxenbibzagf`ccbpaj`t`y````",
-"`````````yfoeyaceoevenfpffbx`mam`mbifpdwchapehaicocoamaibibtezfxdgfxeffjccfpeiddfg``````",
-"````````ej`rdidvaobzalbzfp`mauchfpfkezfkau`f`fdechchchfzbic`axbxfpauff`ebg`pejej`t``````",
-"```````````tf`f`ajal`zcrfpendsffaycochfzdgfzbjcoancofpdo`ben`affce`edjbcbebef`di````````",
-"```````````t`rf`dvaoeobcdu`ece`bfpencucofxbic`auc`dgficuef`bbxffbg`ebedddvaobfew````````",
-"````````````cnejbpaodvftdj`jcr`pcoen`j`jcu`ifcbifx`jc``jen`bbx`vccbe`z`zddddcn``````````",
-"``````````````ewbpddfbddaccycr`dfp`jfpca`jcu`dc`cacv`dff`d`d`x`dft`z`zbeejcn````````````",
-"````````````````fgfneoduembmfj`vag`act`bds`ac``j`j`acv`bbcagak`xdudvbpcn`t``````````````",
-"``````````````````ewd`fnaeakemcyaecvdjaeaecrcvdsakaeakafcy`jao`zfnd`cn`t````````````````",
-"````````````````````d`dkfndzd``zbm`v`k`b`ecvemaeca`vaedudz`zafew`kbfey``````````````````",
-"````````````````````````bfdkd`dz`kafdzae`vemcyafakakaedzdzbed`dkcn``````````````````````",
-"````````````````````````````ahdkbnbnbm`z`sdk`s`zd`bm`safd`bn`s``````````````````````````",
-"````````````````````````````````bnbn`sd`d`dk`sbmbnah`s`sah``````````````````````````````",
-"````````````````````````````````````````````cn``````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass9[] = {
-/* width height ncolors chars_per_pixel */
-"50 50 188 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #292957",
-"bz c #232351",
-"c` c #26264A",
-"ca c #2F2F60",
-"cb c #202044",
-"cc c #5D5D97",
-"cd c #2B2B5C",
-"ce c #363674",
-"cf c #3C3C66",
-"cg c #252556",
-"ch c #30306E",
-"ci c #3E3E54",
-"cj c #414178",
-"ck c #2C2C6A",
-"cl c #2F2F4F",
-"cm c #25252E",
-"cn c #27275B",
-"co c #363663",
-"cp c #4C4C68",
-"cq c #20204A",
-"cr c #2E2E5B",
-"cs c #29294C",
-"ct c #242451",
-"cu c #27274A",
-"cv c #343464",
-"cw c #4F4F64",
-"cx c #252548",
-"cy c #16162C",
-"cz c #292938",
-"d` c #333384",
-"da c #3C3C6F",
-"db c #353572",
-"dc c #1E1E37",
-"dd c #38386B",
-"de c #414156",
-"df c #242454",
-"dg c #31316E",
-"dh c #181831",
-"di c #232349",
-"dj c #272739",
-"dk c #393979",
-"dl c #4C4C85",
-"dm c #2F2F83",
-"dn c #28285B",
-"do c #292952",
-"dp c #36366C",
-"dq c #48486D",
-"dr c #23234C",
-"ds c #37377A",
-"dt c #20203F",
-"du c #1E1E3D",
-"dv c #26265C",
-"dw c #313174",
-"dx c #4C4C60",
-"dy c #27273F",
-"dz c #3C3C78",
-"e` c #48485C",
-"ea c white",
-"eb c #383874",
-"ec c #333379",
-"ed c #444458",
-"ee c #272756",
-"ef c #47477C",
-"eg c #32326E",
-"eh c #1B1B33",
-"ei c #1E1E2C",
-"ej c #30306C",
-"ek c #40407F",
-"el c #292944",
-"em c #212150",
-"en c #23233E",
-"eo c #141422",
-"ep c #343473",
-"eq c #323271",
-"er c #2D2D76",
-"es c #2E2E6D",
-"et c #40406E",
-"eu c #21213F",
-"ev c #272731",
-"ew c #8080BA",
-"ex c #23232D",
-"ey c #25255A",
-"ez c #1B1B39",
-"f` c #35356D",
-"fa c #191937",
-"fb c #262651",
-"fc c #313169",
-"fd c #2C2C6E",
-"fe c #22224D",
-"ff c #18182C",
-"fg c #373786",
-"fh c #2D2D65",
-"fi c #232344",
-"fj c #2B2B63",
-"fk c #292961",
-"fl c #27275F",
-"fm c #202037",
-"fn c #1C1C33",
-"fo c #242452",
-"fp c #45456F",
-"fq c #484868",
-"fr c #535380",
-"fs c #1F1F43",
-"ft c #2C2C5D",
-"fu c #3535DD",
-"fv c #353573",
-"fw c #262657",
-"fx c #393963",
-"fy c #242455",
-/* pixels */
-"````````````````````````````````````````````````````````````````````````````````````````````````````",
-"``````````````````````````````````````e`bscwbscwbsbsbsbsbsbsbscw````````````````````````````````````",
-"````````````````````````````````bse`bscpbse`awawcwbsbsdqawawbsdxdxcwcw``````````````````````````````",
-"````````````````````````````e`eddxfqcwcpfqfqawawdqawdqawawfqcwawawfqfqe`cw``````````````````````````",
-"````````````````````````cie`e`dxfqboboawfpfpdqfpbafpawfpdqbofpabdqfqfqedcfdee```````````````````````",
-"``````````````````````edede`cifqbodqabfpfpbabobaccbabafpbaddbaetfpfqabbobobodee`````````````````````",
-"````````````````````deedbvbvfxfxcfetboetfpcfewetddetetdaefetbaetabetbofxabcfedcici``````````````````",
-"``````````````````bdedbd`cabdefxababfxddetddcccjefbacjeaetddddcfdpdaddababb``cdeedde````````````````",
-"````````````````bvbdbvfx`cb`fxcfcffxdddaddefccaaeaefewbwdldadaddcoayddcvcfb``cbvbdbvci``````````````",
-"```````````````s`cbvbdb`b`b`cocvdddaddayf`braadlfrccdldzewdddaebddfcbwayfxcfb``cbd`cbd`s````````````",
-"````````````bd`sclclbjb`crb`arcofr`ubtbtfcdkaaewewdlcjdabtdabtcvddebayaycadoarb``c`n`ncl`s``````````",
-"``````````bdbv`c`ccub`b`b`ascrdp`fcadzaqbwfjebcjeaccewaaccdlfrdlegbw`f`lcab`crcrcrclclelbpbd````````",
-"``````````bnbmcuclclcrb``pararcv`ff`fcegf`dzewcjcjeqdleabkavf`fc`mbrcaegfcaycabjararcrae`sbm````````",
-"````````evaedycragcacvb`apcrasbwf``faybtavekewaddleqdkccccdkbrdzfcavapbrfhf`biascac`bjcuel`kbf``````",
-"````````aeae`vcldo`acrcacr`fbtddaqapebceckbleqdzdseqaaadekdwebdkavceapbrbt`fftamcrbybjaeclbpbp``````",
-"```````rfnbeakdocubzarfw`faiarbraqegejbkcheqeqekd``oefekewdzchekbkaqfhbtbkapcrcacr`j`vdocbbpfn`t````",
-"``````cz`zdoakbccbbyasdr`fap`uf`fcejck`obkdl`odmfudwecdwaadzbkdzdbaz`legaqftar`fcadofbdobjafdccm````",
-"``````bfehdc`aeefifbftaiambw`gavbkblck`gckd`eqecec`hfgd`addsepbkfvfkapazavf`fw`fbycrcd`a`vehbubp````",
-"`````tbuehdyfbasdocaapayayebebbteq`geqchfvdwecbqdkaddsfudwdzbkckdwfjbrapf`bwf`byfwbyasdr`iezbucy`t``",
-"`````yfnfieu`bdi`abydn`mfcf`f`egdbavdbec`odwcefgecdsd`dmbqepceeqf`az`wejdbbrambi`lcdft`bcbc``va`ei``",
-"````a`eoenfifsaycrbyfl`mfc`uan`webceebdmer`gdwbqdsdsdmdmbqekdkeccechckfkejegfhbiftarby`a`v`vfiffbu``",
-"````fmcycxdidt`iardpdnemanavflejazeqesepcefgblerfud`fgfderfgdkdsdkdzfkeqbkapapbt`lctfceuas`vcydhfn``",
-"````ehdheudtagbybjcabidnapapfcebejblchcheqer`hbqbqerbqfufgecdsebcedkbkbleqf`fjambicaaycu`vcxa`du`y``",
-"````fnfndhdtbgdobybifocnbwameqckdgeqeqfdesfdfgfgdwflfddmfufudwch`odschflejebdvayby`pee`vcbacfndcbu``",
-"````bube`vacfe`iembyfc`f`ufc`wdveqdkeqflfddwfudm`her`hd`fgbqecd`ecbbflfkfjapdvbwdnftas`jfifieh`yeo``",
-"````ffehdhdhdrcqalft`jembtai`wfkdg`obbesbldmfddm`gecfud`dmbbdw`ochbl`ufkap`weganaiar`j`j`ddu`adhff``",
-"````ffdcdrdtbj`a`pfhfebibh`legfkesapaqeq`obqbqfddkfu`hd`dwfkchdw`wcheq`ufjemfyaucdby`peectduezdhbu``",
-"`````tfadhag`v`iee`fcqfweefleyanaqfjazazebfg`g`qfu`hadcher`q`h`gazdwaibbap`lfw`waybxct`aagcbeueofn``",
-"````eoa`ffcbfididr`eaxeybzbhcgaqepdlbkckazeqds`qfueqfdblefeqdzchdg`wfheyamey`laibyalbiagdraodheheo``",
-"````at`ydhdh`dfsal`pfyalfyemeyey`waqdgazckepbkdw`qekepecfjdmejflazfj`ubw`lbiftaxee`beecbcbbcdu`ta```",
-"````a`a`a`ficbalcqeeauct`fcgdffyflejapds`wefdleradewegaaegeseqbr`lfl`u`megamamctfb`vfebc`deudceoat``",
-"``````eofffacb`abyftcbbybtfcanfwaidvapepap`wegazdzdlek`uerfgepdgfj`laqdncn`mbyfoct`p`vbgacezdhbu````",
-"```````yffdhfsficbeealbybxbiemcncnamflch`u`uccew`udgdlf``wdldbcgflanbweefycnaxeeacezfsdyfmdh`y`t````",
-"```````teoeiezajdcdc`ealeeai`jaxaiamcgavaiew`ucc`w`mandzanebflfcamfldvbiemdffw`pfeezcbdcbpeh`yeo````",
-"`````````tfffffmaoakdtalamfbdremfjamaiaidffraiddegdbfhancnbrdn`mamegfwaxfocgftct`x`efeezeifn`t``````",
-"````````ex`tehbeezdubydialcdaxcnbidndfbhfwbweydf`mandfcgdvananfyfofycncgcnaxfoacbg`e`pfadueiex``````",
-"```````````rbufndcajacfscbbycqfofodnaifhfyai`paxcnfweyddcg`pcgfwfofedifeaxbyalfs`j`kduehfmfm````````",
-"```````````yeifndhbefsao`vaxbxbxcsfebyfwbzfybidfcgbjfwaidnambibybzbx`afocdbc`vfidtezajbueha`````````",
-"`````````````y`r`rezduaocxficb`jfw`abz`jct`jdnfwbzfwdnaufofofw`afo`i`ddiducb`zdudcezdu`rex``````````",
-"``````````````evbudjfmajcbagbcctbcfwcgaufoct`afofb`afodf`jbzemfobx`dfe`val`xczdjbebpdccm````````````",
-"````````````````evcmezfneufsaoelcqcxctfeaufecsfectbxbzfeae`b`jdrc``b`x`ecb`zbpfmfmeiev``````````````",
-"``````````````````ffbubpfiafafbmbc`vag`bc`csdr`j`bct`jfefbcxcx`j`xdificxacbeenbfev`t````````````````",
-"````````````````````cmczczdy`zak`kcucucudrcuaecxc`cxdrcxaeelak`vc``jajakbpafbfbf`r``````````````````",
-"``````````````````````cmczbpdjdc`kcxelaoelakagbc`aaeel`bbxakakeu`zdtbm`zdjbpevbf````````````````````",
-"````````````````````````cmbfeibfbmeuel`kelelafelelakaeelaf`k`k`zdjbebm`zbncmah``````````````````````",
-"````````````````````````````czbnczbp`zafbmaedyafelbmdy`zdybeczdjczbf`kbpex``````````````````````````",
-"`````````````````````````````````sevdjbncz`zdj`sczcz`k`k`s`sdjbfahevbn``````````````````````````````",
-"``````````````````````````````````````evah`sbncz`kev`sbnczbnczah````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass10[] = {
-/* width height ncolors chars_per_pixel */
-"60 60 189 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #36366C",
-"dr c #48486D",
-"ds c #23234C",
-"dt c #37377A",
-"du c #20203F",
-"dv c #1E1E3D",
-"dw c #26265C",
-"dx c #313174",
-"dy c #4C4C60",
-"dz c #27273F",
-"e` c #3C3C78",
-"ea c #48485C",
-"eb c white",
-"ec c #383874",
-"ed c #333379",
-"ee c #444458",
-"ef c #272756",
-"eg c #47477C",
-"eh c #32326E",
-"ei c #1B1B33",
-"ej c #1E1E2C",
-"ek c #30306C",
-"el c #40407F",
-"em c #292944",
-"en c #212150",
-"eo c #23233E",
-"ep c #141422",
-"eq c #343473",
-"er c #323271",
-"es c #2D2D76",
-"et c #2E2E6D",
-"eu c #40406E",
-"ev c #21213F",
-"ew c #272731",
-"ex c #8080BA",
-"ey c #23232D",
-"ez c #25255A",
-"f` c #1B1B39",
-"fa c #35356D",
-"fb c #191937",
-"fc c #262651",
-"fd c #313169",
-"fe c #2C2C6E",
-"ff c #22224D",
-"fg c #18182C",
-"fh c #373786",
-"fi c #2D2D65",
-"fj c #232344",
-"fk c #2B2B63",
-"fl c #292961",
-"fm c #27275F",
-"fn c #202037",
-"fo c #1C1C33",
-"fp c #242452",
-"fq c #45456F",
-"fr c #484868",
-"fs c #535380",
-"ft c #1F1F43",
-"fu c #2C2C5D",
-"fv c #3535DD",
-"fw c #353573",
-"fx c #262657",
-"fy c #393963",
-"fz c #242455",
-/* pixels */
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````bsbsbsbsbsbsbsbsbsbsbscxbs``````````````````````````````````````````````",
-"``````````````````````````````````````````dycxdydycxawawawbsbsbsawcxcxcqdycxcxbs````````````````````````````````````````",
-"````````````````````````````````````dyeacxfrawcqawfrawcqcxawcqawawawawawawfrfrcxcqeabs``````````````````````````````````",
-"````````````````````````````````dfeadydyawcqawawfrcqawawdrawcqawawfqawcqcqfrawawfrdyeaeadf``````````````````````````````",
-"``````````````````````````````eadyeadyfreedrboawfqfqfqdrfqeufqawbaawbabofqeufqdrcqfreeboeadf````````````````````````````",
-"``````````````````````````dydffrbocjfrfrdrfrfrfqfqbabofrfqfsbaeubafqfqcgeubafqdrbaabbobobocjeedf````````````````````````",
-"````````````````````````dfeeeadffyboeecgeufrfreufqeueueucgbaeubadrdbbacdbaeucgbabocpboboabboeaeebd``````````````````````",
-"``````````````````````bdbdcjbd`cfyeefybaabcgfyeubaabdmfseudbdefsaackdbeudebaeudedebocgbofyfycjcjeecj````````````````````",
-"````````````````````cjdfabbvb`cg`cfyfyfycgabcgdeckbrfscddecdcddmdmfsabdeeucwcpdbdbcgcgcp`cbvbvcjbvbdcj``````````````````",
-"``````````````````bdbddfbv`ccgfyb`cgcgcpfycwdedbdbcdadcdexexckcd`u`uegdedbdbaycpaydecpcpb`bvfybvbdcj`s`s````````````````",
-"````````````````dfbdcjbvbd`c`c`cb`cpcwcgdededqayfabrcdexdbcdcdcddeexebbrdbecdedqcwfdaycpcgarb`b`bd`cbd`sbd``````````````",
-"```````````````sbdbd`n`ncmcscsarcscwcpdbbtbwbwbtbrfaebexegexaddbdeeceldqbrbrdqbtbkaybt`fbjcscpb`b``ncmctbdbd````````````",
-"``````````````aebd`c`ncmcsb`cwayascsdebraybwbrfdbtazdmdeexaddladexckdedmdme`btay`lcbcscwarasfucpb`cmcmae`nbd````````````",
-"`````````````saeeo`nbjcmcsarar`paycsbtcb`fbrbtfkfdciecdmdqebcdaacddmece`elbrazfabr`f`wbwbtarbzcsascsarbjbm`kbn``````````",
-"``````````ewd`ae`z`c`zbjcsb`cscscwcwbrbravbtecbrfackaadmckexavciexdme`bkfabtapanbr`ffabtfdbtdpcscsbjbjdpbeae`s`s````````",
-"``````````ahcm`kcm`bdparaycsay`fcscsfdbrfibwbtbrfdeqcd`qdmelbkeldmexdmeqdce`faerdcapbtbwfa`waucscscvdpdpafcmae`n````````",
-"````````cncmaeakcmct`adpcsarcbcbbwdqdeapamdcehcfclbldlbldmeqeradexade`esecelehehdc`ubrbrbtfucsbhcsas`actbecmbpbpey``````",
-"````````ejbpeo`vctcv`abzb`ef`ffxfucbbwapbldcdheqetesdlfwdmescfcddmdmdmbkbleldldhaq`ubrfabtcbcsbtcs`pcccycm`veobe`t``````",
-"`````````rae`aajevdjdsasas`jbifiapbrbtav`uapclcfdlad`odndnfvdxededexegeceqe`e`cfbybydcbrfmcwcbfdcbbjdjca`bcv`zdd`t``````",
-"``````ej`rbu`vcvcv`vcyfcbzefbz`f`uclapfderfeerclerdldlerdada`hedfhe`aacferdtcfciazapfk`ubramcbfuararbzfc`zaeaofo`t`r````",
-"``````bpfodibedsdp`jcs`abwbh`lfadccidcecerclet`gfe`hdxdx`hededdt`hdaelcfereterer`wbk`ubtfdbtef`fefcb`paudpbcdiczdi`y````",
-"``````ejddddemfcbjefcscs`faycedcececapciazcieqbldterdxdnbqelcdfhfv`h`oe`ererdnetfkfdekfabwbtfubifxfcar`affdpf``yepfo````",
-"`````tej`ycyevcuctftbzefdoaiapaqbrbrehfw`udcfwda`oerekfhfhdxdtdaes`hbqfwcferbkehflfkekcffabwfuco`lbzcsbzftbccaevfneja```",
-"````atddddem`xaocscsar`pdwdwfibwapbyapeccfdlcf`hdnfmbl`hfhdtdt`hclfvbq`qfhdxbkcfcl`gfkehfa`ufufpamaycsaydjcc`v`vfoepat``",
-"````ejfgbucy`vccceaseffdfldgai`ubbfzfdazazcfblereqdt`hdnbq`hedbqfedndndte`dtdtdletfmdhehfkapapbt`mdgfubzacdp`xf`dicz`y``",
-"````budddi`x`vevdpcsbzcwfxai`mapfdflfaavblercibkcffhcl`gfvfvfvdadaedclcfcfdteqecdcfkercfav`lbt`famchfdcsbe`bcaczfjbefg``",
-"````a`buepccevcrdpbzbzcbfxbifdfififacfekazereretblfe`hfhbqesesdnfh`h`hbq`hfwecdldcerclavecaqaqfifxbhbzbzcv`xfjfodufnat``",
-"````atepbufodualfcdp`lauauchfi`lapek`gcicieretfecl`gfhed`hesfm`gfefvfvfvdxbl`oederetfm`wdlfkfxaybzau`d`j`xduf`fgdufga```",
-"`````yepddfjacccbz`benamfd`f`mfdbr`mdwcidtcfclfmfebldadneddnesdadadx`hdaededdaclflfmflfmehbyaiaydofuarasftccfjdidiei`t``",
-"````a``yczczfbbcbc`bacficucraqfdanfkflaz`oehbbesbldndxfefefeesfvbqbqdnbbdtedciciazaqfkazaz`ubw`laicbas`pdjcccc`advddat``",
-"````fo`yddccf`fcalcefucbcufpbi`fbyav`wazbt`ucldxed`hblescldn`hbqdndncl`gazedazazazfw`wekfzanameffucbbzbxbz`jf`fbevbuep``",
-"````at`yfbaccy`a`bdsceaiffbzbichfi`manekaq`uclbkcffheletfvesfh`hesdx`qclci`gfkapap`wekapezanfzaifubxeffcfc`bdubufgepat``",
-"````a`czdvf`bcdv`bffbzbicrax`fbiezcofifiekbkfk`geredeserbqdndndtadfhazcfblfecl`u`laiflaq`f`lez`ucbdgff`j`bdpccdddiepep``",
-"````atczdidvaocy`v`edsbcaxdwbxfzefchameqecdlbl`gazdh`qfhaaadelesfhdaflblbkblerazapfidwbhchaqdobibzalfp`pccbgdveiczepat``",
-"````a`epfoczdi`dccac`jaufzcraxaubxdwez`wfkehekbbclbkelaa`obqeleddldafkdmekfm`wfk`wfibwfidobhaiaxef`j`pdsbcacbcaodiddat``",
-"``````eifgczevccfbau`jefdgffbhamaxfxezfd`w`l`odl`udcbk`wdneldtegadaaazetdlfmanan`waqfkehfifpbic``p`dbzagftao`vdifbfg````",
-"``````a``yfgdv`b`v`ifcbz`b`ibwbtamfxfxfmfxekdhcfby`lciehec`wdlaverapcdecelaz`lby`lfidofiap`mcefxfp`idsagbcagajeicza`````",
-"``````ata`czfbdv`vdjceasac`ibiamfian`maifxanazehave`apekehap`uege`ecazcfbkekdwfkfifiauchefbiencuftbcdvfbfof`fbdi`y`y````",
-"`````````yczbudvdvdvfbcubgfcaucrbicraxfzchco`wekfke`aqflav`uaa`udm`u`w`uamfzchfmanameffpdgaidgfpaldvaoevf``zfbfgbu``````",
-"````````a``tejeif`ajddajdsccbz`pbi`jfpdoanfzanbtai`f`ufkfkdq`lanebexaidcfme`fafiancodgenenbiai`pcracccf`bpddbufg`t``````",
-"`````````t`yfgfgbpacaoakdubgbiauffdsenanfidoamaidgcdcoezbtecdc`mdmanbifidoanan`uapfzaxfpfpbhcecr`xbcbgbxddbufoej`t``````",
-"```````````t`yfoddaodidv`i`xaleffpc`chfxamchezaichezfmfzanbwanfpcb`famfkanfxfzezcoanbifxc`ffefacbgccacf`ddddej`t````````",
-"```````````tcnfobpdvbgdvbgbxftefbibxaiaudofzaxfichanfxfpfxezananfxchdgefezfzfxcuc`crdsfpcubz`jft`eeofcfbfoejfg`r````````",
-"````````````eyfgbudiaoajbgdvbecrfpfpff`bffefbwaichchdgdgbhdgbjbidoaicofxfpaicubxds`afpdgas`e`vduag`z`zajdibuey``````````",
-"```````````````t`rbuddeodvft`zalbccr`ec``bc`auenfp`jezchfxaidpc`fxdgfpfiamfcdgfxcvcrfcfpalcr`zbeajf`dvajbfey````````````",
-"```````````````rbfbpfofbbgdvaffjfjcc`jfxbxfcc``b`bdsbiau`jc`biaibifxfpfcch`afpc``d`d`vdvfjfj`zdvajfbdvbp`tcn````````````",
-"````````````````cnfnfnbpfnaoftftdj`ecuftfpaubidgfp`j`bfcfpfc`afpdgc``jfpencuc``b`j`e`vcrevdkdzewbefnfobfej``````````````",
-"``````````````````bffnfnajfodvddccftaf`e`b`jdgcuai`jcv`jc`fcdj`jbxcvcvdsdsbxbxdjcr`xbxdjft`z`zddbefnbf`r````````````````",
-"````````````````````d`eyewbeduak`zfjemcads`dfp`jdj`b`bcu`jcudgfpefds`bcacacvctct`dagak`xaoddbeeybpfn`r``````````````````",
-"``````````````````````eyfnbpdkdz`z`zbmakfj`bag`v`dctctctctem`d`ecvctaeaeafcu`v`ecc`zakafbp`kbpewbfew````````````````````",
-"````````````````````````eyeybfbpdk`zemcvcyafemakcvcvaeaeffdjcvcv`j`vae`vemaf`vagcc`z`z`zeodkbfd`ey``````````````````````",
-"``````````````````````````cnbnfobe`kbe`kevemdzfj`k`z`b`edjctaeaeemds`eaf`vevdzdjafemd`dk`zbfd`ey````````````````````````",
-"``````````````````````````````bncneybf`kbeaf`kememem`kcvafemakaeaeakemem`kdk`z`kbebm`zd`d`ah````````````````````````````",
-"````````````````````````````````ahcnewd`dk`z`zaeaf`kaf`k`vemaedzcvakak`z`kdzd`dkdkbmbfbnah``````````````````````````````",
-"````````````````````````````````````cncnbf`z`sd``s`k`z`s`zbm`s`kd`d``s`s`k`kd`ahd`bncn``````````````````````````````````",
-"``````````````````````````````````````````bnd``s`s`kbnd`d`bfd``kbnbnd`bnd`ewahbn````````````````````````````````````````",
-"````````````````````````````````````````````````ahbnahbnd`ewdkbfewahahewbn``````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
-};
-/* XPM */
-static char *glass11[] = {
-/* width height ncolors chars_per_pixel */
-"72 72 189 2",
-/* colors */
-"`` c None",
-"`a c #27274E",
-"`b c #25254C",
-"`c c #383858",
-"`d c #23234A",
-"`e c #212148",
-"`f c #2E2E62",
-"`g c #292967",
-"`h c #3535A1",
-"`i c #272751",
-"`j c #23234D",
-"`k c #29293F",
-"`l c #2C2C63",
-"`m c #2A2A61",
-"`n c #33334C",
-"`o c #353579",
-"`p c #272754",
-"`q c #414188",
-"`r c #20202C",
-"`s c #2E2E3D",
-"`t c #1C1C28",
-"`u c #2E2E68",
-"`v c #242447",
-"`w c #2C2C66",
-"`x c #222245",
-"`y c #181824",
-"`z c #25253E",
-"a` c #161622",
-"aa c #B9B9ED",
-"ab c #3E3E67",
-"ac c #1C1C3F",
-"ad c #6767A3",
-"ae c #2B2B47",
-"af c #272743",
-"ag c #222248",
-"ah c #292931",
-"ai c #29295C",
-"aj c #1D1D39",
-"ak c #252544",
-"al c #1E1E47",
-"am c #2B2B61",
-"an c #29295F",
-"ao c #1F1F3E",
-"ap c #2F2F68",
-"aq c #2D2D66",
-"ar c #30305F",
-"as c #2C2C5B",
-"at c #11111C",
-"au c #262655",
-"av c #31316D",
-"aw c #4C4C6D",
-"ax c #222251",
-"ay c #323264",
-"az c #2D2D69",
-"b` c #33335B",
-"ba c #43436E",
-"bb c #2B2B67",
-"bc c #212146",
-"bd c #37374B",
-"be c #22223D",
-"bf c #252536",
-"bg c #1D1D42",
-"bh c #2A2A5C",
-"bi c #28285A",
-"bj c #2B2B53",
-"bk c #333372",
-"bl c #2F2F6E",
-"bm c #2B2B3F",
-"bn c #2C2C36",
-"bo c #424266",
-"bp c #232337",
-"bq c #2F2FB0",
-"br c #34346C",
-"bs c #525265",
-"bt c #32326A",
-"bu c #1B1B2F",
-"bv c #3B3B55",
-"bw c #303068",
-"bx c #21214C",
-"by c #2C2C64",
-"bz c #292957",
-"c` c #232351",
-"ca c #26264A",
-"cb c #2F2F60",
-"cc c #202044",
-"cd c #5D5D97",
-"ce c #2B2B5C",
-"cf c #363674",
-"cg c #3C3C66",
-"ch c #252556",
-"ci c #30306E",
-"cj c #3E3E54",
-"ck c #414178",
-"cl c #2C2C6A",
-"cm c #2F2F4F",
-"cn c #25252E",
-"co c #27275B",
-"cp c #363663",
-"cq c #4C4C68",
-"cr c #20204A",
-"cs c #2E2E5B",
-"ct c #29294C",
-"cu c #242451",
-"cv c #27274A",
-"cw c #343464",
-"cx c #4F4F64",
-"cy c #252548",
-"cz c #16162C",
-"d` c #292938",
-"da c #333384",
-"db c #3C3C6F",
-"dc c #353572",
-"dd c #1E1E37",
-"de c #38386B",
-"df c #414156",
-"dg c #242454",
-"dh c #31316E",
-"di c #181831",
-"dj c #232349",
-"dk c #272739",
-"dl c #393979",
-"dm c #4C4C85",
-"dn c #2F2F83",
-"do c #28285B",
-"dp c #292952",
-"dq c #36366C",
-"dr c #48486D",
-"ds c #23234C",
-"dt c #37377A",
-"du c #20203F",
-"dv c #1E1E3D",
-"dw c #26265C",
-"dx c #313174",
-"dy c #4C4C60",
-"dz c #27273F",
-"e` c #3C3C78",
-"ea c #48485C",
-"eb c white",
-"ec c #383874",
-"ed c #333379",
-"ee c #444458",
-"ef c #272756",
-"eg c #47477C",
-"eh c #32326E",
-"ei c #1B1B33",
-"ej c #1E1E2C",
-"ek c #30306C",
-"el c #40407F",
-"em c #292944",
-"en c #212150",
-"eo c #23233E",
-"ep c #141422",
-"eq c #343473",
-"er c #323271",
-"es c #2D2D76",
-"et c #2E2E6D",
-"eu c #40406E",
-"ev c #21213F",
-"ew c #272731",
-"ex c #8080BA",
-"ey c #23232D",
-"ez c #25255A",
-"f` c #1B1B39",
-"fa c #35356D",
-"fb c #191937",
-"fc c #262651",
-"fd c #313169",
-"fe c #2C2C6E",
-"ff c #22224D",
-"fg c #18182C",
-"fh c #373786",
-"fi c #2D2D65",
-"fj c #232344",
-"fk c #2B2B63",
-"fl c #292961",
-"fm c #27275F",
-"fn c #202037",
-"fo c #1C1C33",
-"fp c #242452",
-"fq c #45456F",
-"fr c #484868",
-"fs c #535380",
-"ft c #1F1F43",
-"fu c #2C2C5D",
-"fv c #3535DD",
-"fw c #353573",
-"fx c #262657",
-"fy c #393963",
-"fz c #242455",
-/* pixels */
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"``````````````````````````````````````````````````````````````bsbsbsbsbsbsdydybsbsea````````````````````````````````````````````````````````````",
-"``````````````````````````````````````````````````````eabsbsdybsbsbsbsbsbscqcxbsbsbsbsbscxdy````````````````````````````````````````````````````",
-"````````````````````````````````````````````````dydybsbsdycqcqdycxbsbsfrcqcxdyfrcqcxcxbseacxcxbsbs``````````````````````````````````````````````",
-"````````````````````````````````````````````eaeaeafrcqawawawdrdrawcxawawcqcqawawawawawbscqfrfrdycxcxea``````````````````````````````````````````",
-"````````````````````````````````````````frdfcxcqawcqcqawawfrcqdrawfrawawcqawawawfqawcqawcqdrawdrfrdycqdycx``````````````````````````````````````",
-"````````````````````````````````````eeeaeaeadycqdffrboboawfqfqfqdrdrfqbabadrdrdrdrbobodrdrbaawdrdyfreaeaboeeee``````````````````````````````````",
-"``````````````````````````````````eeeefreeeefrbofrfrbofrfqeudrbadrfqdrfqeubabababababafqdreufqfrbafrfreeeeeacjdf````````````````````````````````",
-"``````````````````````````````eecjboeebocjboboababboabdrfsfqfqbabobobafqfqawdrfqawbaeueudrdebafrbocgbobobobodfdfcjbd````````````````````````````",
-"````````````````````````````dfeeeedfcjbvab`ccgfyeuabboabbabaabdbadeucgdeabbabadbegfqfqfqbaeueueubobob`bocgcgdfeacjcjcj``````````````````````````",
-"``````````````````````````cjbddfcjbv`ccgdffycgfqbofyfyabdbeuabfqexbaeueudefqexadckdbbadedebaabdedeeufyboabcpfycjdfdfeecj````````````````````````",
-"````````````````````````cjcjdfdfbvb`cg`cfyfyfyfycgabcgdeeudbbregexdbdbadcddmegexeucgdedbdbayfydbdbabcgfycpb`bv`cbvcjdfbdcj``````````````````````",
-"``````````````````````bdbdcjbvbvfy`c`cb`cpcgfyfyfycpdededbdeegexdmaaebexckaadm`ucddbdedbdbcwcpcpfddedeb`fyb`bvfycjcmbdcj`s`s````````````````````",
-"````````````````````bd`nbvbvbv`ccg`c`ccscpcwcwcgdebrcwbraydqckdbcdegegcdcdade`btdcadbrdqfabrdebrcpbwaycpfyfyb``car`n`nbdcjbnbd``````````````````",
-"```````````````````n`s`n`ncj`nb`b`b`b`b`b`arcpdqfabrbrcwaybtbrexadcddbadaae`dedeexaddbdqdebrdedbdededeayb`b`cpb`b`fy`n`c`ncmbdbd````````````````",
-"```````````````````n`sbdaecmcmcscscscpcscscpcwfsbwfiaqfdaybtecadexaafsexe`exckdbbtecdedqfdaycpbrekcbcsaycb`icsaycpb`b``ncm`naebd````````````````",
-"`````````````````scj`c`ccmctbjcsb`cparasascsdqayaybwecbwbrbrbbe`dee`ebadegcdexadegdbcdade`ecbrbwfk`ffuarcwarcscscscpcscmcmct`nd`bd``````````````",
-"```````````````s`saecv`nbjaecmasarar`parcsayfdcb`fbrbtaq`fbtciecdmdbdeebcdebcdebehece`egfabtaqecbrcbazap`fayarcsas`casbjarcmem`n`sbn````````````",
-"``````````````ew`s`zcv`nevcmbjcscsbzcscwaydedqbwavfafdfadcdcckadebcke`aaehdhadebe`dcehdcbtbran`fbr`fbrfibtayaybzbjarcsb`bjbjafbm`sae````````````",
-"````````````bnaeae`kcmagdjfuaycsb``ffucscsbtbwdcaqfifdfabwave`exaaadcdcddh`oecadcddmfwapdbe`fdaqbrapbtbtfdecaqbhbzarcs`adpcmaf`zcmcncn``````````",
-"````````````dz`n`kctcmct`idparcwaybw`farfubrdqbr`ffdfafaecekerdcfeazeleqavdmexaddmelcibkegbrbtbkfa`uehbwfifiambzfxcscs`abjbjakctcmcm`z``````````",
-"``````````ey`saf`zafbjcv`befascsfuar`ffdbrde`faq`wdcdcbkerclesdlcfdmcdblfwcdebaddmdldxercdecbkavbkapbrbtfdbt`fcbbwcbbjbzcactaebectfn`zey````````",
-"``````````a`bf`zcacvdpcv`icucscsbi`fefbhar`fbr`uekbrekcierdxdxdlcieleqes`odmelelexdmcfere`eldcetaqfibwfadcapcbcscsbtcsfcccakdp`vcv`zfncn````````",
-"`````````tbpaecvao`vcccydsbzcsbzffaifiekbwbtbrap`uekbber`odladdteddndnbqdxeqedeqebeleceqdtelelerbyfkavdcfiancwarbtfdcsbjdjfcbjctaebpddbpbf``````",
-"````````bf`rfodpevcv`vfjcybz`idpefbhayapetblapfdciblcleqeteqeldldxdxdadadaesdadtadcdcfereqdldcekapap`wflbwayamcbbhcbasasdp`pbjakcvfjfo`y`y``````",
-"````````ewdddidvdj`abzagdpcu`p`lbzambwfdbbclehdcerfeetetflfedaedbldxdadndaeddada`qdmcfeqdxdheqblfkap`waqfddq`fdgaycs`pcsefef`afjeveieifo`k``````",
-"```````ybfevei`zft`afubzcsas`fam`fbwfaecdcdcdccfetbbblcieretedesed`h`heldm`qdafvdndleceqercledetaqbrapbkfaayfabwbz`fbiascs`p`j`vftf`a`epbu`t````",
-"```````y`ybufnaefc`bdpcucs`pfubw`lbwbrdqdcehavfw`wcfcfereqfwercidt`hdae``qdtbqbqeddle`cfdtdxercifk`uavavecbwbw`fbz`m`mefay`jbc`d`aaobua`fg`t````",
-"``````epbuddcvfjefca`bdsbzbzbhezbyaqaqbrdqehecdcfddccfeqdaedblazdtfhfhdxdtdnfednfvfvcfdtererdcehfl`wfkbkfafaap`fcefifiasasfudjbc`bcadudda``t````",
-"``````a`foeoemak`adparcsarefaidwamapbwapbyazeheccfeccfdxbqesfmblesbqeldtdtbq`g`hfvbq`q`qeqerfweqclbbfmdhbwfa`ufubifxbtarcscb`b`bcv`v`vfgfgbu````",
-"````atejfgfgcy`v`bbcfuasef`ffiezchco`uazezezap`uekdlererereqeddadnfvfved`ofvesesbqfvdle`dleddtdlclfmfkerbr`mapfibtbi`lbzfufuccfccvccdvfg`yfoat``",
-"`````yfodiaj`v`v`x`bdpcsbzdeamamaxfkaqehfm`wav`ueteretbkbkcffhdxfednfefv`hbqdadxesfedtfwcfdtfwe`dcflcldlbkfdfibtap`fanfpayasao`idpagczfneifg`t``",
-"````atfgfofgagccao`abjasbzcbfufxbibtbwfdapecdlavekerblbkeqeqdaesfedafvdndn`hfvfv`hdxeddtdtcffwdlecdhcleqehbkaqaqfkfkco`f`fayafctdjcadiajdv`yfo``",
-"````atejbpczaocc`aaldpbzbzfudoen`mbtfiambtbtereretererbletetfeesbq`hfv`g`gdn`hdafhdabqfvbkbkdldlfwerclfkekecaqaqfdfidgef`b`pctccftakfoajfgbua```",
-"````ata`befofoft`daldp`p`laubzambi`lby`lehfm`gavciererclfe`g`gfhdtdxed`g`gesfmdnfvfvdndnetdxedblblazfmfmapec`mfzcbarc`bzbxfcaoccftf`fgbcepfgbu``",
-"`````y`yevbefjdv`xfpdp`jenbifd`lfufkfdbtazdw`merdtdtci`g`gfebledfhesdnfeesdafvededfvdaed`hdadaclflfmflezfibtbycobwfudgfuarfuds`v`xaodidia`atat``",
-"````atfgaobudif`acfp`ebxacfu`fc`fxfdfdan`mdw`gaz`ocfekcletesdndxfecletesdn`h`hfvfhedclfheqfherek`gbyazfm`uaz`ubtamanfucbceaufcccccducaevfoatat``",
-"````atfoejfof`fbcc`jcrbheffufualaxamfiancifkbbciehekflcleleqdadxfedn`gbq`hfvesdnblfmflbberedcletazeqazehapfm`w`lfubzcbcsbzcr`jdpacf`ftdvfn`yat``",
-"````atfgbufodjfjdudp`afpfu`l`jfcbiefdoapavfkfketazbyazbldxdt`hes`hesdxdx`h`hesdndaet`gazeler`wazdhdhcidhanbxezfzchbibh`p`pfceffffcf`czfodd`yat``",
-"````atatczdif``b`v`v`afffu`facfcfubidgfmcoez`lapbbap`gbbedecfhedetdaesesfv`h`qcifhfhdadletfl`wekfianfkcifk`lfkchfl`lbzcrcufc`ift`aaodddda`buat``",
-"````at`tdif`dvagcycc`iff`pefcraxfz`fbianezfkap`uehfw`ufl`gcieqcderfh`hdnedeqdcfedmazdldxdl`gazaq`lfmfmdwfi`l`lan`wfdfucrc`fp`b`d`daoddbufnatat``",
-"``````fga`f`dvdvcycc`xffdsdscrchezcrfzeffxezfieqecdlbkfebbcidh`qfhfhad`qelfedndadnfkblcfclcierazapaqdwaibhchaqanfxcecealfpef`x`bdvf`eiczfg`y````",
-"``````at`yeiczeiajftftac`j`pfpaxalaxefbxfzch`maqfkbkerazclblbkdmdtdaaaedexfvaddafe`udmblflfkazbbazaqfiaqanbiamanaxfpbzds`pfcbcccdvftaoei`yep````",
-"``````a`a`didif`f`acbxalfp`pbxax`jcefufzfzfmfmbbfifkfibkdhaveqelexfv`qcddndmcdadfeekdl`hflanfkfm`wfdfkapapbhcuefchcuau`bbz`jacccf``vdidvat`y````",
-"``````a`epfoczdv`baoacefbxbzcscr`pfi`fcochchezez`mavekdcecfmfmdmfa`wdlapexcdcddmaabbazes`wfd`lan`maqaibwehapcofiauauau`befalbcdp`ddvfodieiat````",
-"````````ata`difbftao`a`bbzfu`bagbzfdbrfiandoaiaifp`wekeqfw`wfkeke`apckaqelecerfkckcdfherer`ufk`wbyaqaidoanamanbzcufx`b`pbgbcbgccagdieiczep``````",
-"````````at`yfgf`difbctagbzascrbcefaubififx`lananezdo`mcidhapav`uelcddcecape`dcflfaekbkeqekdwcofkfiapaidgefchbic`ffalftaldvf`bpf`fbdidia`a```````",
-"````````at`yczddeiaof`dvfb`jbgccasc`crbhcrfpenchchcoanekeh`we``wfkelececaaek`qcdaqfk`ufiezdgdwfman`lbhenfzfzaifpcealcraoaodueobeajdifg`ya```````",
-"``````````a`bueibueiajajddddbcbgalbzfcbh`j`pfpdoaichchavapdodmbtbyad`mfkbydweccfckaielfmbybt`l`mcodwanaxaxenbifxbzdsbxf`ftacfndkajfofgfg````````",
-"``````````a``teifgbubeftdvafccbgalamef`j`dbxcofkaqcodo`famdgdeanaidqanape``me`fiaianfk`m`mbwfdapaqfzffenfpc`bhfu`pftagagft`jddddfofofga`````````",
-"````````````fg`tbueibpf`dvevfbevbgfpfpcrenbxaxamfiananfkbiaxfpezezfxfkecbwbifzch`mezfiamdocochfi`lcobibibzfpfpbzcufjevccac`efgbubu`tej``````````",
-"`````````````tbu`rejf`aodidvdjfcagacbzbhaxdochfxanfzfpbiaichanbychchchbt`lfzbhezcofxaiaichchaufzc`fxch`jdoffenefbgalbgbcbccceiddfo`y`r``````````",
-"```````````````rejeifodvdvajacbcccccdgbibxfpdgaufuezfz`manfzanfxaufp`fcodocoezchchenauchfxchefff`jagffbxenbzbi`dftbc`edz`df`buddbudd````````````",
-"```````````````y`rbuf`diaoajacbgevevcrfpfpfp`afffffc`faqfxchchfzc`dgfxdgbjfxaiaiancofxfpcodg`bffds`adgbxbzbz`e`v`vftbeev`zajf`ddei`t````````````",
-"`````````````````yfoeyfbaj`zajbgevakalbxcccu`e`b`bc`efbic`axaxchfxfpezchbjfcdodochfx`fanbzcuaufxcv`bfp`pef`e`eeoeoaof`f`ajdv`rfn`r``````````````",
-"``````````````````cn`rejeidvacdveoak`vccccfffpbibx`ac``jcucu`jfxbifxfpfxfxfxcodgc`aybiai`i`jch`j`a`edjagacbc`x`zfnddajf`eodvey`t````````````````",
-"``````````````````eybfej`rejfoaoevcccc`v`xbcc`c`fffpbicubxcucuffc`cu`pfcfpdgbhdoaucu`jcuffbxbx`bcr`efjagbcfjeodkeodkevddfobpcney````````````````",
-"````````````````````eyejbpejbpdddvaoaodjbcagbcft`jefchfxbiauc``a`ac`c`fc`afcfccufcenfp`jfffp`jdsfpftcycrbcccdz`zdkbebebfddbf`r``````````````````",
-"``````````````````````cnbpeyfofofodudd`eacdjafcr`d`dcufpffef`jca`bff`jfcbxcuc`dsaecv`d`jds`dcy`vag`xagbcfteo`zbpfnbpbfej`r`r````````````````````",
-"````````````````````````d`bpddbfbebgak`zfj`z`kdsdsbxffff`bdj`b`b`jcucucudgcueffp`b`bcacacvcvctct`dagcyfjccevddeoeybpd`ej`r``````````````````````",
-"``````````````````````````eyddbp`r`k`z`zdzem`kfjfj`b`d`vdjcyctctcactctcv`dcr`bcvctaeaecv`b`jfjdsccakcveoakbedz`zd`ahewah````````````````````````",
-"````````````````````````````ewcnbnbndd`kdzfjdzemakemae`zcv`dcaaeaecy`e`acadsag`vaeaecvakaffjcacrbcajfj`zbp`z`kfnewewcn``````````````````````````",
-"```````````````````````````````rewbfbp`z`zbedzafcyakembeafctcaak`d`v`acvaeae`dff`dag`baeakfj`zcy`zbm`z`z`k`zbfd`ahcn````````````````````````````",
-"```````````````````````````````````sd`eyfnbmeobm`zdz`saf`v`k`kcvbcag`bcvemaeaecvagcyaecvevafaf`zem`zd`dkbmd`bfbf````````````````````````````````",
-"````````````````````````````````````ahewfoewbf`k`z`zdz`zafemememcvaf`kdz`vafaeafakemembmbpafdkdkbp`k`zbp`seyah``````````````````````````````````",
-"`````````````````````````````````````````sah`zewdk`z`zdzaeaf`kemdzakakaeae`kemakemeo`z`kemdkbfbpdk`kd`d`bn``````````````````````````````````````",
-"````````````````````````````````````````````ahbnbf`zd`d``sbm`kdz`sdkdk`sae`k`zbmd``k`sbmdz`kbnah`s`sbn``````````````````````````````````````````",
-"````````````````````````````````````````````````bncnbmbnd`dkdkdkdkbm`sbnbnbndzd`d``sbm`sbfd`bnewah``````````````````````````````````````````````",
-"``````````````````````````````````````````````````````cnd``s`s`sahd`dkbmbnbn`sbnd`bnbn`newah````````````````````````````````````````````````````",
-"``````````````````````````````````````````````````````````````ahcn`sbnahewbn`sewahbn````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````",
-"````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````"
-};
-char **default_bubbles[] = {glass1, glass2, glass3, glass4, glass5, glass6, glass7, glass8, glass9, glass10, glass11, (char **)0};
-
-int num_default_bubbles = 11;
-
-#endif /* NO_DEFAULT_BUBBLE */
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1993, 1994
- * Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* decayscreen
- *
- * Based on slidescreen program from the xscreensaver application and the
- * decay program for Sun framebuffers. This is the comment from the decay.c
- * file:
-
- * decay.c
- * find the screen bitmap for the console and make it "decay" by
- * randomly shifting random rectangles by one pixelwidth at a time.
- *
- * by David Wald, 1988
- * rewritten by Natuerlich!
- * based on a similar "utility" on the Apollo ring at Yale.
-
- * X version by
- *
- * Vivek Khera <khera@cs.duke.edu>
- * 5-AUG-1993
- */
-
-#include "screenhack.h"
-
-static int sizex, sizey;
-static int delay;
-static GC gc;
-
-static void
-init_decay (dpy, window)
- Display *dpy;
- Window window;
-{
- XGCValues gcv;
- XWindowAttributes xgwa;
- int root_p;
- Pixmap pixmap;
-
- delay = get_integer_resource ("delay", "Integer");
- root_p = get_boolean_resource ("root", "Boolean");
-
- if (delay < 0) delay = 0;
-
- gcv.function = GXcopy;
- gcv.subwindow_mode = IncludeInferiors;
- gc = XCreateGC (dpy, window, GCForeground |GCFunction | GCSubwindowMode,
- &gcv);
-
- XGetWindowAttributes (dpy, window, &xgwa);
- sizex = xgwa.width;
- sizey = xgwa.height;
-
- copy_default_colormap_contents (dpy, xgwa.colormap, xgwa.visual);
- pixmap = grab_screen_image (dpy, window, root_p);
-}
-
-
-/*
- * perform one iteration of decay
- */
-static void
-decay1 (dpy, window)
- Display *dpy;
- Window window;
-{
- int left, top, width, height;
-
-#define nrnd(x) (random() % (x))
-
- switch (random() % 8) {
- case 0: /* move a block left */
- case 1:
- left = nrnd(sizex - 1) + 1;
- top = nrnd(sizey);
- width = nrnd(sizex - left);
- height = nrnd(sizey - top);
- XCopyArea (dpy, window, window, gc, left, top, width, height,
- left - 1, top);
- break;
- case 2: /* move a block right */
- case 3:
- left = nrnd(sizex - 1);
- top = nrnd(sizey);
- width = nrnd(sizex - 1 - left);
- height = nrnd(sizey - top);
- XCopyArea (dpy, window, window, gc, left, top, width, height,
- left + 1, top);
- break;
- case 4: /* move a block up */
- left = nrnd(sizex);
- top = nrnd(sizey - 1) + 1;
- width = nrnd(sizex - left);
- height = nrnd(sizey - top);
- XCopyArea (dpy, window, window, gc, left, top, width, height,
- left, top - 1);
- break;
- default: /* move block down (biased to this) */
- left = nrnd(sizex);
- top = nrnd(sizey - 1);
- width = nrnd(sizex - left);
- height = nrnd(sizey - 1 - top);
- XCopyArea (dpy, window, window, gc, left, top, width, height,
- left, top + 1);
- break;
- }
- XSync (dpy, True);
-#undef nrnd
-}
-
-\f
-char *progclass = "DecayScreen";
-
-char *defaults [] = {
- "DecayScreen.mappedWhenManaged:false",
- "DecayScreen.dontClearWindow: true",
- "*delay: 10",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-delay", ".delay", XrmoptionSepArg, 0 },
-};
-
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_decay (dpy, window);
- while (1) {
- decay1 (dpy, window);
- if (delay) usleep (delay);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "05-aug-93" "X Version 11"
-.SH NAME
-decayscreen - make a screen meltdown.
-.SH SYNOPSIS
-.B decayscreen
-[\-display \fIhost:display.screen\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIusecs\fP]
-.SH DESCRIPTION
-The \fIdecayscreen\fP program creates a melting effect by randomly
-shifting rectangles around the screen.
-.SH OPTIONS
-.I decayscreen
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-delay \fImicroseconds\fP
-Slow it down.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH "SEE ALSO"
-X(1),
-xscreensaver(1)
-.SH COPYRIGHT
-Copyright 1992 by Vivek Khera. Permission to use, copy, modify, distribute,
-and sell this software and its documentation for any purpose is hereby granted
-without fee, provided that the above copyright notice appear in all copies and
-that both that copyright notice and this permission notice appear in
-supporting documentation. No representations are made about the suitability
-of this software for any purpose. It is provided "as is" without express or
-implied warranty.
-.SH AUTHOR
-Vivek Khera <khera@cs.duke.edu>, 05-Aug-93; based on code by David Wald, 1988.
+++ /dev/null
-#define logo_width 464
-#define logo_height 435
-static unsigned char logo_bits[] = {
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0x60,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x60,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0x0f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfc,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfc,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf8,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfc,0xff,0xdf,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xdf,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x8f,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0xff,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0xff,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xff,0xff,0x07,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xff,0xff,0x07,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0xff,0x07,0xfe,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0x03,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0x03,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0xfc,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0x01,0xf8,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xe0,0xff,0xff,0,0xf0,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xe0,0xff,0xff,0,0xf0,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf0,0x07,0,0,
-0x80,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,
-0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0xff,0x03,0,0,0xe0,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfc,0xff,0xff,0,0,0,0,0,0xe0,0xff,0x07,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,
-0x7f,0xfe,0,0,0,0,0,0,0xfc,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x01,0xfe,
-0x01,0,0,0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x01,0xfe,0x01,0,
-0,0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0xff,0x07,0,0xce,0x07,0,0,0,
-0,0,0,0xfe,0x1f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfe,0x7f,0,0,0x87,0x1f,0,0,0,0,0,
-0,0xc0,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0xff,0x07,0,0x80,0x03,0x3e,0,0,0,0,0,0,0,
-0xfe,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,
-0x3f,0,0,0x80,0x03,0xf8,0,0,0,0,0,0,0,0xe0,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0x3f,0,
-0,0x80,0x03,0xf8,0,0,0,0,0,0,0,0xe0,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0x07,0,0,0xc0,
-0x01,0xe0,0x01,0,0,0,0,0,0,0,0xff,0x01,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0xc0,0xfb,0xff,
-0x0f,0,0,0,0,0,0,0,0xf0,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0xff,0x07,0,0xc0,0xff,0xff,0x3f,0,
-0,0,0,0,0,0,0x80,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0xc0,0xff,0x7f,0,0xe0,0xff,0xff,0x7f,0,0,0,
-0,0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x80,0xff,0xc0,0xff,0x7f,0,0xe0,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0x1f,
-0,0xf8,0xff,0x0f,0xf0,0x0f,0xc0,0xff,0x01,0,0,0,0,0,0,
-0,0xf0,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xe0,0x0f,0,0,
-0xff,0x7f,0xf0,0x01,0,0xf8,0x03,0,0,0,0,0,0,0,0xc0,
-0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,0x80,0xff,
-0x7b,0,0,0xe0,0x07,0,0,0,0,0,0,0,0,0xfe,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf8,0,0,0,0,0xfc,0x3f,0,
-0,0x80,0x1f,0,0,0,0,0,0,0,0,0xf0,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0,0,0,0,0xfc,0x3f,0,0,0x80,
-0x1f,0,0,0,0,0,0,0,0,0xf0,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x3c,0,0,0,0,0xe0,0x7f,0,0,0,0x7e,0,
-0,0,0,0,0,0,0,0xe0,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x3e,0,0,0,0,0,0xff,0x03,0,0,0x70,0,0,0,
-0,0,0,0,0,0x80,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,
-0,0,0,0,0,0xf0,0x1f,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfc,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0x0f,0,0,
-0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,
-0,0,0xf8,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,0,0,
-0xf8,0x07,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xe0,0x03,0,0,0,0,0,0,0xe0,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0x01,0,0,0,0,0,0,0x80,0xff,0,0,
-0,0,0,0,0,0,0,0,0,0,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xf8,0x01,0,0,0,0,0,0,0,0xfc,0x07,0,0,0,
-0,0,0,0,0,0,0,0,0x7c,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,
-0,0,0,0xfe,0x03,0,0,0,0xf0,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0,0,
-0,0xfe,0x03,0,0,0,0xf0,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfc,0,0,0xf0,0xff,
-0x1f,0,0,0,0x80,0x7f,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x3f,0,0,0xfc,0xff,0x7f,0,
-0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,0,
-0xc0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0x1f,0,0,0xff,0x47,0x7f,0,0,0,
-0,0xf8,0x0f,0,0,0,0,0,0,0,0,0,0,0x80,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0,0,0,0,0xc0,
-0xff,0,0,0,0,0,0,0,0,0,0,0,0x3e,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xf0,0x07,0x80,0xff,0xff,0x3f,0x7c,0,0,0,0,0xc0,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0x3e,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,
-0x03,0xc0,0xff,0xfe,0xff,0x7d,0,0,0,0,0x80,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0x7c,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0,0x40,
-0,0,0xfe,0x7f,0,0,0,0,0x80,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0xf0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0x3f,0,0,0x80,0x03,
-0xf8,0x3f,0,0,0,0,0x80,0xe7,0x1f,0,0,0,0,0,0,
-0,0,0,0,0xf0,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0x0f,0,0,0xf0,0xff,0xff,0x1f,
-0,0,0,0,0x80,0xc7,0x7f,0,0,0,0,0,0,0,0,
-0,0,0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0x0f,0,0,0xf0,0xff,0xff,0x1f,0,0,
-0,0,0x80,0xc7,0x7f,0,0,0,0,0,0,0,0,0,0,
-0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0xff,0x03,0,0,0xf0,0xff,0xff,0x0f,0,0,0,0,
-0xc0,0x0f,0xff,0x01,0,0,0,0,0,0,0,0,0,0xc0,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0x7f,0,0,0,0xc0,0xff,0xff,0x01,0,0,0,0,0xc0,0x0f,
-0xfc,0x07,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0x0f,0xf0,0x0f,
-0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0x80,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0xe0,0x1f,0x80,0x3f,0,0,
-0,0,0,0,0,0,0,0,0x1c,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf8,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0x1c,0,0xfe,0x03,0,0,0,
-0,0,0,0,0,0,0x78,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0x1c,0,0xfe,0x03,0,0,0,0,0,
-0,0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfe,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0x70,0x1c,0,0xf0,0x07,0,0,0,0,0,0,0,
-0,0,0xf0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x70,0x38,0,0xc0,0x1f,0,0,0,0,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0x70,
-0x78,0,0,0x7f,0,0,0,0,0,0,0,0,0,0xc0,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x70,0x70,0,
-0,0xfc,0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0x70,0x70,0,0,0xfc,
-0,0,0,0,0,0,0,0,0,0xc0,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xc0,0x01,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x38,0x70,0,0,0xfe,0x03,0xfe,
-0x7f,0,0,0,0,0,0,0,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0x38,0xf0,0,0,0xfe,0x0f,0xff,0xff,0x01,
-0,0,0,0,0,0,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xe0,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x18,0xe0,0,0x80,0x9f,0xff,0x3f,0xfe,0x03,0,0,
-0,0,0,0,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x1c,0xe0,0,0x80,0x0f,0xff,0x07,0xc0,0x0f,0,0,0,0,
-0,0,0x1e,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x1c,0xe0,0,0x80,0x0f,0xff,0x07,0xc0,0x0f,0,0,0,0,0,0,
-0x1e,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xf1,
-0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0x0e,0xe0,
-0,0xc0,0x07,0xfc,0x01,0,0x1f,0,0,0,0,0,0,0x3e,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xe1,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0x0e,0xe0,0x01,0xe0,
-0x03,0x60,0,0,0x38,0,0,0,0,0,0,0x3c,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xc3,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0x07,0xc0,0x01,0xf0,0x01,0,
-0xe0,0x03,0xf0,0,0,0,0,0,0,0x38,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0x07,0xf0,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0x07,0xc0,0x03,0xf8,0,0,0xf8,0x1f,
-0xe0,0,0,0,0,0,0,0x38,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0x07,0xf0,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0x07,0xc0,0x03,0xf8,0,0,0xf8,0x1f,0xe0,0,
-0,0,0,0,0,0x38,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0x0f,0xc0,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0x07,0x80,0x03,0x78,0,0,0xf8,0x7f,0xe0,0x01,0,0,
-0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x0f,0x80,0x0f,0,0,0,0,0,0,0,0,0,0,
-0x80,0x03,0x80,0x03,0x3e,0,0,0x78,0x7e,0xc0,0x03,0,0,0,0,
-0,0x78,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x1e,0x1c,0x0f,0,0,0,0,0,0,0,0,0,0,0x80,0xf3,
-0x9f,0x03,0x1f,0,0,0,0xf0,0x80,0x03,0,0,0,0,0,0x70,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x1e,0xfe,
-0x0f,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x07,
-0x0f,0,0,0,0xe0,0,0x07,0,0,0,0,0,0x70,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x1e,0xfe,0x0f,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x07,0x0f,0,
-0,0,0xe0,0,0x07,0,0,0,0,0,0x70,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x7c,0xfc,0x0f,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0x87,0x07,0,0,0,
-0xe0,0,0x07,0,0,0,0,0,0x70,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x7c,0xf8,0x0f,0,0,0,0,0,
-0,0,0,0,0,0xc0,0x3f,0xf4,0xc7,0x07,0,0,0,0xe0,0,
-0x07,0,0,0,0,0,0x70,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0x03,0x80,0xe7,0x01,0,0,0,0xe0,0,0x07,0,
-0,0,0,0,0xe0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0,0,0xff,0x01,0,0,0,0xe0,0x80,0x07,0,0,0,
-0,0,0xe0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xff,0,0,0,0,0xf8,0x80,0x03,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xff,0,0,0,0,0xf8,0x80,0x03,0,0,0,0,0,0xe0,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x80,0x07,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x7e,0,
-0,0,0,0x7c,0xc0,0x01,0,0,0,0,0,0xe0,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x3e,0,0x80,0x07,
-0xe0,0x3f,0xe0,0x01,0,0,0,0,0,0xc0,0x01,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x1e,0,0xc0,0xff,0xff,0x0f,
-0xe0,0,0,0,0,0,0,0xc0,0x01,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x1e,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x1f,0,0xe0,0xff,0xff,0x03,0xe0,0,
-0,0,0,0,0,0xc0,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x1e,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x1f,0,0xe0,0xff,0xff,0x03,0xe0,0,0,0,
-0,0,0,0xc0,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x3f,0,0x1e,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0x07,0,0x80,0xff,0x7f,0,0xf8,0x01,0,0,0,0,
-0,0xc0,0x01,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0x03,0x1e,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xc0,0x07,0,0,0,0,0,0xfc,0x07,0,0,0,0,0,0xc0,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x1e,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x03,
-0,0,0,0,0,0xfe,0x0f,0,0,0,0,0,0xc0,0x01,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,
-0,0,0x80,0xcf,0x3f,0,0,0xfe,0x01,0,0xc0,0x01,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0x0f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0x01,0,0,0,0,
-0x80,0xcf,0x3f,0,0,0xfe,0x01,0,0xc0,0x01,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x07,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0,0,0,0,0,0xe0,0xe7,
-0xff,0,0,0xfe,0x0f,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0x03,0,0xfc,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0x03,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x7c,0,0,0,0,0xf0,0xff,0xf9,0xff,0x01,
-0,0xe0,0x1f,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0x03,0,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0x03,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x7e,0,0,0,0xc0,0xff,0x7f,0xfe,0xe1,0x07,0,0xc0,
-0xff,0,0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0x01,0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x03,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x1e,0,0,0,0xfc,0xff,0x1f,0xff,0x81,0x0f,0,0x80,0xf1,0x03,
-0xc0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,
-0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0x1e,
-0,0,0,0xfc,0xff,0x1f,0xff,0x81,0x0f,0,0x80,0xf1,0x03,0xc0,0xe1,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0xc0,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x81,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,
-0,0xff,0x3f,0x80,0xff,0,0x1f,0,0x80,0xc1,0x07,0xc0,0xe1,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0,0,0,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xc1,0xff,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0x0f,0,0x03,0xc0,0x3f,
-0,0xe0,0x7f,0,0x7e,0,0x80,0x01,0x1f,0xe0,0xe1,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0xfc,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0x80,0x0f,0x80,0x07,0xf0,0x07,0,0xf0,
-0x3f,0,0xf8,0,0x80,0x01,0x3c,0xe0,0xe1,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0x03,0,0,0,0xf8,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xe0,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0xc0,0x03,0x80,0xff,0xff,0x01,0,0xfc,0x1f,0,
-0xf0,0x01,0xc0,0x01,0x38,0xe0,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0x7f,0xf0,0,0xf8,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0xe0,0x03,0,0xfe,0x1f,0,0x80,0xbf,0x07,0,0x80,0x07,
-0xc0,0x01,0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,
-0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x7f,0xf0,0,0xf8,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0xe0,0x03,0,0xfe,0x1f,0,0x80,0xbf,0x07,0,0x80,0x07,0xc0,0x01,
-0xe0,0xf1,0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,0,0,
-0,0,0x80,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,
-0xf0,0,0,0xfe,0x7f,0,0,0,0,0,0,0,0,0,0xf0,
-0x01,0,0xf8,0x03,0,0xc0,0xcf,0x03,0,0x80,0x1f,0xf0,0x01,0xe0,0x71,
-0xe0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0,
-0,0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x7f,0xf0,0,
-0,0xe0,0xff,0x03,0,0,0,0,0,0,0,0,0xf8,0,0,
-0,0,0,0xe0,0xe7,0x03,0,0,0x7e,0xff,0,0xc0,0x73,0xf0,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0xfc,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x3f,0xf0,0,0,0,
-0xfc,0x1f,0,0,0,0,0,0,0,0,0x78,0,0,0,0,
-0,0xf8,0xf3,0,0,0,0xfc,0x7f,0,0,0x7f,0xf0,0xff,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0xf0,0xff,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0xf0,0,0,0,0xe0,0xff,
-0,0,0,0,0,0,0,0,0x3c,0,0,0,0,0,0x7c,
-0xf8,0,0,0,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,
-0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x1f,
-0,0,0,0,0,0,0,0xf0,0,0,0,0xe0,0xff,0,0,
-0,0,0,0,0,0,0x3c,0,0,0,0,0,0x7c,0xf8,0,
-0,0,0xf8,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,
-0xff,0x7f,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x3f,0,0,
-0,0,0,0,0,0x70,0,0,0,0x80,0xff,0x0f,0,0,0,
-0,0,0,0,0x3e,0,0,0,0,0,0x7f,0x7c,0,0,0,
-0xe0,0xff,0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x1f,
-0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0,0,0,0,
-0,0,0,0x78,0,0,0,0,0xfe,0x7f,0,0,0,0,0,
-0,0,0x1e,0,0,0,0,0xc0,0x1f,0x3e,0,0,0,0xc0,0xff,
-0xff,0xff,0x7f,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,
-0,0,0,0,0,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,
-0,0x7c,0,0,0,0,0xf0,0xff,0x03,0,0,0,0,0,0,
-0x0f,0,0,0,0,0xe0,0x07,0x1f,0,0,0,0x80,0x0f,0,0,
-0x3c,0xf0,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0xfc,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0x3c,
-0,0,0,0,0,0xfe,0x0f,0,0,0,0,0,0,0x0f,0,
-0,0,0,0xfc,0x83,0x0f,0,0,0,0,0x0f,0,0,0x38,0xf0,
-0xff,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,
-0,0xfc,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0x3c,0,0,
-0,0,0,0xfe,0x0f,0,0,0,0,0,0,0x0f,0,0,0,
-0,0xfc,0x83,0x0f,0,0,0,0,0x0f,0,0,0x38,0xf0,0xff,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0xf0,
-0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0x1e,0,0,0,0xf8,
-0xff,0xff,0x3f,0,0,0,0,0,0x80,0x07,0,0,0,0,0xff,
-0x80,0x07,0,0,0,0,0x3e,0,0,0x38,0,0,0,0,0,
-0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0xff,0x7f,0,0,0,0,0,0,0x0f,0,0,0,0xff,0xff,0xff,
-0xff,0x03,0,0,0,0,0xe0,0x01,0,0,0,0xe0,0x1f,0xe0,0x03,
-0,0,0,0,0x78,0,0,0x1c,0,0,0,0,0xe0,0xff,0xff,
-0xff,0x0f,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,
-0,0,0,0,0,0x80,0x0f,0,0,0,0xff,0x3f,0xe0,0xff,0x0f,
-0,0,0,0,0xf0,0x01,0,0,0,0xf8,0x07,0xf0,0x01,0,0,
-0,0,0xf0,0x01,0,0x1e,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x03,0,
-0,0,0,0x80,0x07,0,0,0,0xe0,0xff,0x01,0xfe,0x3f,0,0,
-0,0,0xf0,0,0,0,0,0xfe,0x01,0xf8,0,0,0,0,0,
-0xc0,0x03,0,0x0e,0,0,0,0,0xfc,0xff,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x03,0,0,0,
-0,0x80,0x07,0,0,0,0xe0,0xff,0x01,0xfe,0x3f,0,0,0,0,
-0xf0,0,0,0,0,0xfe,0x01,0xf8,0,0,0,0,0,0xc0,0x03,
-0,0x0e,0,0,0,0,0xfc,0xff,0xff,0xff,0x01,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0x07,0,0,0,0,0x80,
-0x07,0,0,0,0,0xf8,0x07,0xc0,0xff,0x01,0,0,0,0xf8,0,
-0,0,0x80,0x7f,0,0x78,0,0,0,0,0,0xc0,0x0f,0,0x0e,
-0,0,0,0,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,
-0,0,0,0xf0,0xff,0xff,0xff,0x1f,0,0,0,0,0xc0,0xe3,0xff,
-0xff,0,0,0xc0,0x1f,0x80,0xff,0x03,0,0,0,0x3c,0,0,0,
-0xe0,0x1f,0,0x3e,0,0,0,0,0,0,0x0f,0,0x07,0,0,
-0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0x7f,0,0,0,0,0xc0,0xfb,0xff,0xff,0x0f,
-0,0,0x3e,0x80,0xf3,0x1f,0,0,0,0x3e,0,0,0,0xf8,0x07,
-0,0x1e,0,0,0,0,0,0,0x1e,0,0x07,0,0,0,0xe0,
-0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,
-0xff,0xff,0xff,0xff,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0,0,
-0x7c,0xc0,0x81,0xff,0,0,0,0x1f,0,0,0,0xff,0x01,0,0x0f,
-0,0,0,0,0,0,0x7c,0x80,0x07,0,0,0,0xf0,0xff,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0xff,0xff,0x03,0,0,0,0xc0,0x7f,0,0xe0,0xff,0x3f,0,0xf0,0xc0,
-0x01,0xfe,0x03,0,0,0x0f,0,0,0xc0,0x7f,0,0xc0,0x07,0,0,
-0,0,0,0,0xf0,0xc0,0x03,0,0,0,0xfc,0xff,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,
-0x03,0,0,0,0xc0,0x7f,0,0xe0,0xff,0x3f,0,0xf0,0xc0,0x01,0xfe,
-0x03,0,0,0x0f,0,0,0xc0,0x7f,0,0xc0,0x07,0,0,0,0,
-0,0,0xf0,0xc0,0x03,0,0,0,0xfc,0xff,0xff,0xff,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0xff,0x07,0,
-0,0,0xc0,0x0f,0,0,0xfc,0xff,0x03,0xc0,0xe3,0x01,0xf0,0x07,0,
-0x80,0x07,0,0,0xf0,0x1f,0,0xc0,0x07,0,0,0,0,0,0,
-0xf0,0xc1,0x01,0,0,0,0xff,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x1f,0,0,0,
-0xc0,0x07,0,0,0,0xfc,0xff,0,0xf7,0,0,0x3f,0,0xc0,0x03,
-0,0,0xff,0,0,0xe0,0x01,0,0,0,0,0,0,0xc0,0xe3,
-0x01,0,0,0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0,0,0,0xc0,0x01,
-0,0,0,0xc0,0xff,0x07,0x7f,0,0,0xfc,0,0xe0,0x03,0,0xe0,
-0x3f,0,0,0xf0,0x01,0,0,0,0,0,0,0x80,0xff,0,0,
-0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfe,0xff,0xff,0xff,0,0,0,0xc0,0x01,0,0,
-0,0,0xfe,0x7f,0x7f,0,0,0xf8,0x01,0xe0,0x01,0,0xfc,0x07,0,
-0,0xf8,0,0,0,0,0,0,0,0,0xff,0,0,0,0xfc,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfe,0xff,0xff,0xff,0,0,0,0xc0,0x01,0,0,0,0,
-0xfe,0x7f,0x7f,0,0,0xf8,0x01,0xe0,0x01,0,0xfc,0x07,0,0,0xf8,
-0,0,0,0,0,0,0,0,0xff,0,0,0,0xfc,0xff,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0xff,0x03,0,0,0xc0,0x03,0,0,0,0,0xe0,0xff,
-0x3f,0,0,0xf0,0x07,0xf0,0,0,0xff,0x03,0,0,0x7c,0,0,
-0,0,0,0,0,0,0x7e,0,0,0,0xff,0xff,0xff,0x7f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0xff,0x0f,0,0,0xc0,0x03,0,0,0,0,0,0xfe,0x3f,0,
-0,0xc0,0x3f,0xf8,0,0xf8,0x3f,0,0,0,0x3c,0,0,0,0,
-0,0,0,0,0x3c,0,0,0x80,0xff,0xff,0xff,0x3f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,
-0x3f,0,0,0xc0,0x03,0,0,0,0,0,0xf0,0xff,0x0f,0,0,
-0x7f,0x7c,0,0xfe,0x07,0,0,0,0x1e,0,0,0,0,0,0,
-0,0,0x1e,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,
-0,0x80,0x07,0,0,0,0,0,0,0xff,0x7f,0,0,0xfc,0x3e,
-0xe0,0x7f,0,0,0,0,0x1f,0,0,0,0,0,0,0,0,
-0x1f,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,0,0x80,
-0x07,0,0,0,0,0,0,0xff,0x7f,0,0,0xfc,0x3e,0xe0,0x7f,
-0,0,0,0,0x1f,0,0,0,0,0,0,0,0,0x1f,0,
-0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0x01,0,0x80,0x0f,0,
-0,0,0,0,0,0xf0,0xff,0x1f,0,0xf0,0x1f,0xfe,0x0f,0,0,
-0,0x80,0x0f,0,0,0,0,0,0,0,0,0x07,0,0,0xfc,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0x0f,0,0,0,
-0,0,0,0,0xfc,0xff,0x3f,0xc0,0xff,0xff,0,0,0,0,0xc0,
-0x07,0,0,0,0,0,0,0,0x80,0x03,0,0,0xff,0xff,0xff,
-0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0x0f,0,0,0x1e,0,0,0,0,0,
-0,0,0,0xfe,0xff,0xff,0xff,0x1f,0,0,0,0,0xe0,0x03,0,
-0,0,0,0,0,0,0xe0,0x03,0,0xc0,0xff,0xff,0xff,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x80,0xff,0xff,0xff,0x7f,0,0,0x3c,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0xff,0x03,0,0,0,0,0xf0,0x01,0,0,0,
-0,0,0,0,0xf8,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,
-0xff,0xff,0x7f,0,0,0x3c,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0x03,0,0,0,0,0xf0,0x01,0,0,0,0,0,
-0,0,0xf8,0,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,
-0xff,0,0,0x78,0,0,0,0,0,0,0,0,0,0,0xf8,
-0xff,0x1f,0,0,0,0,0xf0,0,0,0,0,0,0,0,0,
-0x7c,0,0,0xfc,0xff,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,
-0,0xf0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0x7f,
-0,0,0,0,0x7c,0,0,0,0,0,0,0,0,0x3e,0,
-0,0xff,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0,0xe0,
-0x01,0,0,0,0,0,0,0,0,0,0,0x7c,0xfe,0,0,
-0,0,0x3c,0,0,0,0,0,0,0,0x80,0x1f,0,0xc0,0xff,
-0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x1f,0,0xc0,0x03,0,
-0,0,0,0,0,0,0,0,0,0x78,0xf8,0x03,0,0,0,
-0x1e,0,0,0,0,0,0,0,0xc0,0x07,0,0xe0,0xff,0xff,0xff,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x80,0xff,0xff,0xff,0x7f,0,0x80,0x07,0,0,0,
-0,0,0,0,0,0,0,0x70,0xe0,0x0f,0,0,0,0x0f,0,
-0,0,0,0,0,0,0xf0,0x03,0,0xf8,0xff,0xff,0xff,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0xff,0xff,0x7f,0,0x80,0x07,0,0,0,0,0,
-0,0,0,0,0,0x70,0xe0,0x0f,0,0,0,0x0f,0,0,0,
-0,0,0,0,0xf0,0x03,0,0xf8,0xff,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0xff,0xff,0,0x80,0x0f,0,0,0,0,0,0,0,
-0,0,0,0x70,0,0x3f,0,0,0x80,0x0f,0,0,0,0,0,
-0,0,0xf8,0x01,0,0xfe,0xff,0xff,0x7f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,
-0xff,0xff,0xff,0x03,0,0x1f,0,0,0,0,0,0,0,0,0,
-0,0x70,0,0xfe,0,0,0xc0,0x03,0,0,0,0,0,0,0,
-0x7e,0,0x80,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,
-0xff,0x0f,0,0x3e,0,0,0,0,0,0,0,0,0,0,0x70,
-0,0xf8,0x01,0,0xc0,0x03,0,0,0,0,0,0,0,0x3e,0,
-0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,
-0,0xf8,0,0,0,0,0,0,0,0,0,0,0x70,0,0x80,
-0x0f,0,0xf0,0x01,0,0,0,0,0,0,0xc0,0x0f,0,0xf8,0xff,
-0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,0,0xf8,
-0,0,0,0,0,0,0,0,0,0,0x70,0,0x80,0x0f,0,
-0xf0,0x01,0,0,0,0,0,0,0xc0,0x0f,0,0xf8,0xff,0xff,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,0,0xe0,0x01,0,
-0,0,0,0,0,0,0,0,0x70,0,0,0x3e,0,0xf0,0,
-0,0,0,0,0,0,0xe0,0x07,0,0xfe,0xff,0xff,0xff,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,0xc0,0x03,0,0,0,
-0,0,0,0,0,0,0x70,0,0,0xfc,0,0x78,0,0,0,
-0,0,0,0,0xf8,0x01,0x80,0xff,0xff,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0xff,0xff,0xff,0x0f,0xc0,0x07,0,0,0,0,0,
-0,0,0,0,0x78,0,0,0xe0,0x03,0x3c,0,0,0,0,0,
-0,0,0x7c,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0x1f,0,0x0f,0,0,0,0,0,0,0,
-0,0,0x7c,0,0,0xc0,0x1f,0x1e,0,0,0,0,0,0,0,
-0x3e,0,0xf0,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0x1f,0,0x0f,0,0,0,0,0,0,0,0,0,
-0x7c,0,0,0xc0,0x1f,0x1e,0,0,0,0,0,0,0,0x3e,0,
-0xf0,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,
-0xff,0x7f,0,0x1e,0,0,0,0,0,0,0,0,0,0x7c,0,
-0,0,0x3f,0x0f,0,0,0,0,0,0,0x80,0x0f,0,0xfc,0xff,
-0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,
-0x01,0x7c,0,0,0,0,0,0,0,0,0,0x3c,0,0,0,
-0xfc,0x0f,0,0,0,0,0,0,0xe0,0x07,0,0xff,0xff,0xff,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x03,0x78,
-0,0,0,0,0,0,0,0,0,0x3c,0,0,0,0xf8,0x07,
-0,0,0,0,0,0,0xf0,0x01,0xc0,0xff,0xff,0xff,0x1f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0,
-0,0,0,0,0,0,0,0x1c,0,0,0,0xfc,0x03,0,0,
-0,0,0,0,0xf8,0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0xff,0xff,0xff,0x07,0xf0,0x01,0,0,0,
-0,0,0,0,0,0x1c,0,0,0,0xfc,0x03,0,0,0,0,
-0,0,0xf8,0,0xf0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0xff,0x1f,0xe0,0x03,0,0,0,0,0,
-0,0,0,0x1c,0,0,0,0xfc,0x01,0,0,0,0,0,0,
-0x7e,0,0xf8,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xff,0xff,0xff,0xff,0x80,0x0f,0,0,0,0,0,0,0,
-0,0x1e,0,0,0,0xff,0,0,0,0,0,0,0x80,0x0f,0,
-0xfe,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0xff,0x01,0x1f,0,0,0,0,0,0,0,0,0x0e,
-0,0,0x80,0x7f,0,0,0,0,0,0,0xc0,0x07,0x80,0xff,0xff,
-0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,
-0xff,0xff,0x07,0x3e,0,0,0,0,0,0,0,0,0x0e,0,0,
-0xc0,0x3f,0,0,0,0,0,0,0xf0,0x01,0xe0,0xff,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,
-0x0f,0x7c,0,0,0,0,0,0,0,0,0x0f,0,0,0xe0,0x3f,
-0,0,0,0,0,0,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,0x7c,
-0,0,0,0,0,0,0,0,0x0f,0,0,0xe0,0x3f,0,0,
-0,0,0,0,0xf8,0x01,0xf8,0xff,0xff,0xff,0x01,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0xff,0x3f,0xf0,0,0,
-0,0,0,0,0,0,0x0f,0,0,0xf0,0x1f,0,0,0,0,
-0,0,0x7e,0,0xfc,0xff,0xff,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfe,0xff,0xff,0x7f,0xe0,0x01,0,0,0,
-0,0,0,0x80,0x07,0,0,0xfc,0x1f,0,0,0,0,0,0,
-0x3e,0,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfc,0xff,0xff,0xff,0xe0,0x03,0,0,0,0,0,
-0,0x80,0x07,0,0,0xfc,0x0f,0,0,0,0,0,0,0x1f,0xc0,
-0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0xff,0xff,0xc1,0x07,0,0,0,0,0,0,0xc0,
-0x03,0,0,0xfe,0x07,0,0,0,0,0,0xc0,0x0f,0xf0,0xff,0xff,
-0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf0,0xff,0xff,0xff,0xc1,0x07,0,0,0,0,0,0,0xc0,0x03,0,
-0,0xfe,0x07,0,0,0,0,0,0xc0,0x0f,0xf0,0xff,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0xff,0xff,0x83,0x0f,0,0,0,0,0,0,0xc0,0x01,0,0,0xff,
-0x07,0,0,0,0,0,0xc0,0x07,0xf8,0xff,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,
-0x0f,0x1e,0,0,0,0,0,0,0xe0,0x01,0,0xc0,0xef,0x03,0,
-0,0,0,0,0xe0,0x01,0xff,0xff,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,0x0f,0x1c,
-0,0,0,0,0,0,0xf0,0,0,0xe0,0xf3,0x01,0,0,0,
-0,0,0xf0,0x80,0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x1f,0x38,0,0,
-0,0,0,0,0x70,0,0,0xf0,0xf9,0,0,0,0,0,0,
-0x78,0xe0,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfc,0xff,0xff,0x1f,0x38,0,0,0,0,
-0,0,0x70,0,0,0xf0,0xf9,0,0,0,0,0,0,0x78,0xe0,
-0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0x7f,0xf0,0,0,0,0,0,0,
-0x78,0,0,0x78,0x7c,0,0,0,0,0,0,0x3c,0xf0,0xff,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0xff,0xff,0xe0,0,0,0,0,0,0,0x78,0,
-0,0x7e,0x7c,0,0,0,0,0,0,0x3c,0xf8,0xff,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0xff,0xe0,0x01,0,0,0,0,0,0x3c,0,0,0x3e,
-0x3e,0,0,0,0,0,0,0x1f,0xfe,0xff,0xff,0x7f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xff,0xc1,0x03,0,0,0,0,0,0x3c,0,0,0x0f,0x1e,0,
-0,0,0,0,0,0x0f,0xfe,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0xff,
-0xc1,0x03,0,0,0,0,0,0x3c,0,0,0x0f,0x1e,0,0,0,
-0,0,0,0x0f,0xfe,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x83,0x07,
-0,0,0,0,0,0x1e,0,0xc0,0x07,0x0f,0,0,0,0,0,
-0x80,0x07,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0x07,0x0f,0,0,
-0,0,0,0x0f,0,0xe0,0x83,0x0f,0,0,0,0,0,0x80,0xc7,
-0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xc0,0xff,0xff,0x0f,0x0f,0,0,0,0,
-0,0x07,0,0xf0,0x81,0x07,0,0,0,0,0,0xc0,0xc3,0xff,0xff,
-0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xff,0xff,0x1f,0x1c,0,0,0,0,0x80,0x03,
-0,0x7c,0xc0,0x03,0,0,0,0,0,0xe0,0xe1,0xff,0xff,0x7f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x3f,0x3c,0,0,0,0,0xc0,0x03,0,0x3f,
-0xe0,0x01,0,0,0,0,0,0xe0,0xe0,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0x3f,0x3c,0,0,0,0,0xc0,0x03,0,0x3f,0xe0,0x01,
-0,0,0,0,0,0xe0,0xe0,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,
-0xff,0x3f,0x3c,0,0,0,0,0xe0,0x01,0x80,0x1f,0xe0,0x01,0,0,
-0,0,0,0xf0,0xe0,0xff,0xff,0x07,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,
-0x38,0,0,0,0,0xe0,0,0xe0,0x07,0xf0,0,0,0,0,0,
-0,0x78,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,
-0,0,0,0xf0,0,0xf0,0x03,0x70,0,0,0,0,0,0,0x78,
-0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,
-0,0x70,0,0xfe,0,0x38,0,0,0,0,0,0,0x3c,0xfc,0xff,
-0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,0,0x70,
-0,0xfe,0,0x38,0,0,0,0,0,0,0x3c,0xfc,0xff,0x3f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x3f,0x38,0,0,0,0,0x38,0x80,0x3f,
-0,0x3c,0,0,0,0,0,0,0x1c,0xfc,0xff,0x3f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0x3f,0x38,0,0,0,0,0x1c,0xc0,0x0f,0,0x1c,
-0,0,0,0,0,0,0x1e,0xfc,0xff,0x3f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0x38,0,0,0,0,0x1e,0xf0,0x03,0,0x1e,0,0,
-0,0,0,0,0x1e,0xfc,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,
-0x1f,0x38,0,0,0,0,0x0f,0x7f,0,0,0x0f,0,0,0,0,
-0,0,0x0f,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x1f,0x38,
-0,0,0,0,0x0f,0x7f,0,0,0x0f,0,0,0,0,0,0,
-0x0f,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x1f,0x38,0,0,
-0,0,0xe7,0x3f,0,0,0x07,0,0,0,0,0,0,0x0f,0xfc,
-0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xff,0xff,0x0f,0x38,0,0,0,0x80,
-0xfb,0x0f,0,0x80,0x03,0,0,0,0,0,0,0x07,0xfc,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xff,0xff,0x07,0x38,0,0,0,0xc0,0xff,0x01,
-0,0xc0,0x03,0,0,0,0,0,0x80,0x07,0xf8,0xff,0xff,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0xff,0x07,0x38,0,0,0,0xe0,0x3f,0,0,0xc0,
-0x01,0,0,0,0,0,0xc0,0x03,0xf8,0xff,0xff,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0x38,0,0,0,0xe0,0x3f,0,0,0xc0,0x01,0,
-0,0,0,0,0xc0,0x03,0xf8,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,
-0xff,0x07,0x38,0,0,0,0xe0,0x0f,0,0,0xe0,0,0,0,0,
-0,0,0xc0,0x03,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,
-0x38,0,0,0,0xf0,0x03,0,0,0xf0,0,0,0,0,0,0,
-0xe0,0x01,0xf8,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0x38,0,
-0,0,0x70,0,0,0,0x70,0,0,0,0,0,0,0xe0,0x01,
-0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0x01,0x38,0,0,0,
-0,0,0,0,0x78,0,0,0,0,0,0,0xe0,0,0xf0,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,
-0,0,0x38,0,0,0,0,0,0,0xf0,0,0xf0,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,0,0,
-0x38,0,0,0,0,0,0,0xf0,0,0xf0,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0xff,0xff,0,0x38,0,0,0,0,0,0,0,0x3c,0,
-0,0,0,0,0,0xf0,0,0xe0,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0xff,0,0x38,0,0,0,0,0,0,0,0x1e,0,0,0,
-0,0,0,0x78,0,0xe0,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,
-0,0x18,0,0,0,0,0,0,0,0x1e,0,0,0,0,0,
-0,0x78,0,0xc0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0x18,
-0,0,0,0,0,0,0,0x0f,0,0,0,0,0,0,0x3c,
-0,0xc0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0x18,0,0,
-0,0,0,0,0,0x0f,0,0,0,0,0,0,0x3c,0,0xc0,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x7f,0,0x1c,0,0,0,0,
-0,0,0x80,0x07,0,0,0,0,0,0,0x3c,0,0x80,0xff,0xff,
-0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x3f,0,0x1c,0,0,0,0,0,0,
-0x80,0x07,0,0,0,0,0,0,0x1e,0,0x80,0xff,0xff,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,
-0,0,0,0,0,0,0x1e,0,0x80,0xff,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,0,0,
-0,0,0,0,0x1f,0,0,0xff,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0x1f,0,0x1c,0,0,0,0,0,0,0xc0,0x03,0,0,0,0,
-0,0,0x1f,0,0,0xff,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,
-0x1c,0,0,0,0,0,0,0xe0,0x01,0,0,0,0,0,0,
-0x0f,0,0,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0x1c,0,
-0,0,0,0,0,0xe0,0,0,0,0,0,0,0,0x0f,0,
-0,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0x07,0,0x1c,0,0,0,
-0,0,0,0xf0,0,0,0,0,0,0,0x80,0x07,0,0,0xfe,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,
-0,0x70,0,0,0,0,0,0,0x80,0x07,0,0,0xfe,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,0,0x70,
-0,0,0,0,0,0,0x80,0x07,0,0,0xfe,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0,0x1e,0,0,0,0,0,0,0x78,0,0,
-0,0,0,0,0x80,0x07,0,0,0xfc,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,
-0xff,0x03,0,0x1e,0,0,0,0,0,0,0x38,0,0,0,0,
-0,0,0x80,0x03,0,0,0xfc,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,
-0,0x1e,0,0,0,0,0,0,0x3c,0,0,0,0,0,0,
-0xc0,0x03,0,0,0xfc,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0,0x1e,
-0,0,0,0,0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,
-0,0,0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xc0,0xff,0xff,0x03,0,0x1e,0,0,
-0,0,0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,0,0,
-0xf8,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xc0,0xff,0xff,0x01,0,0x1e,0,0,0,0,
-0,0,0x1e,0,0,0,0,0,0,0xc0,0x03,0,0,0xf8,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0x01,0,0x1c,0,0,0,0,0,0,
-0x0f,0,0,0,0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xe0,0xff,0xff,0,0,0x1c,0,0,0,0,0,0x80,0x07,0,
-0,0,0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0xff,0,0,0x3c,0,0,0,0,0,0x80,0x07,0,0,0,
-0,0,0,0xc0,0x01,0,0,0xf0,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,
-0,0,0x3c,0,0,0,0,0,0x80,0x03,0,0,0,0,0,
-0,0xc0,0x01,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,
-0x3c,0,0,0,0,0,0x80,0x03,0,0,0,0,0,0,0xc0,
-0x01,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0x38,0,
-0,0,0,0,0xc0,0x03,0,0,0,0,0,0,0xc0,0x01,0,
-0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x3f,0,0,0x38,0,0,0,
-0,0,0xc0,0x01,0,0,0,0,0,0,0xc0,0x01,0,0,0xe0,
-0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x3f,0,0,0x38,0,0,0,0,0,
-0xe0,0x01,0,0,0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfc,0xff,0x1f,0,0,0x38,0,0,0,0,0,0xe0,0,
-0,0,0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,0x07,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0,0,0x38,0,0,0,0,0,0xe0,0,0,0,
-0,0,0,0,0xc0,0x01,0,0,0xc0,0xff,0xff,0x07,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0x1f,0,0,0x38,0,0,0,0,0,0xf0,0,0,0,0,0,
-0,0,0xc0,0x01,0,0,0x80,0xff,0xff,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,
-0,0x38,0,0,0,0,0,0x78,0,0,0,0,0,0,0,
-0xc0,0x03,0,0,0x80,0xff,0xff,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x38,
-0,0,0,0,0,0x78,0,0,0,0,0,0,0,0xc0,0x03,
-0,0,0,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x3c,0,0,
-0,0,0,0x3c,0,0,0,0,0,0,0,0x80,0x07,0,0,
-0,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0x0f,0,0,0x3c,0,0,0,0,
-0,0x3c,0,0,0,0,0,0,0,0x80,0x07,0,0,0,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0x07,0,0,0xfc,0x3f,0,0,0,0,0,0x3e,
-0,0,0,0,0,0,0,0x80,0x07,0,0,0,0xfe,0xff,0x1f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x0f,0,0xe0,0xff,0xff,0x3f,0,0,0,0,0,0x1e,0,0,
-0,0,0,0,0,0,0x0f,0,0,0,0xfe,0xff,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0xff,0xff,0x3f,0,0,0,0,0,0x0f,0,0,0,0,
-0,0,0,0,0x0f,0,0,0,0xfe,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0xff,0x0f,0x3c,0,0,0,0,0,0x0f,0,0,0,0,0,0,
-0,0,0x0e,0,0,0,0xfc,0xff,0x3f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,
-0x3c,0,0,0,0,0,0x0f,0,0,0,0,0,0,0,0,
-0x0e,0,0,0,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x01,0,0x38,0,
-0,0,0,0x80,0x07,0,0,0,0,0,0,0,0,0x1e,0,
-0,0,0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0xff,0xff,0,0,0,0x38,0,0,0,
-0,0x80,0x07,0,0,0,0,0,0,0,0,0x3c,0,0,0,
-0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xff,0xff,0x03,0,0,0,0x38,0,0,0,0,0xc0,
-0x03,0,0,0,0,0,0,0,0,0x78,0,0,0,0xf8,0xff,
-0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x1f,0,0,0,0,0x78,0,0,0,0,0xc0,0x01,0,
-0,0,0,0,0,0,0,0x70,0,0,0,0xf8,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,
-0x01,0,0,0,0,0x70,0,0,0,0,0xe0,0x01,0,0,0,
-0,0,0,0,0,0xf0,0x01,0,0,0xf0,0xff,0xff,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0xff,0x01,0,
-0,0,0,0x70,0,0,0,0,0xe0,0x01,0,0,0,0,0,
-0,0,0,0xf0,0x01,0,0,0xf0,0xff,0xff,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xff,0xff,0x07,0,0xfe,0,0,
-0,0x70,0,0,0,0,0xe0,0,0,0,0,0,0,0,0,
-0,0xe0,0x03,0,0,0xf0,0xff,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf0,0xff,0x1f,0,0xf8,0xff,0,0,0,0x70,
-0,0,0,0,0xf0,0,0,0,0,0,0,0,0,0,0xc0,
-0x03,0,0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0x7f,0,0xe0,0xff,0x7f,0,0,0,0x70,0,0,
-0,0,0xf8,0,0,0,0,0,0,0,0,0,0x80,0x0f,0,
-0,0xf0,0xff,0xff,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xe0,0xff,0x03,0,0xf0,0xff,0x3f,0,0,0,0x70,0,0,0,0,
-0x78,0,0,0,0,0,0,0,0,0,0,0x1f,0,0,0xe0,
-0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,
-0x03,0,0xf0,0xff,0x3f,0,0,0,0x70,0,0,0,0,0x78,0,
-0,0,0,0,0,0,0,0,0,0x1f,0,0,0xe0,0xff,0xff,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0x7f,0,0,
-0xf8,0xff,0x3f,0,0,0,0x70,0,0,0,0,0x78,0,0,0,
-0,0,0,0,0,0,0,0x7c,0,0,0xe0,0xff,0xff,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x80,0xff,0x07,0,0,0xf8,0xff,
-0x1f,0,0,0,0xe0,0,0,0,0,0x3c,0,0,0,0,0,
-0,0,0,0,0,0xf8,0x01,0,0xe0,0xff,0xff,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xc0,0xff,0,0,0,0xfc,0xff,0x1f,0,
-0,0,0xe0,0,0,0,0,0x3c,0,0,0,0,0,0,0,
-0,0,0,0xe0,0x07,0,0xc0,0xff,0xff,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xc0,0x1f,0,0,0,0xfe,0xff,0x1f,0,0,0,
-0xe0,0,0,0,0,0x3c,0,0,0x60,0,0,0,0,0,0,
-0,0xc0,0x3f,0,0xc0,0xff,0xff,0x07,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0x1f,0,0,0,0xfe,0xff,0x1f,0,0,0,0xe0,0,
-0,0,0,0x3c,0,0,0x60,0,0,0,0,0,0,0,0xc0,
-0x3f,0,0xc0,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x80,0x03,0,0,0,0xfe,0xff,0x0f,0,0,0,0xe0,0,0,0,
-0,0x3e,0,0,0x70,0,0,0,0,0,0,0,0,0xff,0x01,
-0x80,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x0f,0,0,0,0xe0,0,0,0,0,0x3f,
-0,0,0x38,0,0,0,0,0,0,0,0,0xf8,0x3f,0x80,0xff,
-0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0,0,0,0xc0,0x01,0,0,0,0xff,0,0,
-0x38,0,0,0,0,0,0,0,0,0xc0,0xff,0,0xfc,0xff,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0x07,0,0,0,0xc0,0x01,0,0,0,0xf7,0x03,0,0x3c,0,
-0,0,0,0,0,0,0,0,0xff,0x0f,0xc0,0xff,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0x07,
-0,0,0,0xc0,0x01,0,0,0,0xf7,0x03,0,0x3c,0,0,0,
-0,0,0,0,0,0,0xff,0x0f,0xc0,0xff,0x0f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,
-0,0xc0,0x01,0,0,0x80,0xe3,0x0f,0,0x3f,0,0,0,0,0,
-0,0,0,0,0xf0,0x7f,0,0xf8,0x1f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,0,0xc0,
-0x01,0,0,0x80,0xe3,0xff,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0x80,0xff,0x03,0x80,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0x03,0,0,0,0xc0,0x01,0,
-0,0x80,0xc3,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0xfe,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0x01,0,0,0,0xc0,0x01,0,0,0xc0,
-0x01,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0,0,0,0,0xc0,0x01,0,0,0xc0,0x01,0xfe,
-0x7f,0x38,0,0,0,0,0,0,0,0,0,0,0,0xfe,0x1f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0,0,0,0,0xc0,0x01,0,0,0xc0,0x01,0xfe,0x7f,0x38,
-0,0,0,0,0,0,0,0,0,0,0,0xfe,0x1f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0,0,0,0,0xc1,0x01,0,0,0xe0,0,0x3e,0,0x38,0,0,
-0,0,0,0,0,0,0,0,0,0xf0,0xff,0x01,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0,0,
-0,0x80,0xc3,0x01,0,0,0xe0,0,0x7c,0,0x3c,0,0,0,0,
-0,0,0,0,0,0,0,0,0xff,0x7f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0,0,0,0xf0,
-0xc3,0x01,0,0,0xf0,0,0xf0,0,0x3c,0,0,0,0,0,0,
-0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf8,0xff,0x7f,0,0,0,0xf8,0xc3,0x01,
-0,0,0xf0,0,0xe0,0x01,0x3c,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf8,0xff,0x7f,0,0,0,0xf8,0xc3,0x01,0,0,
-0xf0,0,0xe0,0x01,0x3c,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0xff,0x7f,0,0,0,0xff,0xc3,0x03,0,0,0x70,0,
-0xc0,0x03,0x3c,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x80,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0xff,0x3f,0,0,0x80,0xff,0xc3,0x03,0,0,0x70,0,0xc0,0x03,
-0x3c,0,0,0,0,0,0,0,0,0,0,0,0xf0,0x01,0,
-0xf0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,
-0x1f,0,0,0xe0,0xff,0xc3,0x03,0,0,0x78,0,0x80,0x07,0x3c,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0x7f,0,0,0,
-0xfc,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,
-0,0xf8,0xff,0xc3,0x03,0,0,0x78,0,0,0x0f,0x3c,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0x0f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0x1f,0,0,0xf8,
-0xff,0xc3,0x03,0,0,0x78,0,0,0x0f,0x3c,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0x0f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0x0f,0,0,0xfe,0xff,0x83,
-0x03,0,0,0x3c,0,0,0x1e,0x1c,0,0,0,0,0,0,0,
-0,0xfc,0xff,0x01,0xe0,0xff,0xff,0x01,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0x0f,0,0x80,0xff,0xff,0x87,0x03,0,
-0,0x3c,0,0,0x3c,0x1c,0,0,0,0,0,0,0xf8,0xff,0xff,
-0xff,0xff,0xe1,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x0f,0,0xc0,0xff,0xff,0x87,0x03,0,0,0x3c,
-0,0,0x78,0x1c,0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0xff,
-0xe1,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xff,0xff,0x07,0,0xf8,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,
-0xe0,0x1c,0,0,0,0x80,0xff,0xff,0xff,0x01,0,0,0,0xc0,0xff,
-0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0x07,0,0xf8,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0xe0,0x1c,
-0,0,0,0x80,0xff,0xff,0xff,0x01,0,0,0,0xc0,0xff,0xff,0x03,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0x03,
-0,0xfe,0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0xe0,0x1f,0,0,
-0,0xf0,0xff,0xff,0,0,0,0,0,0x80,0xff,0xff,0x07,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0,0xff,
-0xff,0xff,0xc7,0x03,0,0,0x1c,0,0,0x80,0x1f,0,0,0,0xff,
-0xff,0x03,0,0,0,0xfc,0x03,0x80,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0x03,0xc0,0xff,0xff,0xff,
-0xc7,0x03,0,0,0x1e,0,0,0,0x1f,0,0,0xf8,0xff,0x0f,0,
-0x80,0xff,0xff,0xff,0x1f,0,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0x01,0xf0,0xff,0xff,0xff,0xc3,0x03,
-0,0,0xfe,0xff,0,0,0x1f,0,0xe0,0xff,0x3f,0,0,0x80,0xff,
-0xff,0xff,0x3f,0,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0,0,
-0xfe,0xff,0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0x80,0xff,0xff,0xff,
-0x7f,0,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0x01,0xfc,0xff,0xff,0xff,0xc1,0x03,0,0,0xfe,0xff,
-0xff,0xff,0xff,0xff,0xff,0xff,0x01,0,0,0x80,0xff,0xff,0xff,0x7f,0,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xe0,
-0xff,0xff,0x01,0xff,0xff,0xff,0xff,0x80,0x03,0,0,0xfe,0xff,0xff,0xff,
-0xff,0xff,0xff,0x07,0,0,0,0,0xfe,0xff,0xff,0xff,0x01,0xfe,0xff,
-0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0x80,0xff,0xff,0xff,0x3f,0,0,0,0,0x7c,0,0,0xf5,0xff,0xff,
-0x3f,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x07,0xfe,0xff,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0x7f,0xf0,0xff,
-0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0xff,0x1f,0xfe,0xff,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,
-0x03,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0xff,0x7f,0xf8,0xff,0xff,0xff,0x03,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xc0,0xff,0xff,0xff,0x3f,0xfe,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0xff,0xff,0xfc,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0xff,0xff,0xff,0xff,0xff,0x3f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,
-0xff,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0xff,0xff,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0xff,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,
-0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,
-0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0xff,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0x7f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0xff,0x7f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfc,0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,
-0xff,0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,0xff,
-0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xfe,
-0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0xff,
-0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,
-0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0xff,0x01,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0xff,0xff,0xff,0x01,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0xff,0xff,0x1f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xc0,0xff,0xff,0xff,0xff,0x07,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xf0,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xf0,0xff,0xff,0xff,0xff,0x03,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0xff,0xff,0xff,0xff,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,
-0xff,0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0xff,0xff,
-0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x0f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfc,0xff,0xff,0xff,0x0f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0xff,0xff,0xff,0x03,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xf8,0xff,0xff,0xff,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0xff,0xff,0xff,0x01,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xe0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf8,0xff,0xff,0x7f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0xff,0xff,0x0f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xf8,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xff,0xff,0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,
-0xff,0x3f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,
-0xff,0x1f,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x07,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x3f,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xfc,0xff,0xff,0x03,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0xf8,0xff,0xff,0x3f,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xfe,0xff,0xff,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0xe0,0xff,0xff,0x3f,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0xfe,0xff,0x3f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0xff,0x3f,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xfe,0xff,0x3f,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0x80,0xff,0xff,0x3f,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xfe,0xff,0x0f,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xfe,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xff,
-0xff,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xfc,0xff,0x7f,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xff,0xff,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xf0,0xff,
-0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0x3f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,0x7f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0x80,0xff,0x1f,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0x80,0xff,0xff,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0xc0,0xff,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xfe,0xff,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0xc0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xfc,0xff,0x01,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,
-0x7f,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xf0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0xe0,0x1f,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0xc0,0xff,0x01,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xe0,0x1f,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0xc0,0xff,
-0x01,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xe0,0x0f,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0x80,0xff,0x01,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0xfe,0x03,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0x78,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0xf8,0x03,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0x18,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0x18,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0xf0,0x03,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0xc0,0x07,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0x07,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-};
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* This file was ported from xlock for use in xscreensaver (and standalone)
- * by jwz on 18-Oct-93. Original copyright reads:
- *
- * static char sccsid[] = "@(#)flame.c 1.4 91/09/27 XLOCK";
- *
- * flame.c - recursive fractal cosmic flames.
- *
- * Copyright (c) 1991 by Patrick J. Naughton.
- *
- * Permission to use, copy, modify, and distribute this software and its
- * documentation for any purpose and without fee is hereby granted,
- * provided that the above copyright notice appear in all copies and that
- * both that copyright notice and this permission notice appear in
- * supporting documentation.
- *
- * This file is provided AS IS with no warranties of any kind. The author
- * shall have no liability with respect to the infringement of copyrights,
- * trade secrets or any patents by this file or any part thereof. In no
- * event will the author be liable for any lost revenue or profits or
- * other special, indirect and consequential damages.
- *
- * Comments and additions should be sent to the author:
- *
- * naughton@eng.sun.com
- *
- * Patrick J. Naughton
- * MS 21-14
- * Sun Laboritories, Inc.
- * 2550 Garcia Ave
- * Mountain View, CA 94043
- *
- * Revision History:
- * 27-Jun-91: vary number of functions used.
- * 24-Jun-91: fixed portability problem with integer mod (%).
- * 06-Jun-91: Written. (received from Scott Graves, spot@cs.cmu.edu).
- */
-
-#include "screenhack.h"
-
-#define POINT_BUFFER_SIZE 10
-#define MAXLEV 4
-
-static double f[2][3][MAXLEV]; /* three non-homogeneous transforms */
-static int max_total;
-static int max_levels;
-static int max_points;
-static int cur_level;
-static int snum;
-static int anum;
-static int num_points;
-static int total_points;
-static int pixcol;
-static int npixels;
-static unsigned long *pixels;
-static XPoint points [POINT_BUFFER_SIZE];
-static GC gc;
-
-static int delay, delay2;
-static int width, height;
-
-static short
-halfrandom (mv)
- int mv;
-{
- static short lasthalf = 0;
- unsigned long r;
-
- if (lasthalf)
- {
- r = lasthalf;
- lasthalf = 0;
- }
- else
- {
- r = random ();
- lasthalf = r >> 16;
- }
- return (r % mv);
-}
-
-
-static void
-init_flame (dpy, window)
- Display *dpy;
- Window window;
-{
- XGCValues gcv;
- XWindowAttributes xgwa;
- Colormap cmap;
- XGetWindowAttributes (dpy, window, &xgwa);
- width = xgwa.width;
- height = xgwa.height;
- cmap = xgwa.colormap;
-
- max_points = get_integer_resource ("iterations", "Integer");
- if (max_points <= 0) max_points = 100;
-
- max_levels = max_points;
-
- max_total = get_integer_resource ("points", "Integer");
- if (max_total <= 0) max_total = 10000;
-
- delay = get_integer_resource ("delay", "Integer");
- if (delay < 0) delay = 0;
- delay2 = get_integer_resource ("delay2", "Integer");
- if (delay2 < 0) delay2 = 0;
-
- if (mono_p)
- npixels = 0;
- else
- {
- int i = get_integer_resource ("ncolors", "Integer");
- double saturation = 1.0;
- double value = 1.0;
- XColor color;
- if (i <= 0) i = 128;
-
- pixels = (unsigned long *) malloc ((i+1) * sizeof (*pixels));
- for (npixels = 0; npixels < i; npixels++)
- {
- hsv_to_rgb ((360*npixels)/i, saturation, value,
- &color.red, &color.green, &color.blue);
- if (! XAllocColor (dpy, cmap, &color))
- break;
- pixels [npixels] = color.pixel;
- }
- }
-
- gcv.foreground = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- gcv.background = get_pixel_resource ("background", "Background", dpy, cmap);
-
- if (! mono_p)
- {
- pixcol = halfrandom (npixels);
- gcv.foreground = (pixels [pixcol]);
- }
-
- gc = XCreateGC (dpy, window, GCForeground | GCBackground, &gcv);
-}
-
-static int
-recurse (x, y, l, dpy, win)
- register double x, y;
- register int l;
- Display *dpy;
- Window win;
-{
- int xp, yp, i;
- double nx, ny;
-
- if (l == max_levels)
- {
- total_points++;
- if (total_points > max_total) /* how long each fractal runs */
- return 0;
-
- if (x > -1.0 && x < 1.0 && y > -1.0 && y < 1.0)
- {
- xp = points[num_points].x = (int) ((width / 2) * (x + 1.0));
- yp = points[num_points].y = (int) ((height / 2) * (y + 1.0));
- num_points++;
- if (num_points >= POINT_BUFFER_SIZE)
- {
- XDrawPoints (dpy, win, gc, points, num_points, CoordModeOrigin);
- num_points = 0;
- /* if (delay) usleep (delay); */
- /* XSync (dpy, True); */
- }
- }
- }
- else
- {
- for (i = 0; i < snum; i++)
- {
- nx = f[0][0][i] * x + f[0][1][i] * y + f[0][2][i];
- ny = f[1][0][i] * x + f[1][1][i] * y + f[1][2][i];
- if (i < anum)
- {
- nx = sin(nx);
- ny = sin(ny);
- }
- if (!recurse (nx, ny, l + 1, dpy, win))
- return 0;
- }
- }
- return 1;
-}
-
-
-static void
-flame (dpy, window)
- Display *dpy;
- Window window;
-{
- int i, j, k;
- static int alt = 0;
-
- if (!(cur_level++ % max_levels))
- {
- if (delay2) usleep (delay2);
- XClearWindow (dpy, window);
- alt = !alt;
- }
- else
- {
- if (npixels > 2)
- {
- XSetForeground (dpy, gc, pixels [pixcol]);
- if (--pixcol < 0)
- pixcol = npixels - 1;
- }
- }
-
- /* number of functions */
- snum = 2 + (cur_level % (MAXLEV - 1));
-
- /* how many of them are of alternate form */
- if (alt)
- anum = 0;
- else
- anum = halfrandom (snum) + 2;
-
- /* 6 coefs per function */
- for (k = 0; k < snum; k++)
- {
- for (i = 0; i < 2; i++)
- for (j = 0; j < 3; j++)
- f[i][j][k] = ((double) (random() & 1023) / 512.0 - 1.0);
- }
- num_points = 0;
- total_points = 0;
- (void) recurse (0.0, 0.0, 0, dpy, window);
- XDrawPoints (dpy, window, gc, points, num_points, CoordModeOrigin);
- XSync (dpy, True);
- if (delay) usleep (delay);
-}
-
-
-#ifdef __hpux
-/* I don't understand why this is necessary, but I'm told that this program
- does nothing at all on HP-sUX without it.
- */
-#undef random
-#undef srandom
-#include <math.h>
-int matherr(x)
- register struct exception *x;
-{
- if (x->type == PLOSS) return 1;
- else return 0;
-}
-#endif /* __hpux */
-
-
-\f
-char *progclass = "Flame";
-
-char *defaults [] = {
- "Flame.background: black", /* to placate SGI */
- "Flame.foreground: white",
- "*colors: 128",
- "*iterations: 25",
- "*delay: 50000",
- "*delay2: 2000000",
- "*points: 10000",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-ncolors", ".colors", XrmoptionSepArg, 0 },
- { "-iterations", ".iterations", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-delay2", ".delay2", XrmoptionSepArg, 0 },
- { "-points", ".points", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_flame (dpy, window);
- while (1)
- flame (dpy, window);
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-flame - draw weird cosmic fractals
-.SH SYNOPSIS
-.B flame
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-iterations \fIinteger\fP] [\-points \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-delay2 \fImicroseconds\fP]
-.SH DESCRIPTION
-The \fIflame\fP program generates colorful fractal displays.
-.SH OPTIONS
-.I flame
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-ncolors \fIinteger\fP
-How many colors should be used (if possible). Default 128.
-The colors used cycle through the hue, making N stops around
-the color wheel.
-.TP 8
-.B \-iterations \fIinteger\fP
-How many fractals to generate. Default 25.
-.TP 8
-.B \-points \fIinteger\fP
-How many pixels to draw for each fractal. Default 10000.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How long we should wait between drawing each fractal. Default 50000,
-or about 1/20th second.
-.TP 8
-.B \-delay2 \fImicroseconds\fP
-How long we should wait before clearing the screen when each run ends.
-Default 2000000, or two seconds.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1),
-.BR xlock (1)
-.SH COPYRIGHT
-Copyright \(co 1991 by Patrick J. Naughton
-
-Permission to use, copy, modify, and distribute this software and its
-documentation for any purpose and without fee is hereby granted,
-provided that the above copyright notice appear in all copies and that
-both that copyright notice and this permission notice appear in
-supporting documentation.
-.SH AUTHOR
-Scott Graves <spot@cs.cmu.edu>, 06-Jun-91.n
-
-Ability to run standalone or with \fIxscreensaver\fP added by
-Jamie Zawinski <jwz@netscape.com>, 18-Oct-93.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "screenhack.h"
-
-#define NBITS 12
-
-#include <X11/bitmaps/stipple>
-#include <X11/bitmaps/cross_weave>
-#include <X11/bitmaps/dimple1>
-#include <X11/bitmaps/dimple3>
-#include <X11/bitmaps/flipped_gray>
-#include <X11/bitmaps/gray1>
-#include <X11/bitmaps/gray3>
-#include <X11/bitmaps/hlines2>
-#include <X11/bitmaps/light_gray>
-#include <X11/bitmaps/root_weave>
-#include <X11/bitmaps/vlines2>
-#include <X11/bitmaps/vlines3>
-
-static Pixmap pixmaps [NBITS];
-static GC gc;
-static int delay;
-static unsigned long fg, bg, pixels [512];
-static int npixels;
-
-static void
-init_greynetic (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- XGCValues gcv;
- XWindowAttributes xgwa;
- Colormap cmap;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- npixels = 0;
- gcv.foreground= fg= get_pixel_resource("foreground","Foreground", dpy, cmap);
- gcv.background= bg= get_pixel_resource("background","Background", dpy, cmap);
- gcv.fill_style= FillOpaqueStippled;
- gc = XCreateGC (dpy, window, GCForeground|GCBackground|GCFillStyle, &gcv);
-
- delay = get_integer_resource ("delay", "Integer");
- if (delay < 0) delay = 0;
-
- i = 0;
-#define BITS(n,w,h) \
- pixmaps [i++] = XCreatePixmapFromBitmapData (dpy, window, n, w, h, 1, 0, 1)
-
- BITS (stipple_bits, stipple_width, stipple_height);
- BITS (cross_weave_bits, cross_weave_width, cross_weave_height);
- BITS (dimple1_bits, dimple1_width, dimple1_height);
- BITS (dimple3_bits, dimple3_width, dimple3_height);
- BITS (flipped_gray_bits, flipped_gray_width, flipped_gray_height);
- BITS (gray1_bits, gray1_width, gray1_height);
- BITS (gray3_bits, gray3_width, gray3_height);
- BITS (hlines2_bits, hlines2_width, hlines2_height);
- BITS (light_gray_bits, light_gray_width, light_gray_height);
- BITS (root_weave_bits, root_weave_width, root_weave_height);
- BITS (vlines2_bits, vlines2_width, vlines2_height);
- BITS (vlines3_bits, vlines3_width, vlines3_height);
-}
-
-static void
-greynetic (dpy, window)
- Display *dpy;
- Window window;
-{
- static int tick = 500, xlim, ylim;
- static Colormap cmap;
- int x, y, w, h, i;
- XGCValues gcv;
- if (tick++ == 500)
- {
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- tick = 0;
- xlim = xgwa.width;
- ylim = xgwa.height;
- cmap = xgwa.colormap;
- }
- for (i = 0; i < 10; i++) /* minimize area, but don't try too hard */
- {
- w = 50 + random () % (xlim - 50);
- h = 50 + random () % (ylim - 50);
- if (w + h < xlim && w + h < ylim)
- break;
- }
- x = random () % (xlim - w);
- y = random () % (ylim - h);
- gcv.stipple = pixmaps [random () % NBITS];
- if (mono_p)
- {
- if (random () & 1)
- gcv.foreground = fg, gcv.background = bg;
- else
- gcv.foreground = bg, gcv.background = fg;
- }
- else
- {
- XColor fgc, bgc;
- if (npixels == sizeof (pixels) / sizeof (unsigned long))
- goto REUSE;
- fgc.flags = bgc.flags = DoRed|DoGreen|DoBlue;
- fgc.red = random ();
- fgc.green = random ();
- fgc.blue = random ();
- bgc.red = random ();
- bgc.green = random ();
- bgc.blue = random ();
- if (! XAllocColor (dpy, cmap, &fgc))
- goto REUSE;
- pixels [npixels++] = fgc.pixel;
- gcv.foreground = fgc.pixel;
- if (! XAllocColor (dpy, cmap, &bgc))
- goto REUSE;
- pixels [npixels++] = bgc.pixel;
- gcv.background = bgc.pixel;
- goto DONE;
- REUSE:
- gcv.foreground = pixels [random () % npixels];
- gcv.background = pixels [random () % npixels];
- DONE:
- ;
- }
- XChangeGC (dpy, gc, GCStipple|GCForeground|GCBackground, &gcv);
- XFillRectangle (dpy, window, gc, x, y, w, h);
- XSync (dpy, True);
-}
-
-\f
-char *progclass = "Greynetic";
-
-char *defaults [] = {
- "Greynetic.background: black", /* to placate SGI */
- "Greynetic.foreground: white",
- "*delay: 0",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-delay", ".delay", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_greynetic (dpy, window);
- while (1)
- {
- greynetic (dpy, window);
- if (delay) usleep (delay);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-greynetic - draw random stippled/color rectangles
-.SH SYNOPSIS
-.B greynetic
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIusecs\fP]
-.SH DESCRIPTION
-The \fIgreynetic\fP program draws random rectangles.
-.SH OPTIONS
-.I greynetic
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-delay \fImicroseconds\fP
-Slow it down.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* I wanted to lay down new circles with TV:ALU-ADD instead of TV:ALU-XOR,
- but X doesn't support arithmetic combinations of pixmaps!! What losers.
- I suppose I could crank out the 2's compliment math by hand, but that's
- a real drag...
-
- This would probably look good with shapes other than circles as well.
-
- */
-
-#include "screenhack.h"
-#include <stdio.h>
-
-struct circle {
- int x, y, radius;
- int increment;
- int dx, dy;
-};
-
-static enum color_mode {
- seuss_mode, ramp_mode, random_mode
-} cmode;
-
-
-static struct circle *circles;
-static int count, global_count;
-static Pixmap pixmap, buffer;
-static int width, height, global_inc;
-static int delay;
-static unsigned long fg_pixel, bg_pixel;
-static XColor fgc, bgc;
-static GC draw_gc, erase_gc, copy_gc, merge_gc;
-static Bool anim_p;
-static Colormap cmap;
-
-#define min(x,y) ((x)<(y)?(x):(y))
-#define max(x,y) ((x)>(y)?(x):(y))
-
-static void
-init_circles_1 (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- count = (global_count ? global_count
- : (3 + (random () % max (1, (min (width, height) / 50)))
- + (random () % max (1, (min (width, height) / 50)))));
- circles = (struct circle *) malloc (count * sizeof (struct circle));
- for (i = 0; i < count; i++)
- {
- circles [i].x = 10 + random () % (width - 20);
- circles [i].y = 10 + random () % (height - 20);
- if (global_inc)
- circles [i].increment = global_inc;
- else
- { /* prefer smaller increments to larger ones */
- int j = 8;
- int inc = ((random()%j) + (random()%j) + (random()%j)) - ((j*3)/2);
- if (inc < 0) inc = -inc + 3;
- circles [i].increment = inc + 3;
- }
- circles [i].radius = random () % circles [i].increment;
- circles [i].dx = ((random () % 3) - 1) * (1 + random () % 5);
- circles [i].dy = ((random () % 3) - 1) * (1 + random () % 5);
- }
-}
-
-static void
-init_circles (dpy, window)
- Display *dpy;
- Window window;
-{
- XGCValues gcv;
- XWindowAttributes xgwa;
- char *mode_str = 0;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- global_count = get_integer_resource ("count", "Integer");
- if (global_count < 0) global_count = 0;
- global_inc = get_integer_resource ("increment", "Integer");
- if (global_inc < 0) global_inc = 0;
- anim_p = get_boolean_resource ("animate", "Boolean");
- delay = get_integer_resource ("delay", "Integer");
- mode_str = get_string_resource ("colorMode", "ColorMode");
- if (! mode_str) cmode = random_mode;
- else if (!strcmp (mode_str, "seuss")) cmode = seuss_mode;
- else if (!strcmp (mode_str, "ramp")) cmode = ramp_mode;
- else if (!strcmp (mode_str, "random")) cmode = random_mode;
- else {
- fprintf (stderr,
- "%s: colorMode must be seuss, ramp, or random, not \"%s\"\n",
- progname, mode_str);
- exit (1);
- }
-
- if (mono_p) cmode = seuss_mode;
- if (cmode == random_mode)
- cmode = ((random()&3) == 1) ? ramp_mode : seuss_mode;
-
- if (cmode == ramp_mode)
- anim_p = False; /* This combo doesn't work right... */
-
- if (mono_p)
- {
- fg_pixel = get_pixel_resource ("foreground","Foreground", dpy, cmap);
- bg_pixel = get_pixel_resource ("background","Background", dpy, cmap);
- }
- else
- {
- int r = random() % 360;
- int r2 = (random() % 180) + 45;
- double fs, bs;
- if (cmode == seuss_mode)
- fs = 0.5, bs = 1.0;
- else
- fs = 1.0, bs = 0.1;
- hsv_to_rgb (r, fs, 1.0, &fgc.red, &fgc.green, &fgc.blue);
- hsv_to_rgb ((r+r2)%360, bs, 0.7, &bgc.red, &bgc.green, &bgc.blue);
- XAllocColor (dpy, cmap, &fgc);
- XAllocColor (dpy, cmap, &bgc);
- fg_pixel = fgc.pixel;
- bg_pixel = bgc.pixel;
- }
-
- width = max (50, xgwa.width);
- height = max (50, xgwa.height);
-
-#ifdef DEBUG
- width/=2; height/=2;
-#endif
-
- pixmap = XCreatePixmap (dpy, window, width, height, 1);
- if (cmode == seuss_mode)
- buffer = XCreatePixmap (dpy, window, width, height, 1);
- else
- buffer = 0;
-
- gcv.foreground = 1;
- gcv.background = 0;
- draw_gc = XCreateGC (dpy, pixmap, GCForeground | GCBackground, &gcv);
- gcv.foreground = 0;
- erase_gc = XCreateGC (dpy, pixmap, GCForeground, &gcv);
- gcv.foreground = fg_pixel;
- gcv.background = bg_pixel;
- copy_gc = XCreateGC (dpy, window, GCForeground | GCBackground, &gcv);
-
- if (cmode == seuss_mode)
- {
- gcv.foreground = 1;
- gcv.background = 0;
- gcv.function = GXxor;
- merge_gc = XCreateGC (dpy, pixmap,
- GCForeground | GCBackground | GCFunction, &gcv);
- }
- else
- {
- gcv.foreground = fg_pixel;
- gcv.background = bg_pixel;
- gcv.function = GXcopy;
- merge_gc = XCreateGC (dpy, window,
- GCForeground | GCBackground | GCFunction, &gcv);
- }
-
- init_circles_1 (dpy, window);
- XClearWindow (dpy, window);
- if (buffer) XFillRectangle (dpy, buffer, erase_gc, 0, 0, width, height);
-}
-
-static void
-run_circles (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- static int iterations = 0;
- static int oiterations = 0;
- static Bool first_time_p = True;
- Bool done = False;
- Bool inhibit_sleep = False;
- XFillRectangle (dpy, pixmap, erase_gc, 0, 0, width, height);
- for (i = 0; i < count; i++)
- {
- int radius = circles [i].radius;
- int inc = circles [i].increment;
- if (! (iterations & 1))
- ;
- else if (radius == 0)
- ;
- else if (radius < 0)
- done = True;
- else
- {
- /* Probably there's a simpler way to ask the musical question,
- "is this square completely enclosed by this circle," but I've
- forgotten too much trig to know it... (That's not really the
- right question anyway, but the right question is too hard.) */
- double x1 = ((double) (-circles [i].x)) / ((double) radius);
- double y1 = ((double) (-circles [i].y)) / ((double) radius);
- double x2 = ((double) (width - circles [i].x)) / ((double) radius);
- double y2 = ((double) (height - circles [i].y)) / ((double) radius);
- x1 *= x1; x2 *= x2; y1 *= y1; y2 *= y2;
- if ((x1 + y1) < 1 && (x2 + y2) < 1 && (x1 + y2) < 1 && (x2 + y1) < 1)
- done = True;
- }
- if (radius > 0 &&
- (cmode == seuss_mode || circles [0].increment < 0))
- XFillArc (dpy,
- (cmode == seuss_mode ? pixmap : window),
- (cmode == seuss_mode ? draw_gc : merge_gc),
- circles [i].x - radius, circles [i].y - radius,
- radius * 2, radius * 2, 0, 360*64);
- circles [i].radius += inc;
- }
-
- if (anim_p && !first_time_p)
- inhibit_sleep = !done;
-
- if (done)
- {
- if (anim_p)
- {
- first_time_p = False;
- for (i = 0; i < count; i++)
- {
- circles [i].x += circles [i].dx;
- circles [i].y += circles [i].dy;
- circles [i].radius %= circles [i].increment;
- if (circles [i].x < 0 || circles [i].x >= width)
- {
- circles [i].dx = -circles [i].dx;
- circles [i].x += (2 * circles [i].dx);
- }
- if (circles [i].y < 0 || circles [i].y >= height)
- {
- circles [i].dy = -circles [i].dy;
- circles [i].y += (2 * circles [i].dy);
- }
- }
- }
- else if (circles [0].increment < 0)
- {
- free (circles);
- init_circles_1 (dpy, window);
- if (! mono_p)
- {
- XColor d1, d2;
- cycle_hue (&fgc, 10);
- cycle_hue (&bgc, 10);
- XFreeColors (dpy, cmap, &fgc.pixel, 1, 0);
- XFreeColors (dpy, cmap, &bgc.pixel, 1, 0);
- d1 = fgc;
- d2 = bgc;
- XAllocColor (dpy, cmap, &fgc);
- XAllocColor (dpy, cmap, &bgc);
- fgc.red = d1.red; fgc.green = d1.green; fgc.blue = d1.blue;
- bgc.red = d2.red; bgc.green = d2.green; bgc.blue = d2.blue;
- XSetForeground (dpy, copy_gc, fgc.pixel);
- XSetBackground (dpy, copy_gc, bgc.pixel);
- }
- }
-#if 0
- else if ((random () % 2) == 0)
- {
- iterations = 0; /* ick */
- for (i = 0; i < count; i++)
- circles [i].radius %= circles [i].increment;
- }
-#endif
- else
- {
- oiterations = iterations;
- for (i = 0; i < count; i++)
- {
- circles [i].increment = -circles [i].increment;
- circles [i].radius += (2 * circles [i].increment);
- }
- }
- }
-
- if (buffer)
- XCopyPlane (dpy, pixmap, buffer, merge_gc, 0, 0, width, height, 0, 0, 1);
- else if (cmode != seuss_mode)
- {
- static int ncolors = 0;
- static XColor *colors = 0;
- if (circles [0].increment >= 0)
- inhibit_sleep = True;
- else if (done)
- {
- int fgh, bgh;
- double fgs, fgv, bgs, bgv;
- if (colors)
- for (i = 0; i < ncolors; i++)
- XFreeColors (dpy, cmap, &colors [i].pixel, 1, 0);
-
- rgb_to_hsv (fgc.red, fgc.green, fgc.blue, &fgh, &fgs, &fgv);
- rgb_to_hsv (bgc.red, bgc.green, bgc.blue, &bgh, &bgs, &bgv);
- ncolors = oiterations;
- colors = ((XColor *)
- (colors
- ? realloc (colors, sizeof (XColor) * ncolors)
- : malloc (sizeof (XColor) * ncolors)));
-
- make_color_ramp (bgh, bgs, bgv, fgh, fgs, fgv, colors, ncolors);
- for (i = 0; i < ncolors; i++)
- XAllocColor (dpy, cmap, &colors [i]);
- XSetForeground (dpy, merge_gc, colors [0].pixel);
- }
- else
- {
- XSetForeground (dpy, merge_gc, colors [iterations].pixel);
- }
- }
- else
- XCopyPlane (dpy, pixmap, window, merge_gc, 0, 0, width, height, 0, 0, 1);
-
- if (buffer && (anim_p
- ? (done || (first_time_p && (iterations & 1)))
- : (iterations & 1)))
- {
- XCopyPlane (dpy, buffer, window, copy_gc, 0, 0, width, height, 0, 0, 1);
- XSync (dpy, True);
- if (anim_p && done)
- XFillRectangle (dpy, buffer, erase_gc, 0, 0, width, height);
- }
-#ifdef DEBUG
- XCopyPlane (dpy, pixmap, window, copy_gc, 0,0,width,height,width,height, 1);
- if (buffer)
- XCopyPlane (dpy, buffer, window, copy_gc, 0,0,width,height,0,height, 1);
- XSync (dpy, True);
-#endif
-
- if (done)
- iterations = 0;
- else
- iterations++;
-
- if (delay && !inhibit_sleep) usleep (delay);
-}
-
-\f
-char *progclass = "Halo";
-
-char *defaults [] = {
- "Halo.background: black", /* to placate SGI */
- "Halo.foreground: white",
- "*colorMode: random",
- "*count: 0",
- "*delay: 100000",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-count", ".count", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-animate", ".animate", XrmoptionNoArg, "True" },
- { "-mode", ".colorMode", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_circles (dpy, window);
- while (1)
- run_circles (dpy, window);
-}
+++ /dev/null
-.TH XScreenSaver 1 "7-jul-93" "X Version 11"
-.SH NAME
-halo - draw circular patterns
-.SH SYNOPSIS
-.B halo
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-count \fIint\fP] [\-delay \fIusecs\fP] [\-mode seuss | ramp | random ] [\-animate]
-.SH DESCRIPTION
-The \fIhalo\fP program draws cool patterns based on circles.
-.SH OPTIONS
-.I halo
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-count \fIinteger\fP
-How many circles to draw. Default 0, meaning random.
-.TP 8
-.B \-mode "seuss | ramp | random"
-In \fIseuss\fP mode, alternating striped curves will be drawn.
-
-In \fIramp\fP mode, a color ramp will be drawn.
-
-\fIrandom\fP means pick the mode randomly.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How much of a delay should be introduced between steps of the animation.
-Default 100000, or about 0.1 second.
-.TP 8
-.B \-animate
-If specified, then the centerpoints of the circles will bounce around.
-Otherwise, the circles will be drawn once, erased, and a new set of
-circles will be drawn.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1993 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 6-jul-93.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include <math.h>
-#include "screenhack.h"
-
-static double sins [360];
-static double coss [360];
-
-static GC draw_gc, erase_gc;
-static unsigned int default_fg_pixel;
-
-static void
-init_helix (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- XGCValues gcv;
- XWindowAttributes xgwa;
- Colormap cmap;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- gcv.foreground = default_fg_pixel =
- get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- gcv.foreground = get_pixel_resource ("background", "Background", dpy, cmap);
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
-
- for (i = 0; i < 360; i++)
- {
- sins [i] = sin ((((double) i) / 180.0) * M_PI);
- coss [i] = cos ((((double) i) / 180.0) * M_PI);
- }
-}
-
-static int
-gcd (a, b)
- int a, b;
-{
- while (b > 0)
- {
- int tmp;
- tmp = a % b;
- a = b;
- b = tmp;
- }
- return (a < 0 ? -a : a);
-}
-
-static void
-helix (dpy, window,
- radius1, radius2, d_angle,
- factor1, factor2, factor3, factor4)
- Display *dpy;
- Window window;
- int radius1, radius2, d_angle;
- int factor1, factor2, factor3, factor4;
-{
- XWindowAttributes xgwa;
- int width, height;
- int xmid, ymid;
- int x1, y1, x2, y2, angle, limit;
- int i;
-
- XClearWindow (dpy, window);
- XGetWindowAttributes (dpy, window, &xgwa);
- width = xgwa.width;
- height = xgwa.height;
-
- xmid = width / 2;
- ymid = height / 2;
- x1 = xmid;
- y1 = ymid + radius2;
- x2 = xmid;
- y2 = ymid + radius1;
- angle = 0;
- limit = 1 + (360 / gcd (360, d_angle));
-
- for (i = 0; i < limit; i++)
- {
- int tmp;
-#define pmod(x,y) (tmp = (x % y), (tmp >= 0 ? tmp : tmp + y))
- x1 = xmid + (((double) radius1) * sins [pmod ((angle * factor1), 360)]);
- y1 = ymid + (((double) radius2) * coss [pmod ((angle * factor2), 360)]);
- XDrawLine (dpy, window, draw_gc, x1, y1, x2, y2);
- x2 = xmid + (((double) radius2) * sins [pmod ((angle * factor3), 360)]);
- y2 = ymid + (((double) radius1) * coss [pmod ((angle * factor4), 360)]);
- XDrawLine (dpy, window, draw_gc, x1, y1, x2, y2);
- angle += d_angle;
- XFlush (dpy);
- }
-}
-
-#define min(a,b) ((a)<(b)?(a):(b))
-
-static void
-random_helix (dpy, window)
- Display *dpy;
- Window window;
-{
- Colormap cmap;
- int width, height;
- int radius, radius1, radius2, d_angle, factor1, factor2, factor3, factor4;
- double divisor;
- XColor color;
- int i, got_color = 0;
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- width = xgwa.width;
- height = xgwa.height;
- cmap = xgwa.colormap;
-
- radius = min (width, height) / 2;
-
- d_angle = 0;
- factor1 = 2;
- factor2 = 2;
- factor3 = 2;
- factor4 = 2;
-
- divisor = ((frand (3.0) + 1) * (((random() & 1) * 2) - 1));
-
- if ((random () & 1) == 0)
- {
- radius1 = radius;
- radius2 = radius / divisor;
- }
- else
- {
- radius2 = radius;
- radius1 = radius / divisor;
- }
-
- while (gcd (360, d_angle) >= 2)
- d_angle = random () % 360;
-
-#define random_factor() \
- (((random() % 7) ? ((random() & 1) + 1) : 3) \
- * (((random() & 1) * 2) - 1))
-
- while (gcd (gcd (gcd (factor1, factor2), factor3), factor4) != 1)
- {
- factor1 = random_factor ();
- factor2 = random_factor ();
- factor3 = random_factor ();
- factor4 = random_factor ();
- }
-
- if (mono_p)
- XSetForeground (dpy, draw_gc, default_fg_pixel);
- else
- {
- hsv_to_rgb (random () % 360, frand (1.0), frand (0.5) + 0.5,
- &color.red, &color.green, &color.blue);
- if ((got_color = XAllocColor (dpy, cmap, &color)))
- XSetForeground (dpy, draw_gc, color.pixel);
- else
- XSetForeground (dpy, draw_gc, default_fg_pixel);
- }
- helix (dpy, window, radius1, radius2, d_angle,
- factor1, factor2, factor3, factor4);
-
- XSync (dpy, True);
- sleep (5);
-
- for (i = 0; i < height; i++)
- {
- int y = (random () % height);
- XDrawLine (dpy, window, erase_gc, 0, y, width, y);
- XFlush (dpy);
- if ((i % 50) == 0)
- usleep (10000);
- }
- XClearWindow (dpy, window);
- if (got_color) XFreeColors (dpy, cmap, &color.pixel, 1, 0);
- XSync (dpy, True);
- sleep (1);
-}
-
-\f
-char *progclass = "Helix";
-
-char *defaults [] = {
- "Helix.background: black", /* to placate SGI */
- 0
-};
-
-XrmOptionDescRec options [] = { { 0, } };
-int options_size = 0;
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_helix (dpy, window);
- while (1)
- random_helix (dpy, window);
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-helix - draw helical string-art patterns
-.SH SYNOPSIS
-.B helix
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP]
-.SH DESCRIPTION
-The \fIhelix\fP program draws interesting patterns composed of line segments
-in random colors.
-.SH OPTIONS
-.I helix
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* This file was ported from xlock for use in xscreensaver (and standalone)
- * by jwz on 12-Aug-92. Original copyright reads:
- *
- * hopalong.c - Real Plane Fractals for xlock, the X Window System lockscreen.
- *
- * Copyright (c) 1991 by Patrick J. Naughton.
- *
- * Permission to use, copy, modify, and distribute this software and its
- * documentation for any purpose and without fee is hereby granted,
- * provided that the above copyright notice appear in all copies and that
- * both that copyright notice and this permission notice appear in
- * supporting documentation.
- *
- * This file is provided AS IS with no warranties of any kind. The author
- * shall have no liability with respect to the infringement of copyrights,
- * trade secrets or any patents by this file or any part thereof. In no
- * event will the author be liable for any lost revenue or profits or
- * other special, indirect and consequential damages.
- *
- * Comments and additions should be sent to the author:
- *
- * naughton@eng.sun.com
- *
- * Patrick J. Naughton
- * MS 21-14
- * Sun Laboritories, Inc.
- * 2550 Garcia Ave
- * Mountain View, CA 94043
- *
- * Revision History:
- * 29-Oct-90: fix bad (int) cast.
- * 29-Jul-90: support for multiple screens.
- * 08-Jul-90: new timing and colors and new algorithm for fractals.
- * 15-Dec-89: Fix for proper skipping of {White,Black}Pixel() in colors.
- * 08-Oct-89: Fixed long standing typo bug in RandomInitHop();
- * Fixed bug in memory allocation in inithop();
- * Moved seconds() to an extern.
- * Got rid of the % mod since .mod is slow on a sparc.
- * 20-Sep-89: Lint.
- * 31-Aug-88: Forked from xlock.c for modularity.
- * 23-Mar-88: Coded HOPALONG routines from Scientific American Sept. 86 p. 14.
- */
-
-#include <math.h>
-#include "screenhack.h"
-
-static GC gc;
-static int batchcount = 1000;
-
-static unsigned int *pixels = 0, fg_pixel, bg_pixel;
-static int npixels;
-static unsigned int delay;
-static int timeout;
-
-typedef struct {
- int centerx;
- int centery; /* center of the screen */
- double a;
- double b;
- double c;
- double i;
- double j; /* hopalong parameters */
- int inc;
- int pix;
- long startTime;
-} hopstruct;
-
-static hopstruct hop;
-static XPoint *pointBuffer = 0; /* pointer for XDrawPoints */
-
-static void
-inithop(dsp,win)
- Display *dsp;
- Window win;
-{
- double range;
- XWindowAttributes xgwa;
- hopstruct *hp = &hop;
- XGCValues gcv;
- Colormap cmap;
- XGetWindowAttributes (dsp, win, &xgwa);
- cmap = xgwa.colormap;
-
- if (! pixels)
- {
- XColor color;
- int i = get_integer_resource ("ncolors", "Integer");
- int shift;
- if (i <= 2) i = 2, mono_p = True;
- shift = 360 / i;
- pixels = (unsigned int *) calloc (i, sizeof (unsigned int));
- fg_pixel = get_pixel_resource ("foreground", "Foreground", dsp, cmap);
- bg_pixel = get_pixel_resource ("background", "Background", dsp, cmap);
- if (! mono_p)
- {
- hsv_to_rgb (random () % 360, 1.0, 1.0,
- &color.red, &color.green, &color.blue);
- for (npixels = 0; npixels < i; npixels++)
- {
- if (! XAllocColor (dsp, cmap, &color))
- break;
- pixels[npixels] = color.pixel;
- cycle_hue (&color, shift);
- }
- }
- timeout = get_integer_resource ("timeout", "Seconds");
- if (timeout <= 0) timeout = 30;
- delay = get_integer_resource ("delay", "Usecs");
-
- gcv.foreground = fg_pixel;
- gc = XCreateGC (dsp, win, GCForeground, &gcv);
- }
-
- XClearWindow (dsp, win);
-
- hp->centerx = xgwa.width / 2;
- hp->centery = xgwa.height / 2;
- range = sqrt((double) hp->centerx * hp->centerx +
- (double) hp->centery * hp->centery) /
- (10.0 + random() % 10);
-
- hp->pix = 0;
-#define frand0() (((double) random()) / ((unsigned int) (~0)))
- hp->inc = (int) (frand0() * 200) - 100;
- hp->a = frand0() * range - range / 2.0;
- hp->b = frand0() * range - range / 2.0;
- hp->c = frand0() * range - range / 2.0;
- if (!(random() % 2))
- hp->c = 0.0;
-
- hp->i = hp->j = 0.0;
-
- if (!pointBuffer)
- pointBuffer = (XPoint *) malloc(batchcount * sizeof(XPoint));
-
- XSetForeground(dsp, gc, bg_pixel);
- XFillRectangle(dsp, win, gc, 0, 0,
- hp->centerx * 2, hp->centery * 2);
- XSetForeground(dsp, gc, fg_pixel);
- hp->startTime = time ((time_t *) 0);
-}
-
-
-static void
-drawhop(dsp,win)
- Display *dsp;
- Window win;
-{
- double oldj;
- int k = batchcount;
- XPoint *xp = pointBuffer;
- hopstruct *hp = &hop;
-
- hp->inc++;
- if (! mono_p) {
- XSetForeground(dsp, gc, pixels[hp->pix]);
- if (++hp->pix >= npixels)
- hp->pix = 0;
- }
- while (k--) {
- oldj = hp->j;
- hp->j = hp->a - hp->i;
- hp->i = oldj + (hp->i < 0
- ? sqrt(fabs(hp->b * (hp->i + hp->inc) - hp->c))
- : -sqrt(fabs(hp->b * (hp->i + hp->inc) - hp->c)));
- xp->x = hp->centerx + (int) (hp->i + hp->j);
- xp->y = hp->centery - (int) (hp->i - hp->j);
- xp++;
- }
- XDrawPoints(dsp, win, gc,
- pointBuffer, batchcount, CoordModeOrigin);
- XSync (dsp, True);
- if ((time ((time_t *) 0) - hp->startTime) > timeout)
- {
- int i;
- XSetForeground(dsp, gc, bg_pixel);
- for (i = 0; i < hp->centery; i++)
- {
- int y = (random () % (hp->centery << 1));
- XDrawLine (dsp, win, gc, 0, y, hp->centerx << 1, y);
- XFlush (dsp);
- if ((i % 50) == 0)
- usleep (10000);
- }
- XClearWindow (dsp, win);
- XFlush (dsp);
- sleep (1);
- inithop(dsp,win);
- }
-}
-
-\f
-char *progclass = "Hopalong";
-
-char *defaults [] = {
- "Hopalong.background: black", /* to placate SGI */
- "Hopalong.foreground: white",
- "*count: 1000",
- "*ncolors: 100",
- "*timeout: 20",
- "*delay: 0",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-count", ".count", XrmoptionSepArg, 0 },
- { "-ncolors", ".ncolors", XrmoptionSepArg, 0 },
- { "-timeout", ".timeout", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- inithop (dpy, window);
- while (1)
- {
- drawhop (dpy, window);
- XSync (dpy, True);
- if (delay) usleep (delay);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-hopalong - draw real plane fractals
-.SH SYNOPSIS
-.B hopalong
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-count \fIinteger\fP] [\-ncolors \fIinteger\fP] [\-timeout \fIseconds\fP] [\-delay \fImicroseconds\fP]
-.SH DESCRIPTION
-The \fIhopalong\fP program generates real plane fractals as described in
-the September 1986 issue of Scientific American.
-.SH OPTIONS
-.I hopalong
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-count \fIinteger\fP
-How many pixels should be drawn before a color change. Default 1000.
-.TP 8
-.B \-ncolors \fIinteger\fP
-How many colors should be used (if possible). Default 100.
-The colors used cycle through the hue, making N stops around
-the color wheel.
-.TP 8
-.B \-timeout \fIseconds\fP
-How many seconds we should generate for before clearing the screen
-and starting over. Default 20.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How long we should wait between drawing each pixel. Default 0.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1),
-.BR xlock (1)
-.SH COPYRIGHT
-Copyright \(co 1988-91 by Patrick J. Naughton
-
-Permission to use, copy, modify, and distribute this software and its
-documentation for any purpose and without fee is hereby granted,
-provided that the above copyright notice appear in all copies and that
-both that copyright notice and this permission notice appear in
-supporting documentation.
-.SH AUTHOR
-Patrick J. Naughton <naughton@eng.sun.com>, 23-mar-88.
-
-Ability to run standalone or with \fIxscreensaver\fP added by
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- *
- * This code derived from TI Explorer Lisp code by Joe Keane, Fritz Mueller,
- * and Jamie Zawinski.
- */
-
-#include <math.h>
-#include "screenhack.h"
-
-static Display *dpy;
-static Window window;
-static GC color0, color1, color2, color3, color4, color5, color6, color7;
-static GC black;
-
-static int delay;
-
-static int observer_z;
-static int x_offset, y_offset;
-static int unit_pixels;
-
-struct point_state {
- int old_x, old_y;
- int new_x, new_y;
- Bool same_p;
-};
-
-static void
-move_line (state0, state1, gc)
- struct point_state *state0, *state1;
- GC gc;
-{
- if (state0->same_p && state1->same_p)
- return;
- if (mono_p)
- {
- XDrawLine (dpy, window, black,
- state0->old_x, state0->old_y, state1->old_x, state1->old_y);
- XDrawLine (dpy, window, gc,
- state0->new_x, state0->new_y, state1->new_x, state1->new_y);
- }
- else
- {
- XSegment segments [2];
- segments [0].x1 = state0->old_x; segments [0].y1 = state0->old_y;
- segments [0].x2 = state1->old_x; segments [0].y2 = state1->old_y;
- segments [1].x1 = state0->new_x; segments [1].y1 = state0->new_y;
- segments [1].x2 = state1->new_x; segments [1].y2 = state1->new_y;
- XDrawSegments (dpy, window, gc, segments, 2);
- }
-}
-
-static void
-hyper (xy, xz, yz, xw, yw, zw)
- double xy, xz, yz, xw, yw, zw;
-{
- double cos_xy = cos (xy), sin_xy = sin (xy);
- double cos_xz = cos (xz), sin_xz = sin (xz);
- double cos_yz = cos (yz), sin_yz = sin (yz);
- double cos_xw = cos (xw), sin_xw = sin (xw);
- double cos_yw = cos (yw), sin_yw = sin (yw);
- double cos_zw = cos (zw), sin_zw = sin (zw);
-
- double ax = 1.0, ay = 0.0, az = 0.0, aw = 0.0;
- double bx = 0.0, by = 1.0, bz = 0.0, bw = 0.0;
- double cx = 0.0, cy = 0.0, cz = 1.0, cw = 0.0;
- double dx = 0.0, dy = 0.0, dz = 0.0, dw = 1.0;
-
- double _tmp0_, _tmp1_;
-
- struct point_state points [16];
- memset (points, 0, sizeof (points));
-
-#define mmmm (&points[0])
-#define mmmp (&points[1])
-#define mmpm (&points[2])
-#define mmpp (&points[3])
-#define mpmm (&points[4])
-#define mpmp (&points[5])
-#define mppm (&points[6])
-#define mppp (&points[7])
-#define pmmm (&points[8])
-#define pmmp (&points[9])
-#define pmpm (&points[10])
-#define pmpp (&points[11])
-#define ppmm (&points[12])
-#define ppmp (&points[13])
-#define pppm (&points[14])
-#define pppp (&points[15])
-
- while (1)
- {
- double temp_mult;
-
-#define compute(a,b,c,d,point_state) \
- temp_mult = (unit_pixels / (((a*az) + (b*bz) + (c*cz) + (d*dz) + \
- (a*aw) + (b*bw) + (c*cw) + (d*dw)) \
- - observer_z)); \
- point_state->old_x = point_state->new_x; \
- point_state->old_y = point_state->new_y; \
- point_state->new_x = ((((a*ax) + (b*bx) + (c*cx) + (d*dx)) * temp_mult) \
- + x_offset); \
- point_state->new_y = ((((a*ay) + (b*by) + (c*cy) + (d*dy)) * temp_mult) \
- + y_offset); \
- point_state->same_p = (point_state->old_x == point_state->new_x && \
- point_state->old_y == point_state->new_y);
-
- compute (-1, -1, -1, -1, mmmm);
- compute (-1, -1, -1, 1, mmmp);
- compute (-1, -1, 1, -1, mmpm);
- compute (-1, -1, 1, 1, mmpp);
- compute (-1, 1, -1, -1, mpmm);
- compute (-1, 1, -1, 1, mpmp);
- compute (-1, 1, 1, -1, mppm);
- compute (-1, 1, 1, 1, mppp);
- compute ( 1, -1, -1, -1, pmmm);
- compute ( 1, -1, -1, 1, pmmp);
- compute ( 1, -1, 1, -1, pmpm);
- compute ( 1, -1, 1, 1, pmpp);
- compute ( 1, 1, -1, -1, ppmm);
- compute ( 1, 1, -1, 1, ppmp);
- compute ( 1, 1, 1, -1, pppm);
- compute ( 1, 1, 1, 1, pppp);
-
- move_line (mmmm, mmmp, color0);
- move_line (mmmm, mmpm, color0);
- move_line (mmpm, mmpp, color0);
- move_line (mmmp, mmpp, color0);
-
- move_line (pmmm, pmmp, color1);
- move_line (pmmm, pmpm, color1);
- move_line (pmpm, pmpp, color1);
- move_line (pmmp, pmpp, color1);
-
- move_line (mpmm, mpmp, color2);
- move_line (mpmm, mppm, color2);
- move_line (mppm, mppp, color2);
- move_line (mpmp, mppp, color2);
-
- move_line (mmpp, mppp, color3);
- move_line (mmpp, pmpp, color3);
- move_line (pmpp, pppp, color3);
- move_line (mppp, pppp, color3);
-
- move_line (mmmm, mpmm, color4);
- move_line (mmmm, pmmm, color4);
- move_line (mpmm, ppmm, color4);
- move_line (pmmm, ppmm, color4);
-
- move_line (mmmp, mpmp, color5);
- move_line (mmmp, pmmp, color5);
- move_line (pmmp, ppmp, color5);
- move_line (mpmp, ppmp, color5);
-
- move_line (mmpm, mppm, color6);
- move_line (mmpm, pmpm, color6);
- move_line (pmpm, pppm, color6);
- move_line (mppm, pppm, color6);
-
- move_line (ppmm, ppmp, color7);
- move_line (ppmm, pppm, color7);
- move_line (pppm, pppp, color7);
- move_line (ppmp, pppp, color7);
-
- /* If you get error messages about the following forms, and you think you're
- using an ANSI C conforming compiler, then you're mistaken. Possibly you're
- mixing an ANSI compiler with a non-ANSI preprocessor, or vice versa.
- Regardless, your system is broken; it's not a bug in this program.
- */
-#if __STDC__
-# define rotate(name,dim0,dim1,cos,sin) \
- _tmp0_ = ((name##dim0 * cos) + (name##dim1 * sin)); \
- _tmp1_ = ((name##dim1 * cos) - (name##dim0 * sin)); \
- name##dim0 = _tmp0_; \
- name##dim1 = _tmp1_;
-
-# define rotates(dim0,dim1) \
- if (sin_##dim0##dim1 != 0) { \
- rotate(a, dim0, dim1, cos_##dim0##dim1, sin_##dim0##dim1); \
- rotate(b, dim0, dim1, cos_##dim0##dim1, sin_##dim0##dim1); \
- rotate(c, dim0, dim1, cos_##dim0##dim1, sin_##dim0##dim1); \
- rotate(d, dim0, dim1, cos_##dim0##dim1, sin_##dim0##dim1); \
- }
-
-#else /* !__STDC__, courtesy of Andreas Luik <luik@isa.de> */
-# define rotate(name,dim0,dim1,cos,sin) \
- _tmp0_ = ((name/**/dim0 * cos) + (name/**/dim1 * sin)); \
- _tmp1_ = ((name/**/dim1 * cos) - (name/**/dim0 * sin)); \
- name/**/dim0 = _tmp0_; \
- name/**/dim1 = _tmp1_;
-
-# define rotates(dim0,dim1) \
- if (sin_/**/dim0/**/dim1 != 0) { \
- rotate(a,dim0,dim1,cos_/**/dim0/**/dim1,sin_/**/dim0/**/dim1); \
- rotate(b,dim0,dim1,cos_/**/dim0/**/dim1,sin_/**/dim0/**/dim1); \
- rotate(c,dim0,dim1,cos_/**/dim0/**/dim1,sin_/**/dim0/**/dim1); \
- rotate(d,dim0,dim1,cos_/**/dim0/**/dim1,sin_/**/dim0/**/dim1); \
- }
-#endif /* !__STDC__ */
-
- rotates (x,y);
- rotates (x,z);
- rotates (y,z);
- rotates (x,w);
- rotates (y,w);
- rotates (z,w);
-
- XSync (dpy, True);
- if (delay) usleep (delay);
- }
-}
-
-\f
-char *progclass = "Hypercube";
-
-char *defaults [] = {
- "Hypercube.background: black", /* to placate SGI */
- "Hypercube.foreground: white",
- "*color0: red",
- "*color1: orange",
- "*color2: yellow",
- "*color3: white",
- "*color4: green",
- "*color5: cyan",
- "*color6: dodgerblue",
- "*color7: magenta",
-
- "*xw: 0.000",
- "*xy: 0.010",
- "*xz: 0.005",
- "*yw: 0.010",
- "*yz: 0.000",
- "*zw: 0.000",
-
- "*observer-z: 5",
- "*delay: 100000",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-color0", ".color0", XrmoptionSepArg, 0 },
- { "-color1", ".color1", XrmoptionSepArg, 0 },
- { "-color2", ".color2", XrmoptionSepArg, 0 },
- { "-color3", ".color3", XrmoptionSepArg, 0 },
- { "-color4", ".color4", XrmoptionSepArg, 0 },
- { "-color5", ".color5", XrmoptionSepArg, 0 },
- { "-color6", ".color6", XrmoptionSepArg, 0 },
- { "-color7", ".color7", XrmoptionSepArg, 0 },
-
- { "-xw", ".xw", XrmoptionSepArg, 0 },
- { "-xy", ".xy", XrmoptionSepArg, 0 },
- { "-xz", ".xz", XrmoptionSepArg, 0 },
- { "-yw", ".yw", XrmoptionSepArg, 0 },
- { "-yz", ".yz", XrmoptionSepArg, 0 },
- { "-zw", ".zw", XrmoptionSepArg, 0 },
-
- { "-observer-z", ".observer-z", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 }
-};
-
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-
-void
-screenhack (d, w)
- Display *d;
- Window w;
-{
- XGCValues gcv;
- XWindowAttributes xgwa;
- Colormap cmap;
- double xy, xz, yz, xw, yw, zw;
- unsigned long bg;
-
- dpy = d;
- window = w;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
-
- x_offset = xgwa.width / 2;
- y_offset = xgwa.height / 2;
- unit_pixels = xgwa.width < xgwa.height ? xgwa.width : xgwa.height;
-
- xy = get_float_resource ("xy", "Float");
- xz = get_float_resource ("xz", "Float");
- yz = get_float_resource ("yz", "Float");
- xw = get_float_resource ("xw", "Float");
- yw = get_float_resource ("yw", "Float");
- zw = get_float_resource ("zw", "Float");
-
- observer_z = get_integer_resource ("observer-z", "Integer");
-
- delay = get_integer_resource ("delay", "Integer");
-
- bg = get_pixel_resource ("background", "Background", dpy, cmap);
-
- if (mono_p)
- {
- gcv.function = GXcopy;
- gcv.foreground = bg;
- black = XCreateGC (dpy, window, GCForeground|GCFunction, &gcv);
- gcv.foreground = get_pixel_resource ("foreground", "Foreground",
- dpy, cmap);
- color0 = color1 = color2 = color3 = color4 = color5 = color6 = color7 =
- XCreateGC (dpy, window, GCForeground|GCFunction, &gcv);
- }
- else
- {
- black = 0;
- gcv.function = GXxor;
-#define make_gc(color,name) \
- gcv.foreground = bg ^ get_pixel_resource ((name), "Foreground", \
- dpy, cmap); \
- color = XCreateGC (dpy, window, GCForeground|GCFunction, &gcv)
-
- make_gc (color0,"color0");
- make_gc (color1,"color1");
- make_gc (color2,"color2");
- make_gc (color3,"color3");
- make_gc (color4,"color4");
- make_gc (color5,"color5");
- make_gc (color6,"color6");
- make_gc (color7,"color7");
- }
-
- hyper (xy, xz, yz, xw, yw, zw);
-}
+++ /dev/null
-.TH XScreenSaver 1 "6-dec-92" "X Version 11"
-.SH NAME
-hypercube - 2d projection of a 4d object
-.SH SYNOPSIS
-.B hypercube
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-color[0-7] \fIcolor\fP] [\-xy \fIfloat\fP] [\-xz \fIfloat\fP] [\-yz \fIfloat\fP] [\-xw \fIfloat\fP] [\-yw \fIfloat\fP] [\-zw \fIfloat\fP] [\-observer-z \fIint\fP] [\-delay \fIusecs\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP]
-.SH DESCRIPTION
-The \fIhypercube\fP program displays a wireframe projection of a hypercube
-which is rotating at user-specified rates around any or all of its four axes.
-.SH OPTIONS
-.I hypercube
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How much of a delay should be introduced between steps of the animation.
-Default 100000, or about 1/10th second.
-.TP 8
-.B \-observer-z \fIint\fP
-How far away the observer is from the center of the cube (the cube is one
-unit per side.) Default 5.
-.TP 8
-.B \-color0 \fIcolor\fP
-.TP 8
-.B \-color1 \fIcolor\fP
-.TP 8
-.B \-color2 \fIcolor\fP
-.TP 8
-.B \-color3 \fIcolor\fP
-.TP 8
-.B \-color4 \fIcolor\fP
-.TP 8
-.B \-color5 \fIcolor\fP
-.TP 8
-.B \-color6 \fIcolor\fP
-.TP 8
-.B \-color7 \fIcolor\fP
-The colors used to draw the line segments bordering the eight faces of
-the cube. Some of the faces have only two of their border-lines drawn in
-the specified color, and some have all four.
-.TP 8
-.B \-xw \fIfloat\fP
-.TP 8
-.B \-xy \fIfloat\fP
-.TP 8
-.B \-xz \fIfloat\fP
-.TP 8
-.B \-yw \fIfloat\fP
-.TP 8
-.B \-yz \fIfloat\fP
-.TP 8
-.B \-zw \fIfloat\fP
-The amount that the cube should be rotated around the specified axis at
-each frame of the animation, expressed in radians. These should be small
-floating-point values (less than 0.05 works best.) Default: xy=0.01,
-xz=0.005, yw=0.01.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 6-dec-92.
+++ /dev/null
-/* imsmap, Copyright (c) 1992 Juergen Nickelsen <nickel@cs.tu-berlin.de>
- * Derived from code by Markus Schirmer, TU Berlin.
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "screenhack.h"
-#include <stdio.h>
-#include <X11/Xutil.h>
-
-#define NSTEPS 7
-#define COUNT (1 << NSTEPS)
-#define CELL(c, r) cell[((unsigned int)(c)) + ((unsigned int) (r)) * xmax]
-
-static enum mode_t { MODE_H, MODE_S, MODE_V, MODE_RANDOM } mode;
-
-static GC gc, gc2;
-static Display *disp;
-static Window wind;
-static XWindowAttributes wattrs;
-
-#if defined(sun) && !__STDC__ /* sun cc doesn't know "signed char" */
-#define signed /**/
-#endif
-
-static unsigned long *pixels = 0, fg_pixel, bg_pixel;
-static int npixels = 0;
-static Colormap cmap;
-static int timeout, cycle_delay;
-static int cycle_p;
-static signed char *cell = NULL;
-static int xmax, ymax;
-static int iterations;
-
-static void
-initwin (dsp, win)
- Display *dsp;
- Window win;
-{
- int fg_h, bg_h;
- double fg_s, fg_v, bg_s, bg_v;
-
- enum mode_t this_mode;
- static Bool rv_p;
- static int ncolors = 0;
- int shift = 0;
- double dshift = 0;
-
- XGCValues gcv;
-
- XGetWindowAttributes (dsp, win, &wattrs);
- cmap = wattrs.colormap;
-
- if (!ncolors)
- {
- char *mode_str = get_string_resource ("mode", "Mode");
- rv_p = get_boolean_resource ("reverseVideo", "ReverseVideo");
- cycle_p = get_boolean_resource ("cycle", "Cycle");
- ncolors = get_integer_resource ("ncolors", "Integer");
- timeout = get_integer_resource ("timeout", "Integer");
- cycle_delay = get_integer_resource ("cycleDelay", "Integer");
- iterations = get_integer_resource ("iterations", "Integer");
- if (iterations < 0) iterations = 0;
- else if (iterations > 7) iterations = 7;
- pixels = (unsigned long *) calloc (ncolors, sizeof (unsigned int));
- fg_pixel = get_pixel_resource ("background", "Background", dsp, cmap);
- bg_pixel = get_pixel_resource ("foreground", "Foreground", dsp, cmap);
-
- if (mono_p && fg_pixel == bg_pixel)
- bg_pixel = !bg_pixel;
-
- if (mono_p) cycle_p = False;
-
- gcv.foreground = fg_pixel;
- gcv.background = bg_pixel;
- gc = XCreateGC (dsp, win, GCForeground|GCBackground, &gcv);
- gcv.foreground = bg_pixel;
- gc2 = XCreateGC (dsp, win, GCForeground, &gcv);
-
- if (!mode_str || !strcmp (mode_str, "random"))
- mode = MODE_RANDOM;
- else if (!strcmp (mode_str, "h") || !strcmp (mode_str, "hue"))
- mode = MODE_H;
- else if (!strcmp (mode_str, "s") || !strcmp (mode_str, "saturation"))
- mode = MODE_S;
- else if (!strcmp (mode_str, "v") || !strcmp (mode_str, "value"))
- mode = MODE_V;
- else
- {
- fprintf (stderr,
- "%s: mode must be hue, saturation, value, or random, not \"%s\"\n",
- progname, mode_str);
- mode = MODE_RANDOM;
- }
- }
- else if (! mono_p)
- XFreeColors (dsp, cmap, pixels, npixels, 0);
-
- this_mode = mode;
- if (!mono_p && mode == MODE_RANDOM)
- switch (random () % 3) {
- case 0: this_mode = MODE_H; break;
- case 1: this_mode = MODE_S; break;
- case 2: this_mode = MODE_V; break;
- }
-
- if (mono_p)
- {
- npixels = ncolors;
- pixels [0] = fg_pixel;
- pixels [1] = bg_pixel;
- }
- else
- {
- XColor fg_color, bg_color;
-
- if (fg_pixel == bg_pixel)
- {
- HSV_AGAIN:
- fg_h = random () % 360;
- bg_h = random () % 360;
- fg_s = frand (1.0);
- bg_s = frand (1.0);
- V_AGAIN:
- fg_v = frand (1.0);
- bg_v = frand (1.0);
- if ((fg_v - bg_v) > -0.4 && (fg_v - bg_v) < 0.4)
- goto V_AGAIN;
- hsv_to_rgb (fg_h, fg_s, fg_v,
- &fg_color.red, &fg_color.green, &fg_color.blue);
- hsv_to_rgb (bg_h, bg_s, bg_v,
- &bg_color.red, &bg_color.green, &bg_color.blue);
- }
- else
- {
- XQueryColor (dsp, cmap, &fg_color);
- XQueryColor (dsp, cmap, &bg_color);
- fg_color.pixel = fg_pixel;
- bg_color.pixel = bg_pixel;
- }
- fg_color.flags = DoRed|DoGreen|DoBlue;
- bg_color.flags = DoRed|DoGreen|DoBlue;
-
- rgb_to_hsv (fg_color.red, fg_color.green, fg_color.blue,
- &fg_h, &fg_s, &fg_v);
- rgb_to_hsv (bg_color.red, bg_color.green, bg_color.blue,
- &bg_h, &bg_s, &bg_v);
-
- if (/*mode == MODE_RANDOM &&*/
- ((this_mode == MODE_S && (fg_s-bg_s) > -0.3 && (fg_s-bg_s) < 0.3) ||
- (this_mode == MODE_V && (fg_v-bg_v) > -0.3 && (fg_v-bg_v) < 0.3) ||
- (this_mode == MODE_H && (fg_h-bg_h) > -30 && (fg_h-bg_h) < 30)))
- goto HSV_AGAIN;
-
- switch (this_mode) {
- case MODE_H: shift = (bg_h - fg_h) / ncolors; break;
- case MODE_S: dshift = (bg_s - fg_s) / ncolors; break;
- case MODE_V: dshift = (bg_v - fg_v) / ncolors; break;
- default: abort ();
- }
-
- if (mode == MODE_RANDOM &&
- ((this_mode == MODE_H)
- ? ((shift > -2 && shift < 2) || fg_s < 0.3 || fg_v < 0.3)
- : (dshift > -0.005 && dshift < 0.005)))
- goto HSV_AGAIN;
-
- if (mode == MODE_RANDOM && this_mode == MODE_S && fg_v < 0.5)
- goto V_AGAIN;
-
- for (npixels = 0; npixels < ncolors; npixels++)
- {
- if (cycle_p)
- {
- unsigned long plane_masks;
- /* allocate the writable color cells, one at a time. */
- if (! XAllocColorCells (dsp, cmap, False, &plane_masks, 0,
- &fg_color.pixel, 1))
- {
- fprintf (stderr,
- "%s: couldn't allocate %s writable color cells. Turning off -cycle.\n",
- progname, (npixels ? "enough" : "any"));
- cycle_p = 0;
- goto NON_CYCLE;
- }
- XStoreColor (dsp, cmap, &fg_color);
- }
- else
- {
- NON_CYCLE:
- if (!XAllocColor (dsp, cmap, &fg_color))
- break;
- }
- pixels[npixels] = fg_color.pixel;
-
- switch (this_mode)
- {
- case MODE_H: fg_h = (fg_h + shift) % 360; break;
- case MODE_S: fg_s += dshift; break;
- case MODE_V: fg_v += dshift; break;
- default: abort ();
- }
- hsv_to_rgb (fg_h, fg_s, fg_v,
- &fg_color.red, &fg_color.green, &fg_color.blue);
- }
- }
- XSetForeground (dsp, gc, pixels [0]);
- XFillRectangle (dsp, win, gc, 0, 0, wattrs.width, wattrs.height);
-}
-
-
-#define HEIGHT_TO_PIXEL(height) \
- (((int) (height)) < 0 ? 0 : \
- ((int) (height)) >= npixels ? npixels - 3 : ((int) (height)))
-
-static unsigned int
-set (l, c, size, height)
- unsigned int l, c, size;
- int height;
-{
- int rang = 1 << (NSTEPS - size);
- height = height + (random () % rang) - rang / 2;
- CELL (l, c) = height;
-
- return pixels [HEIGHT_TO_PIXEL (height)];
-}
-
-static void
-floyd_steinberg ()
-{
- int x, y, err;
-
- /* Instead of repeatedly calling XPutPixel(), we make an Image and then
- send its bits over all at once. This consumes much less network
- bandwidth. The image we create is Wx1 intead of WxH, so that we
- don't use enormous amounts of memory.
- */
- XImage *image =
- XCreateImage (disp, DefaultVisual(disp,DefaultScreen(disp)),
- 1, XYBitmap, 0, /* depth, format, offset */
- (char *) calloc ((xmax + 1) / 8, 1), /* data */
- xmax, 1, 8, 0); /* w, h, pad, bpl */
-
- for (y = 0; y < ymax - 1; y++)
- {
- for (x = 0; x < xmax - 1; x++)
- {
- if (CELL(x, y) < 0)
- {
- err = CELL (x, y);
- XPutPixel (image, x, 0, 1);
- }
- else
- {
- err = CELL (x, y) - 1;
- XPutPixel (image, x, 0, 0);
- }
- /* distribute error */
- CELL (x, y+1) += (int) (((float) err) * 3.0/8.0);
- CELL (x+1, y) += (int) (((float) err) * 3.0/8.0);
- CELL (x+1, y+1) += (int) (((float) err) * 1.0/4.0);
- }
- XPutImage (disp, wind, gc, image, 0, 0, 0, y, xmax, 1);
- }
- XDestroyImage (image);
-}
-
-static void
-draw (x, y, pixel, grid_size) /* not called in mono mode */
- int x, y, grid_size;
- unsigned long pixel;
-{
- static unsigned int last_pixel, last_valid = 0;
- if (! (last_valid && pixel == last_pixel))
- XSetForeground (disp, gc, pixel);
- last_valid = 1, last_pixel = pixel;
- if (grid_size == 1)
- XDrawPoint (disp, wind, gc, x, y);
- else
- XFillRectangle (disp, wind, gc, x, y, grid_size, grid_size);
-}
-
-
-static void
-drawmap ()
-{
- unsigned int x, y, i, step, nextStep, x1, x2, y1, y2;
- unsigned int pixel, qpixels [4];
-
- xmax = wattrs.width;
- ymax = wattrs.height;
-
- cell = (signed char *) calloc (xmax * ymax, 1);
- if (cell == NULL)
- exit (1);
-
- CELL (0, 0) = 0;
- step = COUNT;
- for (i = 0; i < iterations; i++)
- {
- nextStep = step / 2;
- for (x = 0; x < xmax; x += step)
- {
- x1 = x + nextStep;
- if (x1 >= xmax)
- x1 = 0;
- x2 = x + step;
- if (x2 >= xmax)
- x2 = 0;
- for (y = 0; y < ymax; y += step)
- {
- y1 = y + nextStep;
- if (y1 >= ymax)
- y1 = 0;
- y2 = y + step;
- if (y2 >= ymax)
- y2 = 0;
-
- qpixels [0] = pixels [HEIGHT_TO_PIXEL (CELL (x, y))];
- qpixels [1] = pixels [HEIGHT_TO_PIXEL (CELL (x, y2))];
- qpixels [2] = pixels [HEIGHT_TO_PIXEL (CELL (x2, y))];
- qpixels [3] = pixels [HEIGHT_TO_PIXEL (CELL (x2, y2))];
-
- pixel = set (x, y1, i,
- ((int) CELL (x, y) + (int) CELL (x, y2) + 1) / 2);
- if (! mono_p &&
- (pixel != qpixels[0] || pixel != qpixels[1] ||
- pixel != qpixels[2] || pixel != qpixels[3]))
- draw (x, y1, pixel, nextStep);
-
- pixel = set (x1, y, i,
- ((int) CELL (x, y) + (int) CELL (x2, y) + 1) / 2);
- if (! mono_p &&
- (pixel != qpixels[0] || pixel != qpixels[1] ||
- pixel != qpixels[2] || pixel != qpixels[3]))
- draw (x1, y, pixel, nextStep);
-
- pixel = set (x1, y1, i,
- ((int) CELL (x, y) + (int) CELL (x, y2) +
- (int) CELL (x2, y) + (int) CELL (x2, y2) + 2)
- / 4);
- if (! mono_p &&
- (pixel != qpixels[0] || pixel != qpixels[1] ||
- pixel != qpixels[2] || pixel != qpixels[3]))
- draw (x1, y1, pixel, nextStep);
- }
- }
- step = nextStep;
- if (!mono_p)
- XSync (disp, True);
- }
- if (mono_p)
- /* in mono-mode, we do all the drawing at the end */
- floyd_steinberg ();
-
- free (cell);
- XSync (disp, True);
-}
-
-static void
-cycle (dpy)
- Display *dpy;
-{
- XColor *colors = (XColor *) malloc (npixels * sizeof (XColor));
- time_t stop;
- int i;
- for (i = 0; i < npixels; i++)
- colors [i].pixel = pixels [i];
- XQueryColors (dpy, cmap, colors, npixels);
- stop = (time_t) ((time ((time_t) 0)) + timeout);
- while (stop >= (time_t) time ((time_t) 0))
- {
- unsigned long scratch = colors [npixels-1].pixel;
- for (i = npixels-1; i > 0; i--)
- colors [i].pixel = colors [i-1].pixel;
- colors [0].pixel = scratch;
- XStoreColors (dpy, cmap, colors, npixels);
- XSync (dpy, True);
- if (cycle_delay) usleep (cycle_delay);
- }
- XSync (dpy, True);
- free (colors);
-}
-
-
-char *progclass = "Imsmap";
-
-char *defaults [] = {
- "Imsmap.background: black", /* to placate SGI */
- "Imsmap.foreground: black",
- "*mode: random",
- "*ncolors: 50",
- "*iterations: 7",
- "*timeout: 10",
- "*cycleDelay: 100000",
- "*cycle: true",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-ncolors", ".ncolors", XrmoptionSepArg, 0 },
- { "-timeout", ".timeout", XrmoptionSepArg, 0 },
- { "-cycle-delay", ".cycleDelay", XrmoptionSepArg, 0 },
- { "-mode", ".mode", XrmoptionSepArg, 0 },
- { "-iterations", ".iterations", XrmoptionSepArg, 0 },
- { "-cycle", ".cycle", XrmoptionNoArg, "True" },
- { "-no-cycle", ".cycle", XrmoptionNoArg, "False" }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- disp = dpy;
- wind = window;
- while (1)
- {
- initwin (dpy, window);
- drawmap ();
- if (timeout)
- {
- if (cycle_p)
- cycle (dpy);
- else
- sleep (timeout);
- }
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "26-apr-93" "X Version 11"
-.SH NAME
-imsmap - generate fractal maps
-.SH SYNOPSIS
-.B imsmap
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIint\fP] [\-timeout \fIseconds\fP] [\-iterations \fIint\fP] [\-mode h|s|v|random] [\-cycle] [\-no\-cycle]
-.SH DESCRIPTION
-The \fIimsmap\fP program generates map or cloud-like patterns. It looks
-quite different in monochrome and color.
-.SH OPTIONS
-.I imsmap
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-ncolors \fIinteger\fP
-How many colors to use. Default 50.
-.TP 8
-.B \-timeout \fIinteger\fP
-How long to delay between images. Default 10 seconds.
-.TP 8
-.B \-iterations \fIinteger\fP
-A measure of the resolution of the resultant image, from 0 to 7. Default 7.
-.TP 8
-.B \-mode [ hue | saturation | value | random ]
-The axis upon which colors should be interpolated between the foreground
-and background color. Default random.
-.TP 8
-.B \-cycle
-Whether to do colormap cycling. This is the default.
-.TP 8
-.B \-no\-cycle
-Turns \fI\-cycle\fP off.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH AUTHOR
-Juergen Nickelsen <nickel@cs.tu-berlin.de>, 23-aug-92.
-
-Hacked on by Jamie Zawinski <jwz@netscape.com>, 24-aug-92.
+++ /dev/null
-
-/**************************************************************************
- *
- * FILE lmorph.c
- * MODULE OF xscreensaver
- *
- * DESCRIPTION Bilinear interpolation for morphing line shapes.
- *
- * WRITTEN BY Sverre H. Huseby Glenn T. Lines
- * Maridalsvn. 122, leil 101 Frysjavn. 3, 5. etg.
- * N-0461 Oslo N-0883 Oslo
- * Norway Norway
- *
- * Phone: +47 22 71 99 08 Phone: +47 22 23 71 99
- * E-mail: sverrehu@ifi.uio.no E-mail: gtl@si.sintef.no
- *
- * The original idea, and the bilinear interpolation
- * mathematics used, emerged in the head of the wise
- * Glenn Terje Lines.
- *
- * MODIFICATIONS march 1995
- * * Converted from an MS-Windows program to X Window.
- *
- **************************************************************************/
-
-#include <stdio.h>
-#include <stdlib.h>
-#include <string.h>
-#include <math.h>
-#include "screenhack.h"
-
-/**************************************************************************
- * *
- * P R I V A T E D A T A *
- * *
- **************************************************************************/
-
-/* Define MARGINS to make some space around the figure */
-#define MARGINS /**/
-
-#define MAXFIGS 20
-#define TWO_PI (2.0 * M_PI)
-#define RND(x) (random() % (x))
-static int
- cFig = 0, /* Number of figure arrays. */
- cPoint, /* Number of points in each array. */
- nWork, /* Current work array number. */
- nFrom, /* Current from array number. */
- nTo; /* Current to array number. */
-static long
- delay; /* usecs to wait between updates. */
-static XPoint
- *aWork[2], /* Working arrays. */
- *a[MAXFIGS], /* The figure arrays. */
- *aTmp, /* Used as source when interrupting morph */
- *aPrev, /* Previous points displayed. */
- *aCurr, /* The current points displayed. */
- *aFrom, /* Figure converting from. */
- *aTo; /* Figure converting to. */
-static double
- gam,
- maxGamma = 1.0,
- delta_gam;
-static GC
- gcDraw, gcClear;
-static Display
- *dpy;
-static Window
- window;
-
-
-
-/**************************************************************************
- * *
- * P U B L I C D A T A *
- * *
- **************************************************************************/
-
-char *progclass = "LMorph";
-
-char *defaults [] = {
- "LMorph.background: black",
- "LMorph.foreground: green",
- "*points: 150",
- "*steps: 0",
- "*delay: 50000",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-points", ".points", XrmoptionSepArg, 0 },
- { "-steps", ".steps", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-
-
-/**************************************************************************
- * *
- * P R I V A T E F U N C T I O N S *
- * *
- **************************************************************************/
-
-static void *xmalloc(size)
- size_t size;
-{
- void *ret;
-
- if ((ret = malloc(size)) == NULL) {
- fprintf(stderr, "lmorph: out of memory\n");
- exit(1);
- }
- return ret;
-}
-
-
-
-static double frnd()
-{
- /*
- * Hm. for some reason the second line (using RAND_MAX) didn't
- * work on some machines, so I always use the first.
- */
-#undef RAND_MAX
-#ifndef RAND_MAX
- return (double) (random() & 0x7FFF) / 0x7FFF;
-#else
- return ((double) random()) / RAND_MAX;
-#endif
-}
-
-
-
-static void initPointArrays()
-{
- XWindowAttributes wa;
- int q, w,
- mx, my, /* Max screen coordinates. */
- mp, /* Max point number. */
- s, rx, ry,
- marginx, marginy;
- double scalex, scaley;
-
- XGetWindowAttributes(dpy, window, &wa);
- mx = wa.width - 1;
- my = wa.height - 1;
- mp = cPoint - 1;
-
- aWork[0] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- aWork[1] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- aTmp = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
-
-
- /*
- * Figure 0
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- s = cPoint / 4;
- for (q = 0; q < s; q++) {
- a[cFig][q].x = ((double) q / s) * mx;
- a[cFig][q].y = 0;
- a[cFig][s + q].x = mx;
- a[cFig][s + q].y = ((double) q / s) * my;
- a[cFig][2 * s + q].x = mx - ((double) q / s) * mx;
- a[cFig][2 * s + q].y = my;
- a[cFig][3 * s + q].x = 0;
- a[cFig][3 * s + q].y = my - ((double) q / s) * my;
- }
- for (q = 4 * s; q < cPoint; q++)
- a[cFig][q].x = a[cFig][q].y = 0;
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 1
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = ((double) q / cPoint) * mx;
- a[cFig][q].y = (1.0 - sin(((double) q / mp) * TWO_PI)) * my / 2.0;
- }
- ++cFig;
-
- /*
- * Figure 2
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + rx * sin(1 * TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * cos(3 * TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 3
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + ry * sin(3 * TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * cos(1 * TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 4
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + ry * (1 - 0.1 * frnd())
- * sin(TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * (1 - 0.1 * frnd())
- * cos(TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 5
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + ry * (0.8 - 0.2 * sin(30 * TWO_PI * q / mp))
- * sin(TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * (0.8 - 0.2 * sin(30 * TWO_PI * q / mp))
- * cos(TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 6
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + ry * sin(TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * cos(TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 7
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + rx * cos(TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * sin(TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 8
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = ((double) q / mp) * mx;
- a[cFig][q].y = (1.0 - cos(((double) q / mp) * 3 * TWO_PI)) * my / 2.0;
- }
- ++cFig;
-
- /*
- * Figure 9
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + rx * sin(2 * TWO_PI * (double) q / mp);
- a[cFig][q].y = my / 2 + ry * cos(3 * TWO_PI * (double) q / mp);
- }
- a[cFig][mp].x = a[cFig][0].x;
- a[cFig][mp].y = a[cFig][0].y;
- ++cFig;
-
- /*
- * Figure 10
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + ry * sin(5 * TWO_PI * (double) q / mp)
- * ((double) q / mp);
- a[cFig][q].y = my / 2 + ry * cos(5 * TWO_PI * (double) q / mp)
- * ((double) q / mp);
- }
- ++cFig;
-
- /*
- * Figure 11
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- rx = mx / 2;
- ry = my / 2;
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = mx / 2 + ry * sin(6 * TWO_PI * (double) q / mp)
- * ((double) q / mp);
- a[cFig][q].y = my / 2 - ry * cos(6 * TWO_PI * (double) q / mp)
- * ((double) q / mp);
- }
- ++cFig;
-
- /*
- * Figure 12
- */
- a[cFig] = (XPoint *) xmalloc(cPoint * sizeof(XPoint));
- for (q = 0; q < cPoint; q++) {
- a[cFig][q].x = ((double) q / mp) * mx;
- a[cFig][q].y = (1.0 - sin(((double) q / mp) * 5 * TWO_PI)) * my / 2.0;
- }
- ++cFig;
-
-#ifdef MARGINS
- /*
- * Make some space around the figures.
- */
- marginx = (mx + 1) / 10;
- marginy = (my + 1) / 10;
- scalex = (double) ((mx + 1) - 2.0 * marginx) / (mx + 1.0);
- scaley = (double) ((my + 1) - 2.0 * marginy) / (my + 1.0);
- for (q = 0; q < cFig; q++)
- for (w = 0; w < cPoint; w++) {
- a[q][w].x = marginx + a[q][w].x * scalex;
- a[q][w].y = marginy + a[q][w].y * scaley;
- }
-#endif
-}
-
-
-
-static void createPoints()
-{
- int q;
- XPoint *pa = aCurr, *pa1 = aFrom, *pa2 = aTo;
- long lg, l1g;
-
-
- lg = 8192L * gam, l1g = 8192L * (1.0 - gam);
- for (q = 0; q < cPoint; q++) {
- pa->x = (short) ((l1g * pa1->x + lg * pa2->x) / 8192L);
- pa->y = (short) ((l1g * pa1->y + lg * pa2->y) / 8192L);
- ++pa;
- ++pa1;
- ++pa2;
- }
-}
-
-
-static void drawImage()
-{
- register int q;
- XPoint *old0, *old1, *new0, *new1;
-
- /*
- * Problem: update the window without too much flickering. I do
- * this by handling each linesegment separately. First remove a
- * line, then draw the new line. The problem is that this leaves
- * small black pixels on the figure. To fix this, I draw the
- * entire figure using XDrawLines() afterwards.
- */
- if (aPrev) {
- old0 = aPrev;
- old1 = aPrev + 1;
- new0 = aCurr;
- new1 = aCurr + 1;
- for (q = cPoint - 1; q; q--) {
- XDrawLine(dpy, window, gcClear,
- old0->x, old0->y, old1->x, old1->y);
- XDrawLine(dpy, window, gcDraw,
- new0->x, new0->y, new1->x, new1->y);
- ++old0;
- ++old1;
- ++new0;
- ++new1;
- }
- }
- XDrawLines(dpy, window, gcDraw, aCurr, cPoint, CoordModeOrigin);
- XFlush(dpy);
-}
-
-static void initLMorph()
-{
- int steps;
- XGCValues gcv;
- XWindowAttributes wa;
- Colormap cmap;
-
- cPoint = get_integer_resource("points", "Integer");
- steps = get_integer_resource("steps", "Integer");
- delay = get_integer_resource("delay", "Integer");
-
- if (steps <= 0)
- steps = (random() % 400) + 100;
-
- delta_gam = 1.0 / steps;
- XGetWindowAttributes(dpy, window, &wa);
- cmap = wa.colormap;
- gcv.foreground = get_pixel_resource("foreground", "Foreground", dpy, cmap);
- gcDraw = XCreateGC(dpy, window, GCForeground, &gcv);
- XSetForeground(dpy, gcDraw, gcv.foreground);
- gcv.foreground = get_pixel_resource("background", "Background", dpy, cmap);
- gcClear = XCreateGC(dpy, window, GCForeground, &gcv);
- XClearWindow(dpy, window);
-
- srandom(time(NULL));
- initPointArrays();
- aCurr = aWork[nWork = 0];
- aPrev = NULL;
- gam = 2.0;
- nTo = RND(cFig);
-}
-
-static void animateLMorph()
-{
- if (gam > maxGamma) {
- gam = 0.0;
- if (maxGamma == 1.0) {
- nFrom = nTo;
- aFrom = a[nFrom];
- } else {
- memcpy(aTmp, aCurr, cPoint * sizeof(XPoint));
- aFrom = aTmp;
- nFrom = -1;
- }
- do {
- nTo = RND(cFig);
- } while (nTo == nFrom);
- aTo = a[nTo];
- if (RND(2)) {
- /*
- * Reverse the array to get more variation.
- */
- int i1, i2;
- XPoint p;
-
- for (i1 = 0, i2 = cPoint - 1; i1 < cPoint / 2; i1++, i2--) {
- p = aTo[i1];
- aTo[i1] = aTo[i2];
- aTo[i2] = p;
- }
- }
- /*
- * It may be nice to interrupt the next run.
- */
- if (RND(3) > 0)
- maxGamma = 0.1 + 0.7 * (RND(1001) / 1000.0);
- else
- maxGamma = 1.0;
- }
-
- createPoints();
- drawImage();
- aPrev = aCurr;
- aCurr = aWork[nWork ^= 1];
-
- gam += delta_gam;
-}
-
-
-
-/**************************************************************************
- * *
- * P U B L I C F U N C T I O N S *
- * *
- **************************************************************************/
-
-void screenhack(disp, win)
- Display *disp;
- Window win;
-{
- dpy = disp;
- window = win;
- initLMorph();
- for (;;) {
- animateLMorph();
- screenhack_usleep(delay);
- }
-}
+++ /dev/null
-.TH LMORPH 1 "xscreensaver hack"
-.SH NAME
-lmorph \- morphing lines
-.SH SYNOPSIS
-.B lmorph
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-points \fIint\fP] [\-steps \fIint\fP] [\-delay \fIusecs\fP]
-.SH DESCRIPTION
-The \fIlmorph\fP program morphs between simple linedrawings using bilinear
-interpolation.
-.SH OPTIONS
-.I lmorph
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-points \fIinteger\fP
-Number of points in each line drawing. Default is 150 points.
-.TP 8
-.B \-steps \fIinteger\fP
-Interpolation steps from one drawing to the next. Default is 0, which
-means a random number between 100 and 500.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How much of a delay should be introduced between steps of the animation.
-Default 50000.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH AUTHOR
-Sverre H. Huseby <sverrehu@ifi.uio.no> and Glenn T. Lines <gtl@si.sintef.no>,
-built on top of the screen saver routines by Jamie Zawinski <jwz@netscape.com>.
+++ /dev/null
-/******************************************************************************
- * [ maze ] ...
- *
- * modified: [ 8-11-95 ] Ed James <james@mml.mmc.com>
- * added fill of dead-end box to solve_maze while loop.
- * modified: [ 3-7-93 ] Jamie Zawinski <jwz@netscape.com>
- * added the XRoger logo, cleaned up resources, made
- * grid size a parameter.
- * modified: [ 3-3-93 ] Jim Randell <jmr@mddjmr.fc.hp.com>
- * Added the colour stuff and integrated it with jwz's
- * screenhack stuff. There's still some work that could
- * be done on this, particularly allowing a resource to
- * specify how big the squares are.
- * modified: [ 10-4-88 ] Richard Hess ...!uunet!cimshop!rhess
- * [ Revised primary execution loop within main()...
- * [ Extended X event handler, check_events()...
- * modified: [ 1-29-88 ] Dave Lemke lemke@sun.com
- * [ Hacked for X11...
- * [ Note the word "hacked" -- this is extremely ugly, but at
- * [ least it does the job. NOT a good programming example
- * [ for X.
- * original: [ 6/21/85 ] Martin Weiss Sun Microsystems [ SunView ]
- *
- ******************************************************************************
- Copyright 1988 by Sun Microsystems, Inc. Mountain View, CA.
-
- All Rights Reserved
-
- Permission to use, copy, modify, and distribute this software and its
- documentation for any purpose and without fee is hereby granted,
- provided that the above copyright notice appear in all copies and that
- both that copyright notice and this permission notice appear in
- supporting documentation, and that the names of Sun or MIT not be
- used in advertising or publicity pertaining to distribution of the
- software without specific prior written permission. Sun and M.I.T.
- make no representations about the suitability of this software for
- any purpose. It is provided "as is" without any express or implied warranty.
-
- SUN DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE, INCLUDING
- ALL IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
- PURPOSE. IN NO EVENT SHALL SUN BE LIABLE FOR ANY SPECIAL, INDIRECT
- OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS
- OF USE, DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE
- OR OTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE
- OR PERFORMANCE OF THIS SOFTWARE.
- *****************************************************************************/
-
-#include "screenhack.h"
-
-#define XROGER
-
-static int solve_delay, pre_solve_delay, post_solve_delay;
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xutil.h>
-#include <X11/bitmaps/gray1>
-
-#define MAX_MAZE_SIZE_X 500
-#define MAX_MAZE_SIZE_Y 500
-
-#define MOVE_LIST_SIZE (MAX_MAZE_SIZE_X * MAX_MAZE_SIZE_Y)
-
-#define WALL_TOP 0x8000
-#define WALL_RIGHT 0x4000
-#define WALL_BOTTOM 0x2000
-#define WALL_LEFT 0x1000
-
-#define DOOR_IN_TOP 0x800
-#define DOOR_IN_RIGHT 0x400
-#define DOOR_IN_BOTTOM 0x200
-#define DOOR_IN_LEFT 0x100
-#define DOOR_IN_ANY 0xF00
-
-#define DOOR_OUT_TOP 0x80
-#define DOOR_OUT_RIGHT 0x40
-#define DOOR_OUT_BOTTOM 0x20
-#define DOOR_OUT_LEFT 0x10
-
-#define START_SQUARE 0x2
-#define END_SQUARE 0x1
-
-#define border_x (0)
-#define border_y (0)
-
-#define get_random(x) (random() % (x))
-
-static int logo_x, logo_y;
-
-#ifdef XROGER
-# define logo_width 128
-# define logo_height 128
-#else
-# include <X11/bitmaps/xlogo64>
-# define logo_width xlogo64_width
-# define logo_height xlogo64_height
-# define logo_bits xlogo64_bits
-#endif
-
-static unsigned short maze[MAX_MAZE_SIZE_X][MAX_MAZE_SIZE_Y];
-
-static struct {
- unsigned char x;
- unsigned char y;
- unsigned char dir;
-} move_list[MOVE_LIST_SIZE], save_path[MOVE_LIST_SIZE], path[MOVE_LIST_SIZE];
-
-static int maze_size_x, maze_size_y;
-static int sqnum, cur_sq_x, cur_sq_y, path_length;
-static int start_x, start_y, start_dir, end_x, end_y, end_dir;
-static int grid_width, grid_height;
-
-static Display *dpy;
-static Window win;
-static GC gc, cgc, tgc, logo_gc;
-static Pixmap logo_map;
-
-static int x = 0, y = 0, restart = 0, stop = 1, state = 1;
-
-static int
-check_events() /* X event handler [ rhess ] */
-{
- XEvent e;
-
- if (XPending(dpy)) {
- XNextEvent(dpy, &e);
- switch (e.type) {
-
- case ButtonPress:
- switch (e.xbutton.button) {
- case 3:
- exit (0);
- break;
- case 2:
- stop = !stop ;
- if (state == 5) state = 4 ;
- else {
- restart = 1;
- stop = 0;
- }
- break;
- default:
- restart = 1 ;
- stop = 0 ;
- break;
- }
- break;
-
- case ConfigureNotify:
- restart = 1;
- break;
- case UnmapNotify:
- stop = 1;
- XClearWindow (dpy, win);
- XSync (dpy, False);
- break;
- case Expose:
- restart = 1;
- break;
- }
- return(1);
- }
- return(0);
-}
-
-
-static void
-set_maze_sizes (width, height)
- int width, height;
-{
- maze_size_x = width / grid_width;
- maze_size_y = height / grid_height;
-}
-
-
-static void
-initialize_maze() /* draw the surrounding wall and start/end squares */
-{
- register int i, j, wall;
-
- /* initialize all squares */
- for ( i=0; i<maze_size_x; i++) {
- for ( j=0; j<maze_size_y; j++) {
- maze[i][j] = 0;
- }
- }
-
- /* top wall */
- for ( i=0; i<maze_size_x; i++ ) {
- maze[i][0] |= WALL_TOP;
- }
-
- /* right wall */
- for ( j=0; j<maze_size_y; j++ ) {
- maze[maze_size_x-1][j] |= WALL_RIGHT;
- }
-
- /* bottom wall */
- for ( i=0; i<maze_size_x; i++ ) {
- maze[i][maze_size_y-1] |= WALL_BOTTOM;
- }
-
- /* left wall */
- for ( j=0; j<maze_size_y; j++ ) {
- maze[0][j] |= WALL_LEFT;
- }
-
- /* set start square */
- wall = get_random(4);
- switch (wall) {
- case 0:
- i = get_random(maze_size_x);
- j = 0;
- break;
- case 1:
- i = maze_size_x - 1;
- j = get_random(maze_size_y);
- break;
- case 2:
- i = get_random(maze_size_x);
- j = maze_size_y - 1;
- break;
- case 3:
- i = 0;
- j = get_random(maze_size_y);
- break;
- }
- maze[i][j] |= START_SQUARE;
- maze[i][j] |= ( DOOR_IN_TOP >> wall );
- maze[i][j] &= ~( WALL_TOP >> wall );
- cur_sq_x = i;
- cur_sq_y = j;
- start_x = i;
- start_y = j;
- start_dir = wall;
- sqnum = 0;
-
- /* set end square */
- wall = (wall + 2)%4;
- switch (wall) {
- case 0:
- i = get_random(maze_size_x);
- j = 0;
- break;
- case 1:
- i = maze_size_x - 1;
- j = get_random(maze_size_y);
- break;
- case 2:
- i = get_random(maze_size_x);
- j = maze_size_y - 1;
- break;
- case 3:
- i = 0;
- j = get_random(maze_size_y);
- break;
- }
- maze[i][j] |= END_SQUARE;
- maze[i][j] |= ( DOOR_OUT_TOP >> wall );
- maze[i][j] &= ~( WALL_TOP >> wall );
- end_x = i;
- end_y = j;
- end_dir = wall;
-
- /* set logo */
- if ((maze_size_x > 15) && (maze_size_y > 15))
- {
- int logow = 1 + logo_width / grid_width;
- int logoh = 1 + logo_height / grid_height;
- /* not closer than 3 grid units from a wall */
- logo_x = get_random (maze_size_x - logow - 6) + 3;
- logo_y = get_random (maze_size_y - logoh - 6) + 3;
- for (i=0; i<logow; i++)
- for (j=0; j<logoh; j++)
- maze[logo_x + i][logo_y + j] |= DOOR_IN_TOP;
- }
- else
- logo_y = logo_x = -1;
-}
-
-static int choose_door ();
-static int backup ();
-static void draw_wall ();
-static void draw_solid_square ();
-static void enter_square ();
-
-static void
-create_maze() /* create a maze layout given the intiialized maze */
-{
- register int i, newdoor = 0;
-
- do {
- move_list[sqnum].x = cur_sq_x;
- move_list[sqnum].y = cur_sq_y;
- move_list[sqnum].dir = newdoor;
- while ( ( newdoor = choose_door() ) == -1 ) { /* pick a door */
- if ( backup() == -1 ) { /* no more doors ... backup */
- return; /* done ... return */
- }
- }
-
- /* mark the out door */
- maze[cur_sq_x][cur_sq_y] |= ( DOOR_OUT_TOP >> newdoor );
-
- switch (newdoor) {
- case 0: cur_sq_y--;
- break;
- case 1: cur_sq_x++;
- break;
- case 2: cur_sq_y++;
- break;
- case 3: cur_sq_x--;
- break;
- }
- sqnum++;
-
- /* mark the in door */
- maze[cur_sq_x][cur_sq_y] |= ( DOOR_IN_TOP >> ((newdoor+2)%4) );
-
- /* if end square set path length and save path */
- if ( maze[cur_sq_x][cur_sq_y] & END_SQUARE ) {
- path_length = sqnum;
- for ( i=0; i<path_length; i++) {
- save_path[i].x = move_list[i].x;
- save_path[i].y = move_list[i].y;
- save_path[i].dir = move_list[i].dir;
- }
- }
-
- } while (1);
-
-}
-
-
-static int
-choose_door() /* pick a new path */
-{
- int candidates[3];
- register int num_candidates;
-
- num_candidates = 0;
-
- /* top wall */
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_IN_TOP )
- goto rightwall;
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_OUT_TOP )
- goto rightwall;
- if ( maze[cur_sq_x][cur_sq_y] & WALL_TOP )
- goto rightwall;
- if ( maze[cur_sq_x][cur_sq_y - 1] & DOOR_IN_ANY ) {
- maze[cur_sq_x][cur_sq_y] |= WALL_TOP;
- maze[cur_sq_x][cur_sq_y - 1] |= WALL_BOTTOM;
- draw_wall(cur_sq_x, cur_sq_y, 0);
- goto rightwall;
- }
- candidates[num_candidates++] = 0;
-
- rightwall:
- /* right wall */
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_IN_RIGHT )
- goto bottomwall;
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_OUT_RIGHT )
- goto bottomwall;
- if ( maze[cur_sq_x][cur_sq_y] & WALL_RIGHT )
- goto bottomwall;
- if ( maze[cur_sq_x + 1][cur_sq_y] & DOOR_IN_ANY ) {
- maze[cur_sq_x][cur_sq_y] |= WALL_RIGHT;
- maze[cur_sq_x + 1][cur_sq_y] |= WALL_LEFT;
- draw_wall(cur_sq_x, cur_sq_y, 1);
- goto bottomwall;
- }
- candidates[num_candidates++] = 1;
-
- bottomwall:
- /* bottom wall */
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_IN_BOTTOM )
- goto leftwall;
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_OUT_BOTTOM )
- goto leftwall;
- if ( maze[cur_sq_x][cur_sq_y] & WALL_BOTTOM )
- goto leftwall;
- if ( maze[cur_sq_x][cur_sq_y + 1] & DOOR_IN_ANY ) {
- maze[cur_sq_x][cur_sq_y] |= WALL_BOTTOM;
- maze[cur_sq_x][cur_sq_y + 1] |= WALL_TOP;
- draw_wall(cur_sq_x, cur_sq_y, 2);
- goto leftwall;
- }
- candidates[num_candidates++] = 2;
-
- leftwall:
- /* left wall */
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_IN_LEFT )
- goto donewall;
- if ( maze[cur_sq_x][cur_sq_y] & DOOR_OUT_LEFT )
- goto donewall;
- if ( maze[cur_sq_x][cur_sq_y] & WALL_LEFT )
- goto donewall;
- if ( maze[cur_sq_x - 1][cur_sq_y] & DOOR_IN_ANY ) {
- maze[cur_sq_x][cur_sq_y] |= WALL_LEFT;
- maze[cur_sq_x - 1][cur_sq_y] |= WALL_RIGHT;
- draw_wall(cur_sq_x, cur_sq_y, 3);
- goto donewall;
- }
- candidates[num_candidates++] = 3;
-
- donewall:
- if (num_candidates == 0)
- return ( -1 );
- if (num_candidates == 1)
- return ( candidates[0] );
- return ( candidates[ get_random(num_candidates) ] );
-
-}
-
-
-static int
-backup() /* back up a move */
-{
- sqnum--;
- cur_sq_x = move_list[sqnum].x;
- cur_sq_y = move_list[sqnum].y;
- return ( sqnum );
-}
-
-
-static void
-draw_maze_border() /* draw the maze outline */
-{
- register int i, j;
-
-
- for ( i=0; i<maze_size_x; i++) {
- if ( maze[i][0] & WALL_TOP ) {
- XDrawLine(dpy, win, gc,
- border_x + grid_width * i,
- border_y,
- border_x + grid_width * (i+1) - 1,
- border_y);
- }
- if ((maze[i][maze_size_y - 1] & WALL_BOTTOM)) {
- XDrawLine(dpy, win, gc,
- border_x + grid_width * i,
- border_y + grid_height * (maze_size_y) - 1,
- border_x + grid_width * (i+1) - 1,
- border_y + grid_height * (maze_size_y) - 1);
- }
- }
- for ( j=0; j<maze_size_y; j++) {
- if ( maze[maze_size_x - 1][j] & WALL_RIGHT ) {
- XDrawLine(dpy, win, gc,
- border_x + grid_width * maze_size_x - 1,
- border_y + grid_height * j,
- border_x + grid_width * maze_size_x - 1,
- border_y + grid_height * (j+1) - 1);
- }
- if ( maze[0][j] & WALL_LEFT ) {
- XDrawLine(dpy, win, gc,
- border_x,
- border_y + grid_height * j,
- border_x,
- border_y + grid_height * (j+1) - 1);
- }
- }
-
- if (logo_x != -1)
- {
- Window r;
- int x, y;
- unsigned int w, h, bw, d;
- XGetGeometry (dpy, logo_map, &r, &x, &y, &w, &h, &bw, &d);
- XCopyPlane (dpy, logo_map, win, logo_gc,
- 0, 0, w, h,
- border_x + 3 + grid_width * logo_x,
- border_y + 3 + grid_height * logo_y, 1);
- }
- draw_solid_square (start_x, start_y, start_dir, tgc);
- draw_solid_square (end_x, end_y, end_dir, tgc);
-}
-
-
-static void
-draw_wall(i, j, dir) /* draw a single wall */
- int i, j, dir;
-{
- switch (dir) {
- case 0:
- XDrawLine(dpy, win, gc,
- border_x + grid_width * i,
- border_y + grid_height * j,
- border_x + grid_width * (i+1),
- border_y + grid_height * j);
- break;
- case 1:
- XDrawLine(dpy, win, gc,
- border_x + grid_width * (i+1),
- border_y + grid_height * j,
- border_x + grid_width * (i+1),
- border_y + grid_height * (j+1));
- break;
- case 2:
- XDrawLine(dpy, win, gc,
- border_x + grid_width * i,
- border_y + grid_height * (j+1),
- border_x + grid_width * (i+1),
- border_y + grid_height * (j+1));
- break;
- case 3:
- XDrawLine(dpy, win, gc,
- border_x + grid_width * i,
- border_y + grid_height * j,
- border_x + grid_width * i,
- border_y + grid_height * (j+1));
- break;
- }
-}
-
-int bw;
-
-static void
-draw_solid_square(i, j, dir, gc) /* draw a solid square in a square */
- register int i, j, dir;
- GC gc;
-{
- switch (dir) {
- case 0: XFillRectangle(dpy, win, gc,
- border_x + bw + grid_width * i,
- border_y - bw + grid_height * j,
- grid_width - (bw+bw), grid_height);
- break;
- case 1: XFillRectangle(dpy, win, gc,
- border_x + bw + grid_width * i,
- border_y + bw + grid_height * j,
- grid_width, grid_height - (bw+bw));
- break;
- case 2: XFillRectangle(dpy, win, gc,
- border_x + bw + grid_width * i,
- border_y + bw + grid_height * j,
- grid_width - (bw+bw), grid_height);
- break;
- case 3: XFillRectangle(dpy, win, gc,
- border_x - bw + grid_width * i,
- border_y + bw + grid_height * j,
- grid_width, grid_height - (bw+bw));
- break;
- }
- XSync (dpy, False);
-}
-
-
-static void
-solve_maze() /* solve it with graphical feedback */
-{
- int i;
-
-
- /* plug up the surrounding wall */
- maze[start_x][start_y] |= (WALL_TOP >> start_dir);
- maze[end_x][end_y] |= (WALL_TOP >> end_dir);
-
- /* initialize search path */
- i = 0;
- path[i].x = end_x;
- path[i].y = end_y;
- path[i].dir = -1;
-
- /* do it */
- while (1) {
- if ( ++path[i].dir >= 4 ) {
- XFillRectangle(dpy, win, cgc,
- border_x + bw + grid_width * (int)(path[i].x),
- border_y + bw + grid_height * (int)(path[i].y),
- grid_width - (bw+bw), grid_height - (bw+bw));
- i--;
- draw_solid_square( (int)(path[i].x), (int)(path[i].y),
- (int)(path[i].dir), cgc);
- }
- else if ( ! (maze[path[i].x][path[i].y] &
- (WALL_TOP >> path[i].dir)) &&
- ( (i == 0) || ( (path[i].dir !=
- (int)(path[i-1].dir+2)%4) ) ) ) {
- enter_square(i);
- i++;
- if ( maze[path[i].x][path[i].y] & START_SQUARE ) {
- return;
- }
- }
- if (check_events()) return;
- /* Abort solve on expose - cheapo repaint strategy */
- if (solve_delay) usleep (solve_delay);
- }
-}
-
-
-static void
-enter_square(n) /* move into a neighboring square */
- int n;
-{
- draw_solid_square( (int)path[n].x, (int)path[n].y,
- (int)path[n].dir, tgc);
-
- path[n+1].dir = -1;
- switch (path[n].dir) {
- case 0: path[n+1].x = path[n].x;
- path[n+1].y = path[n].y - 1;
- break;
- case 1: path[n+1].x = path[n].x + 1;
- path[n+1].y = path[n].y;
- break;
- case 2: path[n+1].x = path[n].x;
- path[n+1].y = path[n].y + 1;
- break;
- case 3: path[n+1].x = path[n].x - 1;
- path[n+1].y = path[n].y;
- break;
- }
-}
-
-/* ----<eof> */
-
-
-/*
- * jmr additions for Jamie Zawinski's <jwz@netscape.com> screensaver stuff,
- * note that the code above this has probably been hacked about in some
- * arbitrary way.
- */
-
-char *progclass = "Maze";
-
-char *defaults[] = {
- "Maze.background: black", /* to placate SGI */
- "Maze.foreground: white", /* to placate SGI */
- "*gridSize: 0",
- "*solveDelay: 5000",
- "*preDelay: 2000000",
- "*postDelay: 4000000",
- "*liveColor: green",
- "*deadColor: red",
-#ifdef XROGER
- "*logoColor: red3",
-#endif
- 0
-};
-
-XrmOptionDescRec options[] = {
- { "-grid-size", ".gridSize", XrmoptionSepArg, 0 },
- { "-solve-delay", ".solveDelay", XrmoptionSepArg, 0 },
- { "-pre-delay", ".preDelay", XrmoptionSepArg, 0 },
- { "-post-delay", ".postDelay", XrmoptionSepArg, 0 },
- { "-live-color", ".liveColor", XrmoptionSepArg, 0 },
- { "-dead-color", ".deadColor", XrmoptionSepArg, 0 }
-};
-
-int options_size = (sizeof(options)/sizeof(options[0]));
-
-void screenhack(display,window)
- Display *display;
- Window window;
-{
- Pixmap gray;
- int size, root;
- XWindowAttributes xgwa;
- unsigned long bg, fg, pfg, pbg, lfg;
-
- size = get_integer_resource ("gridSize", "Dimension");
- root = get_boolean_resource("root", "Boolean");
- solve_delay = get_integer_resource ("solveDelay", "Integer");
- pre_solve_delay = get_integer_resource ("preDelay", "Integer");
- post_solve_delay = get_integer_resource ("postDelay", "Integer");
-
- if (size < 2) size = 7 + (random () % 30);
- grid_width = grid_height = size;
- bw = (size > 6 ? 3 : (size-1)/2);
-
- dpy = display; win = window; /* the maze stuff uses global variables */
-
- XGetWindowAttributes (dpy, win, &xgwa);
-
- x = 0;
- y = 0;
-
- set_maze_sizes (xgwa.width, xgwa.height);
-
- if (! root)
- XSelectInput (dpy, win, ExposureMask|ButtonPressMask|StructureNotifyMask);
-
- gc = XCreateGC(dpy, win, 0, 0);
- cgc = XCreateGC(dpy, win, 0, 0);
- tgc = XCreateGC(dpy,win,0,0);
- logo_gc = XCreateGC(dpy, win, 0, 0);
-
- gray = XCreateBitmapFromData (dpy,win,gray1_bits,gray1_width,gray1_height);
-
- bg = get_pixel_resource ("background","Background", dpy, xgwa.colormap);
- fg = get_pixel_resource ("foreground","Foreground", dpy, xgwa.colormap);
- lfg = get_pixel_resource ("logoColor", "Foreground", dpy, xgwa.colormap);
- pfg = get_pixel_resource ("liveColor", "Foreground", dpy, xgwa.colormap);
- pbg = get_pixel_resource ("deadColor", "Foreground", dpy, xgwa.colormap);
- if (mono_p) lfg = pfg = fg;
-
- if (lfg == bg)
- lfg = ((bg == WhitePixel (dpy, DefaultScreen (dpy)))
- ? BlackPixel (dpy, DefaultScreen (dpy))
- : WhitePixel (dpy, DefaultScreen (dpy)));
-
- XSetForeground (dpy, gc, fg);
- XSetBackground (dpy, gc, bg);
- XSetForeground (dpy, cgc, pbg);
- XSetBackground (dpy, cgc, bg);
- XSetForeground (dpy, tgc, pfg);
- XSetBackground (dpy, tgc, bg);
- XSetForeground (dpy, logo_gc, lfg);
- XSetBackground (dpy, logo_gc, bg);
-
- XSetStipple (dpy, cgc, gray);
- XSetFillStyle (dpy, cgc, FillOpaqueStippled);
-
-#ifdef XROGER
- {
- int w, h;
- XGCValues gcv;
- GC draw_gc, erase_gc;
- extern void skull ();
- /* round up to grid size */
- w = ((logo_width / grid_width) + 1) * grid_width;
- h = ((logo_height / grid_height) + 1) * grid_height;
- logo_map = XCreatePixmap (dpy, win, w, h, 1);
- gcv.foreground = 1L;
- draw_gc = XCreateGC (dpy, logo_map, GCForeground, &gcv);
- gcv.foreground = 0L;
- erase_gc= XCreateGC (dpy, logo_map, GCForeground, &gcv);
- XFillRectangle (dpy, logo_map, erase_gc, 0, 0, w, h);
- skull (dpy, logo_map, draw_gc, erase_gc, 5, 0, w-10, h-10);
- XFreeGC (dpy, draw_gc);
- XFreeGC (dpy, erase_gc);
- }
-#else
- if (!(logo_map = XCreateBitmapFromData (dpy, win, logo_bits,
- logo_width, logo_height)))
- {
- fprintf (stderr, "Can't create logo pixmap\n");
- exit (1);
- }
-#endif
- XMapRaised(dpy, win);
- srandom(getpid());
-
- restart = root;
-
- while (1) { /* primary execution loop [ rhess ] */
- if (check_events()) continue ;
- if (restart || stop) goto pop;
- switch (state) {
- case 1:
- initialize_maze();
- break;
- case 2:
- XClearWindow(dpy, win);
- draw_maze_border();
- break;
- case 3:
- create_maze();
- break;
- case 4:
- XSync (dpy, False);
- usleep (pre_solve_delay);
- break;
- case 5:
- solve_maze();
- break;
- case 6:
- XSync (dpy, False);
- usleep (post_solve_delay);
- state = 0 ;
- break;
- default:
- abort ();
- }
- ++state;
- pop:
- if (restart)
- {
- static XWindowAttributes wattr;
- restart = 0;
- stop = 0;
- state = 1;
- XGetWindowAttributes (dpy, win, &wattr);
- set_maze_sizes (wattr.width, wattr.height);
- XClearWindow (dpy, win);
- XSync (dpy, False);
- }
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "7-mar-93" "X Version 11"
-.SH NAME
-maze \- an automated X11 demo repeatedly creating and solving a random maze
-.SH SYNOPSIS
-.B maze
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-grid\-size \fIpixels\fP] [\-live\-color \fIcolor\fP] [\-dead\-color \fIcolor\fP] [\-solve\-delay \fIusecs\fP] [\-pre\-delay \fIusecs\fP] [\-post\-delay \fIusecs\fP]
-.SH DESCRIPTION
-The \fImaze\fP program creates a "random" maze and then solves it with
-graphical feedback.
-.SH OPTIONS
-.I maze
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-grid\-size \fIpixels\fP
-The size of each block of the maze, in pixels; default is 0, meaning
-pick a random grid size.
-.TP 8
-.B \-live\-color \fIcolor\fP
-The color of the path.
-.TP 8
-.B \-dead\-color \fIcolor\fP
-The color of the failed path (it is also stippled with a 50% pattern.)
-.TP 8
-.B \-solve\-delay \fIinteger\fP
-Delay (in microseconds) between each step of the solution path.
-Default 5000, or about 1/200th second.
-.TP 8
-.B \-pre\-delay \fIinteger\fP
-Delay (in microseconds) between generating a maze and starting to solve it.
-Default 2000000 (2 seconds.)
-.TP 8
-.B \-post\-delay \fIinteger\fP
-Delay (in microseconds) after solving a maze and before generating a new one.
-Default 4000000 (4 seconds.)
-.PP
-Clicking the mouse in the maze window controls it.
-.TP 16
-.B "LeftButton
-Clears the window and restarts maze.
-.TP 16
-.B MiddleButton
-Pause or unpause the program.
-.TP 16
-.B RightButton
-Exit.
-.SH BUGS
-Expose events force a restart of maze.
-
-Mouse actions are based on "raw" values (Button1, Button2 and Button3)
-instead of using the pointer map.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-.PP
-Copyright \(co 1988 by Sun Microsystems, Inc. Mountain View, CA.
-.PP
-All Rights Reserved
-.PP
-Permission to use, copy, modify, and distribute this software and its
-documentation for any purpose and without fee is hereby granted, provided that
-the above copyright notice appear in all copies and that both that copyright
-notice and this permission notice appear in supporting documentation, and that
-the names of Sun or MIT not be used in advertising or publicity pertaining to
-distribution of the software without specific prior written permission. Sun
-and M.I.T. make no representations about the suitability of this software for
-any purpose. It is provided "as is" without any express or implied warranty.
-.PP
-SUN DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE, INCLUDING ALL
-IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. IN
-NO EVENT SHALL SUN BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL
-DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS,
-WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING
-OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE.
-.SH AUTHOR(s)
-.nf
-Jim Randell [ XScreenSaver version ] jmr@mddjmr.fc.hp.com
- HPLabs, Bristol
-Richard Hess [ X11 extensions ] {...}!uunet!cimshop!rhess
- Consilium, Mountain View, CA
-Dave Lemke [ X11 version ] lemke@sun.COM
- Sun MicroSystems, Mountain View, CA
-Martin Weiss [ SunView version ]
- Sun MicroSystems, Mountain View, CA
-.fi
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* Make a little guy with a big nose and a hat wanter around the screen,
- spewing out messages. Derived from xnlock by Dan Heller <argv@sun.com>.
- */
-
-#include "screenhack.h"
-#include <stdio.h>
-
-#if __STDC__
-extern FILE *popen (const char *, const char *);
-extern int pclose (FILE *);
-#endif
-
-#define Pixel unsigned long
-
-#define font_height(font) (font->ascent + font->descent)
-#define FONT_NAME "-*-times-*-*-*-*-18-*-*-*-*-*-*-*"
-
-static Display *dpy;
-static Window window;
-static int Width, Height;
-static GC fg_gc, bg_gc, text_fg_gc, text_bg_gc;
-static char *words, *get_words();
-static int x, y;
-static XFontStruct *font;
-static char *def_words = "I'm out running around.";
-static void init_images(), walk(), talk();
-static int think();
-static unsigned long interval, look();
-static Pixmap left0, left1, right0, right1;
-static Pixmap left_front, right_front, front, down;
-
-static char *program, *orig_program, *filename, *text;
-
-#define FROM_ARGV 1
-#define FROM_PROGRAM 2
-#define FROM_FILE 3
-#define FROM_RESRC 4
-static int getwordsfrom;
-
-#define IS_MOVING 1
-#define GET_PASSWD 2
-static int state; /* indicates states: walking or getting passwd */
-
-static void (*next_fn) ();
-
-#include "noses/nose.0.left"
-#include "noses/nose.1.left"
-#include "noses/nose.0.right"
-#include "noses/nose.1.right"
-#include "noses/nose.left.front"
-#include "noses/nose.right.front"
-#include "noses/nose.front"
-#include "noses/nose.down"
-
-static void
-init_images ()
-{
- static Pixmap *images[] = {
- &left0, &left1, &right0, &right1,
- &left_front, &right_front, &front, &down
- };
- static unsigned char *bits[] = {
- nose_0_left_bits, nose_1_left_bits, nose_0_right_bits,
- nose_1_right_bits, nose_left_front_bits, nose_right_front_bits,
- nose_front_bits, nose_down_bits
- };
- int i;
-
- for (i = 0; i < sizeof (images) / sizeof (images[0]); i++)
- if (!(*images[i] =
- XCreatePixmapFromBitmapData(dpy, window,
- (char *) bits[i], 64, 64, 1, 0, 1)))
- {
- fprintf (stderr, "%s: Can't load nose images", progname);
- exit (1);
- }
-}
-
-#define LEFT 001
-#define RIGHT 002
-#define DOWN 004
-#define UP 010
-#define FRONT 020
-#define X_INCR 3
-#define Y_INCR 2
-
-static void
-move()
-{
- static int length,
- dir;
-
- if (!length)
- {
- register int tries = 0;
- dir = 0;
- if ((random() & 1) && think())
- {
- talk(0); /* sets timeout to itself */
- return;
- }
- if (!(random() % 3) && (interval = look()))
- {
- next_fn = move;
- return;
- }
- interval = 20 + random() % 100;
- do
- {
- if (!tries)
- length = Width / 100 + random() % 90, tries = 8;
- else
- tries--;
- switch (random() % 8)
- {
- case 0:
- if (x - X_INCR * length >= 5)
- dir = LEFT;
- break;
- case 1:
- if (x + X_INCR * length <= Width - 70)
- dir = RIGHT;
- break;
- case 2:
- if (y - (Y_INCR * length) >= 5)
- dir = UP, interval = 40;
- break;
- case 3:
- if (y + Y_INCR * length <= Height - 70)
- dir = DOWN, interval = 20;
- break;
- case 4:
- if (x - X_INCR * length >= 5 && y - (Y_INCR * length) >= 5)
- dir = (LEFT | UP);
- break;
- case 5:
- if (x + X_INCR * length <= Width - 70 &&
- y - Y_INCR * length >= 5)
- dir = (RIGHT | UP);
- break;
- case 6:
- if (x - X_INCR * length >= 5 &&
- y + Y_INCR * length <= Height - 70)
- dir = (LEFT | DOWN);
- break;
- case 7:
- if (x + X_INCR * length <= Width - 70 &&
- y + Y_INCR * length <= Height - 70)
- dir = (RIGHT | DOWN);
- break;
- default:
- /* No Defaults */
- break;
- }
- } while (!dir);
- }
- walk(dir);
- --length;
- next_fn = move;
-}
-
-static void
-walk(dir)
- register int dir;
-{
- register int incr = 0;
- static int lastdir;
- static int up = 1;
- static Pixmap frame;
-
- if (dir & (LEFT | RIGHT))
- { /* left/right movement (mabye up/down too) */
- up = -up; /* bouncing effect (even if hit a wall) */
- if (dir & LEFT)
- {
- incr = X_INCR;
- frame = (up < 0) ? left0 : left1;
- }
- else
- {
- incr = -X_INCR;
- frame = (up < 0) ? right0 : right1;
- }
- if ((lastdir == FRONT || lastdir == DOWN) && dir & UP)
- {
-
- /*
- * workaround silly bug that leaves screen dust when guy is
- * facing forward or down and moves up-left/right.
- */
- XCopyPlane(dpy, frame, window, fg_gc, 0, 0, 64, 64, x, y, 1L);
- XFlush(dpy);
- }
- /* note that maybe neither UP nor DOWN is set! */
- if (dir & UP && y > Y_INCR)
- y -= Y_INCR;
- else if (dir & DOWN && y < Height - 64)
- y += Y_INCR;
- }
- /* Explicit up/down movement only (no left/right) */
- else if (dir == UP)
- XCopyPlane(dpy, front, window, fg_gc,
- 0, 0, 64, 64, x, y -= Y_INCR, 1L);
- else if (dir == DOWN)
- XCopyPlane(dpy, down, window, fg_gc,
- 0, 0, 64, 64, x, y += Y_INCR, 1L);
- else if (dir == FRONT && frame != front)
- {
- if (up > 0)
- up = -up;
- if (lastdir & LEFT)
- frame = left_front;
- else if (lastdir & RIGHT)
- frame = right_front;
- else
- frame = front;
- XCopyPlane(dpy, frame, window, fg_gc, 0, 0, 64, 64, x, y, 1L);
- }
- if (dir & LEFT)
- while (--incr >= 0)
- {
- XCopyPlane(dpy, frame, window, fg_gc,
- 0, 0, 64, 64, --x, y + up, 1L);
- XFlush(dpy);
- }
- else if (dir & RIGHT)
- while (++incr <= 0)
- {
- XCopyPlane(dpy, frame, window, fg_gc,
- 0, 0, 64, 64, ++x, y + up, 1L);
- XFlush(dpy);
- }
- lastdir = dir;
-}
-
-static int
-think()
-{
- if (random() & 1)
- walk(FRONT);
- if (random() & 1)
- {
- if (getwordsfrom == FROM_PROGRAM)
- words = get_words(0, (char **) 0);
- return 1;
- }
- return 0;
-}
-
-#define MAXLINES 40
-
-static void
-talk(force_erase)
- int force_erase;
-{
- int width = 0,
- height,
- Z,
- total = 0;
- static int X,
- Y,
- talking;
- static struct
- {
- int x,
- y,
- width,
- height;
- } s_rect;
- register char *p,
- *p2;
- char buf[BUFSIZ],
- args[MAXLINES][256];
-
- /* clear what we've written */
- if (talking || force_erase)
- {
- if (!talking)
- return;
- XFillRectangle(dpy, window, bg_gc, s_rect.x - 5, s_rect.y - 5,
- s_rect.width + 10, s_rect.height + 10);
- talking = 0;
- if (!force_erase)
- next_fn = move;
- interval = 0;
- {
- /* might as well check the window for size changes now... */
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- Width = xgwa.width + 2;
- Height = xgwa.height + 2;
- }
- return;
- }
- talking = 1;
- walk(FRONT);
- p = strcpy(buf, words);
-
- if (!(p2 = index(p, '\n')) || !p2[1])
- {
- total = strlen (words);
- strcpy (args[0], words);
- width = XTextWidth(font, words, total);
- height = 0;
- }
- else
- /* p2 now points to the first '\n' */
- for (height = 0; p; height++)
- {
- int w;
- *p2 = 0;
- if ((w = XTextWidth(font, p, p2 - p)) > width)
- width = w;
- total += p2 - p; /* total chars; count to determine reading
- * time */
- (void) strcpy(args[height], p);
- if (height == MAXLINES - 1)
- {
- puts("Message too long!");
- break;
- }
- p = p2 + 1;
- if (!(p2 = index(p, '\n')))
- break;
- }
- height++;
-
- /*
- * Figure out the height and width in pixels (height, width) extend the
- * new box by 15 pixels on the sides (30 total) top and bottom.
- */
- s_rect.width = width + 30;
- s_rect.height = height * font_height(font) + 30;
- if (x - s_rect.width - 10 < 5)
- s_rect.x = 5;
- else if ((s_rect.x = x + 32 - (s_rect.width + 15) / 2)
- + s_rect.width + 15 > Width - 5)
- s_rect.x = Width - 15 - s_rect.width;
- if (y - s_rect.height - 10 < 5)
- s_rect.y = y + 64 + 5;
- else
- s_rect.y = y - 5 - s_rect.height;
-
- XFillRectangle(dpy, window, text_bg_gc,
- s_rect.x, s_rect.y, s_rect.width, s_rect.height);
-
- /* make a box that's 5 pixels thick. Then add a thin box inside it */
- XSetLineAttributes(dpy, text_fg_gc, 5, 0, 0, 0);
- XDrawRectangle(dpy, window, text_fg_gc,
- s_rect.x, s_rect.y, s_rect.width - 1, s_rect.height - 1);
- XSetLineAttributes(dpy, text_fg_gc, 0, 0, 0, 0);
- XDrawRectangle(dpy, window, text_fg_gc,
- s_rect.x + 7, s_rect.y + 7, s_rect.width - 15, s_rect.height - 15);
-
- X = 15;
- Y = 15 + font_height(font);
-
- /* now print each string in reverse order (start at bottom of box) */
- for (Z = 0; Z < height; Z++)
- {
- XDrawString(dpy, window, text_fg_gc, s_rect.x + X, s_rect.y + Y,
- args[Z], strlen(args[Z]));
- Y += font_height(font);
- }
- interval = (total / 15) * 1000;
- if (interval < 2000) interval = 2000;
- next_fn = talk;
-}
-
-static unsigned long
-look()
-{
- if (random() % 3)
- {
- XCopyPlane(dpy, (random() & 1) ? down : front, window, fg_gc,
- 0, 0, 64, 64, x, y, 1L);
- return 1000L;
- }
- if (!(random() % 5))
- return 0;
- if (random() % 3)
- {
- XCopyPlane(dpy, (random() & 1) ? left_front : right_front,
- window, fg_gc, 0, 0, 64, 64, x, y, 1L);
- return 1000L;
- }
- if (!(random() % 5))
- return 0;
- XCopyPlane(dpy, (random() & 1) ? left0 : right0, window, fg_gc,
- 0, 0, 64, 64, x, y, 1L);
- return 1000L;
-}
-
-
-static void
-init_words()
-{
- char *mode = get_string_resource ("mode", "Mode");
-
- program = get_string_resource ("program", "Program");
- filename = get_string_resource ("filename", "Filename");
- text = get_string_resource ("text", "Text");
-
- if (program) /* get stderr on stdout, so it shows up on the window */
- {
- orig_program = program;
- program = (char *) malloc (strlen (program) + 10);
- strcpy (program, "( ");
- strcat (program, orig_program);
- strcat (program, " ) 2>&1");
- }
-
- if (!mode || !strcmp (mode, "program"))
- getwordsfrom = FROM_PROGRAM;
- else if (!strcmp (mode, "file"))
- getwordsfrom = FROM_FILE;
- else if (!strcmp (mode, "string"))
- getwordsfrom = FROM_RESRC;
- else
- {
- fprintf (stderr,
- "%s: mode must be program, file, or string, not %s\n",
- progname, mode);
- exit (1);
- }
-
- if (getwordsfrom == FROM_PROGRAM && !program)
- {
- fprintf (stderr, "%s: no program specified.\n", progname);
- exit (1);
- }
- if (getwordsfrom == FROM_FILE && !filename)
- {
- fprintf (stderr, "%s: no file specified.\n", progname);
- exit (1);
- }
-
- words = get_words();
-}
-
-static int first_time = 1;
-
-static char *
-get_words()
-{
- FILE *pp;
- static char buf[BUFSIZ];
- register char *p = buf;
-
- buf[0] = '\0';
-
- switch (getwordsfrom)
- {
- case FROM_PROGRAM:
- if ((pp = popen(program, "r")))
- {
- while (fgets(p, sizeof(buf) - strlen(buf), pp))
- {
- if (strlen(buf) + 1 < sizeof(buf))
- p = buf + strlen(buf);
- else
- break;
- }
- (void) pclose(pp);
- if (! buf[0])
- sprintf (buf, "\"%s\" produced no output!", orig_program);
- else if (!first_time &&
- (strstr (buf, ": not found") ||
- strstr (buf, ": Not found")))
- switch (random () % 20)
- {
- case 1: strcat (buf, "( Get with the program, bub. )\n");
- break;
- case 2: strcat (buf,
- "( I blow my nose at you, you silly person! ) \n"); break;
- case 3: strcat (buf,
- "\nThe resource you want to\nset is `noseguy.program'\n");
- break;
- case 4:
- strcat(buf,"\nHelp!! Help!!\nAAAAAAGGGGHHH!! \n\n"); break;
- case 5: strcpy (buf, "You have new mail.\n"); break;
- case 6:
- strcat(buf,"( Hello? Are you paying attention? )\n");break;
- case 7:
- strcat (buf, "sh: what kind of fool do you take me for? \n");
- break;
- }
- first_time = 0;
- p = buf;
- }
- else
- {
- perror(program);
- p = def_words;
- }
- break;
- case FROM_FILE:
- if ((pp = fopen(filename, "r")))
- {
- while (fgets(p, sizeof(buf) - strlen(buf), pp))
- {
- if (strlen(buf) + 1 < sizeof(buf))
- p = buf + strlen(buf);
- else
- break;
- }
- (void) fclose(pp);
- if (! buf[0])
- sprintf (buf, "file \"%s\" is empty!", filename);
- p = buf;
- }
- else
- {
- sprintf (buf, "couldn't read file \"%s\"!", filename);
- p = buf;
- }
- break;
- case FROM_RESRC:
- p = text;
- break;
- default:
- p = def_words;
- break;
- }
-
- if (!p || *p == '\0')
- p = def_words;
- return p;
-}
-
-
-\f
-char *progclass = "Noseguy";
-
-char *defaults [] = {
- "Noseguy.background: black", /* to placate SGI */
- "Noseguy.foreground: white",
- "*mode: program",
- "*program: fortune -s",
- "noseguy.font: -*-new century schoolbook-*-r-*-*-*-180-*-*-*-*-*-*",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-mode", ".mode", XrmoptionSepArg, 0 },
- { "-program", ".program", XrmoptionSepArg, 0 },
- { "-text", ".text", XrmoptionSepArg, 0 },
- { "-filename", ".filename", XrmoptionSepArg, 0 },
- { "-font", ".font", XrmoptionSepArg, 0 },
- { "-text-foreground", ".textForeground", XrmoptionSepArg, 0 },
- { "-text-background", ".textBackground", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-
-static void
-noseguy_init (d, w)
- Display *d;
- Window w;
-{
- Pixel fg, bg, text_fg, text_bg;
- XWindowAttributes xgwa;
- Colormap cmap;
- char *fontname = get_string_resource ("font", "Font");
- char **list;
- int foo, i;
- XGCValues gcvalues;
- dpy = d;
- window = w;
- XGetWindowAttributes (dpy, window, &xgwa);
- Width = xgwa.width + 2;
- Height = xgwa.height + 2;
- cmap = xgwa.colormap;
-
- init_words();
- init_images();
-
- if (!fontname || !(font = XLoadQueryFont(dpy, fontname)))
- {
- list = XListFonts(dpy, FONT_NAME, 32767, &foo);
- for (i = 0; i < foo; i++)
- if ((font = XLoadQueryFont(dpy, list[i])))
- break;
- if (!font)
- {
- fprintf (stderr, "%s: Can't find a large font.", progname);
- exit (1);
- }
- XFreeFontNames(list);
- }
-
- fg = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- bg = get_pixel_resource ("background", "Background", dpy, cmap);
- text_fg = get_pixel_resource ("textForeground", "Foreground", dpy, cmap);
- text_bg = get_pixel_resource ("textBackground", "Background", dpy, cmap);
- /* notice when unspecified */
- if (! get_string_resource ("textForeground", "Foreground"))
- text_fg = bg;
- if (! get_string_resource ("textBackground", "Background"))
- text_bg = fg;
-
- gcvalues.font = font->fid;
- gcvalues.graphics_exposures = False;
- gcvalues.foreground = fg;
- gcvalues.background = bg;
- fg_gc = XCreateGC (dpy, window,
- GCForeground|GCBackground|GCGraphicsExposures|GCFont,
- &gcvalues);
- gcvalues.foreground = bg;
- gcvalues.background = fg;
- bg_gc = XCreateGC (dpy, window,
- GCForeground|GCBackground|GCGraphicsExposures|GCFont,
- &gcvalues);
- gcvalues.foreground = text_fg;
- gcvalues.background = text_bg;
- text_fg_gc = XCreateGC (dpy, window,
- GCForeground|GCBackground|GCGraphicsExposures|GCFont,
- &gcvalues);
- gcvalues.foreground = text_bg;
- gcvalues.background = text_fg;
- text_bg_gc = XCreateGC (dpy, window,
- GCForeground|GCBackground|GCGraphicsExposures|GCFont,
- &gcvalues);
- x = Width / 2;
- y = Height / 2;
- state = IS_MOVING;
-}
-
-void
-screenhack (d, w)
- Display *d;
- Window w;
-{
- noseguy_init (d, w);
- next_fn = move;
- while (1)
- {
- next_fn (0);
- XSync (dpy, True);
- usleep (interval * 1000);
- }
-}
-
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-noseguy - a little guy with a big nose wanders around being witty
-.SH SYNOPSIS
-.B noseguy
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-text-foreground \fIcolor\fP] [\-text-background \fIcolor\fP] [\-font \fIfont\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-mode \fImode\fP] [\-program \fIprogram\fP] [\-filename \file\fP] [\-text \fItext\fP]
-.SH DESCRIPTION
-A little man with a big nose and a hat runs around spewing out messages to
-the screen. This code (and its bitmaps) were extracted from the \fIxnlock\fP
-program.
-.SH OPTIONS
-.I noseguy
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-font \fIfont\fP
-The font used for the messages.
-.TP 8
-.B \-mode [ program | file | string ]
-In \fIprogram\fP mode, the messages are gotten by running a program.
-The program used is controlled by the \fI\-program\fP option, and
-the \fI.program\fP resource.
-
-In \fIfilename\fP mode, the message used is the contents of a file.
-The file used is controlled by the \fI\-file\fP option, and
-the \fI.filename\fP resource.
-
-In \fIstring\fP mode, the message is whatever was specified on the
-command line as the \fI\-text\fP option, or in the resource database
-as the \fI.text\fP resource.
-.TP 8
-.B \-program \fIprogram\fP
-If \fImode\fP is \fIprogram\fP (the default), then this program will be
-run periodically, and its output will be the text of the messages. The
-default program is \fI"fortune -s"\fP, but \fIyow\fP is also a good choice.
-.TP 8
-.B \-filename \fIfile\fP
-If \fImode\fP is \fIfile\fP, then the contents of this file will be used
-for all messages.
-.TP 8
-.B \-text \fIstring\fP
-If \fImode\fP is \fIstring\fP, then this text will be used for all messages.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1),
-.BR xnlock (1)
-.SH COPYRIGHT
-Copyright 1985, 1990 by Dan Heller <argv@sun.com>.
-.SH AUTHOR
-Dan Heller <argv@sun.com>, 1985.
-
-Ability to run standalone or with \fIxscreensaver\fP added by
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-#define nose_0_left_width 64
-#define nose_0_left_height 64
-static unsigned char nose_0_left_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00,
- 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00,
- 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00,
- 0x18,0x00,0x20,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x40,0x00,0x80,0x00,0x00,
- 0x00,0x08,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x00,0x01,0x20,0x00,
- 0x00,0x00,0x04,0x00,0x00,0x06,0x18,0x00,0x00,0x00,0x06,0x00,0x00,0xf8,0x07,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,
- 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xc0,0x00,0x03,0x03,0x10,0x00,0x00,
- 0x00,0x30,0x00,0x0c,0x01,0x20,0x00,0x00,0x00,0x08,0x00,0x98,0x00,0x20,0x00,
- 0x00,0x00,0x0c,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20,
- 0x00,0x00,0x00,0x42,0x00,0x80,0x00,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,
- 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x01,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_0_right_width 64
-#define nose_0_right_height 64
-static unsigned char nose_0_right_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f,
- 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c,
- 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00,
- 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x18,0x00,0x00,0x80,0x00,
- 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
- 0x01,0x00,0x02,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x20,0x00,0x00,
- 0x00,0x04,0x80,0x00,0x00,0x60,0x00,0x00,0x00,0x18,0x60,0x00,0x00,0x40,0x00,
- 0x00,0x00,0xe0,0x1f,0x00,0x00,0x80,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0xc0,0xc0,0x00,0x03,0x00,
- 0x00,0x00,0x04,0x80,0x30,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x19,0x00,0x10,
- 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x30,0x00,0x00,0x00,0x04,0x00,0x03,0x00,
- 0x43,0x00,0x00,0x00,0x04,0x00,0x01,0x00,0x42,0x00,0x00,0x00,0x04,0x80,0x00,
- 0x00,0x84,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00,
- 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_1_left_width 64
-#define nose_1_left_height 64
-static unsigned char nose_1_left_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x08,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,0xf0,0x03,0x00,0x00,0x80,0x00,
- 0x00,0x00,0x0e,0x0c,0x00,0x00,0x80,0x01,0x00,0x00,0x03,0x30,0x00,0x00,0x00,
- 0x01,0x00,0x80,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x40,0x00,0xc0,0x00,0x00,
- 0x00,0x02,0x00,0x20,0x00,0x80,0x00,0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,
- 0x00,0x00,0x04,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x0c,0x00,0x08,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x08,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x01,0x00,0x00,
- 0x18,0x00,0x10,0x00,0x00,0x01,0x00,0x00,0x08,0x00,0x20,0x00,0x80,0x00,0x00,
- 0x00,0x08,0x00,0x40,0x00,0x40,0x00,0x00,0x00,0x0c,0x00,0x80,0x00,0x20,0x00,
- 0x00,0x00,0xe4,0x00,0x00,0x03,0x18,0x00,0x00,0x00,0x26,0x03,0x00,0xfc,0x07,
- 0x00,0x00,0x00,0x12,0x0c,0x00,0x00,0xf8,0xff,0xff,0xff,0x11,0x10,0x80,0x1f,
- 0x00,0x00,0x00,0x00,0x08,0x20,0x60,0x60,0xc0,0x07,0x00,0x00,0x04,0x40,0x10,
- 0xc0,0x20,0x08,0x00,0x1f,0x02,0x40,0x08,0x00,0x21,0x10,0xc0,0x60,0x02,0x40,
- 0x04,0x00,0x12,0x20,0x20,0x80,0x02,0x20,0xc2,0x00,0x14,0x40,0x18,0x00,0x03,
- 0x20,0x22,0x00,0x0c,0x80,0x04,0x03,0x02,0x10,0x12,0x00,0x08,0x80,0x86,0x00,
- 0x04,0x10,0x12,0x00,0x10,0x80,0x42,0x00,0x18,0x08,0x12,0x00,0x10,0x40,0x42,
- 0x00,0x00,0x04,0x02,0x00,0x20,0x40,0x42,0x00,0x00,0x04,0x02,0x00,0x00,0x20,
- 0x42,0x00,0x00,0x02,0x04,0x00,0x00,0x20,0x02,0x00,0x00,0x01,0x04,0x00,0x00,
- 0x20,0x02,0x00,0x00,0x01,0x08,0x00,0x00,0x20,0x04,0x00,0x80,0x00,0x10,0x00,
- 0x00,0x20,0x0c,0x00,0x80,0x00,0x60,0x00,0x00,0x10,0x08,0x00,0x40,0x00,0x80,
- 0xff,0xff,0x0f,0x30,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0x0f,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_1_right_width 64
-#define nose_1_right_height 64
-static unsigned char nose_1_right_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
- 0x04,0x00,0x00,0x00,0x00,0x10,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,0x00,0x01,0x00,0x00,0xc0,0x0f,
- 0x00,0x00,0x80,0x01,0x00,0x00,0x30,0x70,0x00,0x00,0x80,0x00,0x00,0x00,0x0c,
- 0xc0,0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x01,0x00,0x40,0x00,0x00,0x00,
- 0x03,0x00,0x02,0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x04,0x00,0x20,0x00,0x00,
- 0x00,0x00,0x00,0x08,0x00,0x30,0x00,0x00,0x00,0x00,0x00,0x08,0x00,0x10,0x00,
- 0x00,0x00,0x00,0x00,0x10,0x00,0x10,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,
- 0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,
- 0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,
- 0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,
- 0x10,0x00,0x08,0x00,0x00,0x00,0x00,0x00,0x10,0x00,0x18,0x00,0x00,0x80,0x00,
- 0x00,0x08,0x00,0x10,0x00,0x00,0x80,0x00,0x00,0x08,0x00,0x10,0x00,0x00,0x00,
- 0x01,0x00,0x04,0x00,0x30,0x00,0x00,0x00,0x02,0x00,0x02,0x00,0x27,0x00,0x00,
- 0x00,0x04,0x00,0x01,0xc0,0x64,0x00,0x00,0x00,0x18,0xc0,0x00,0x30,0x48,0x00,
- 0x00,0x00,0xe0,0x3f,0x00,0x08,0x88,0xff,0xff,0xff,0x1f,0x00,0x00,0x04,0x10,
- 0x00,0x00,0x00,0x00,0xf8,0x01,0x02,0x20,0x00,0x00,0xe0,0x03,0x06,0x06,0x02,
- 0x40,0xf8,0x00,0x10,0x04,0x03,0x08,0x02,0x40,0x06,0x03,0x08,0x84,0x00,0x10,
- 0x04,0x40,0x01,0x04,0x04,0x48,0x00,0x20,0x04,0xc0,0x00,0x18,0x02,0x28,0x00,
- 0x43,0x08,0x40,0xc0,0x20,0x01,0x30,0x00,0x44,0x08,0x20,0x00,0x61,0x01,0x10,
- 0x00,0x48,0x10,0x18,0x00,0x42,0x01,0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,
- 0x08,0x00,0x48,0x20,0x00,0x00,0x42,0x02,0x04,0x00,0x40,0x40,0x00,0x00,0x42,
- 0x04,0x00,0x00,0x40,0x80,0x00,0x00,0x40,0x04,0x00,0x00,0x20,0x80,0x00,0x00,
- 0x40,0x04,0x00,0x00,0x20,0x00,0x01,0x00,0x20,0x04,0x00,0x00,0x10,0x00,0x01,
- 0x00,0x30,0x04,0x00,0x00,0x08,0x00,0x02,0x00,0x10,0x08,0x00,0x00,0x06,0x00,
- 0x0c,0x00,0x0c,0xf0,0xff,0xff,0x01,0x00,0xf0,0xff,0x03,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_down_width 64
-#define nose_down_height 64
-static unsigned char nose_down_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0xfc,0xff,0x01,0x00,0x00,0x00,0x00,0xc0,0x03,0x00,0x1e,0x00,
- 0x00,0x00,0x00,0x38,0x00,0x00,0xe0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,
- 0x03,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x04,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x00,0x08,0x00,0x00,0x20,0x00,0x00,0x00,0x00,0x30,0x00,0x00,0x10,0x00,0x80,
- 0x1f,0x00,0x40,0x00,0x00,0x08,0x00,0x60,0x60,0x00,0x80,0x00,0x00,0x08,0x00,
- 0x10,0x80,0x00,0x80,0x00,0x00,0x04,0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x04,
- 0x00,0x08,0x00,0x01,0x00,0x01,0x00,0x02,0x00,0x18,0x80,0x01,0x00,0x02,0x00,
- 0x02,0x00,0x68,0x60,0x01,0x00,0x02,0x00,0x02,0x00,0x88,0x1f,0x01,0x00,0x02,
- 0x00,0x02,0x00,0x08,0x00,0x01,0x00,0x02,0x00,0x02,0x00,0x10,0x80,0x00,0x00,
- 0x03,0x00,0x06,0x00,0x60,0x60,0x00,0x80,0x02,0x00,0x0c,0x00,0x80,0x1f,0x00,
- 0x40,0x01,0x00,0x14,0x00,0x00,0x00,0x00,0x20,0x01,0x00,0x28,0x00,0x00,0x00,
- 0x00,0x90,0x00,0x00,0x50,0x00,0x00,0x00,0x00,0x48,0x00,0x00,0xa0,0x01,0x00,
- 0x00,0x00,0x26,0x00,0x00,0x40,0x1e,0x00,0x00,0xc0,0x11,0x00,0x00,0x80,0xe1,
- 0x03,0x00,0x3c,0x0c,0x00,0x00,0x00,0x0e,0xfc,0xff,0x83,0x03,0x00,0x00,0x00,
- 0xf0,0x01,0x00,0x78,0x00,0x00,0x00,0x00,0x00,0xfe,0xff,0x0f,0x00,0x00,0x00,
- 0x00,0x80,0x03,0x00,0x0c,0x00,0x00,0x00,0x00,0x80,0x02,0x00,0x14,0x00,0x00,
- 0x00,0x00,0x60,0x04,0x00,0x12,0x00,0x00,0xc0,0x7f,0x10,0x04,0x00,0x22,0xe0,
- 0x01,0x70,0xc0,0x18,0x08,0x00,0x61,0x1c,0x06,0x10,0x00,0x0f,0x30,0xc0,0x80,
- 0x07,0x08,0x08,0x00,0x06,0xc0,0x3f,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x02,
- 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80,
- 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00,
- 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00,
- 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84,
- 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08,
- 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff,
- 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_front_width 64
-#define nose_front_height 64
-static unsigned char nose_front_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0xc0,0x1f,0x00,0x20,0x00,0x00,0x08,0x00,0x30,0x60,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0x0f,0x80,0xff,0x3f,0x00,0x00,0x00,0x02,0x02,0x00,0x82,0x00,
- 0x00,0x00,0x00,0x03,0x01,0x00,0x84,0x01,0x00,0x00,0x00,0x81,0x00,0x00,0x08,
- 0x01,0x00,0x00,0x80,0x80,0x00,0x00,0x08,0x02,0x00,0x00,0x80,0x40,0x00,0x00,
- 0x10,0x02,0x00,0x00,0x40,0x40,0x00,0x00,0x10,0x04,0x00,0x00,0x40,0x20,0x00,
- 0x00,0x20,0x04,0x00,0x00,0x60,0x20,0x00,0x00,0x20,0x0c,0x00,0x00,0x20,0x20,
- 0x00,0x00,0x20,0x08,0x00,0x00,0x20,0x20,0x00,0x00,0x20,0x08,0x00,0x00,0x10,
- 0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,
- 0x10,0x20,0x00,0x00,0x20,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,
- 0x00,0x10,0x40,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,
- 0x00,0x00,0x10,0x80,0x00,0x00,0x08,0x10,0x00,0x00,0x30,0x00,0x01,0x00,0x04,
- 0x18,0x00,0x00,0x20,0x00,0x02,0x00,0x02,0x08,0x00,0x00,0x20,0x00,0x0c,0x80,
- 0x01,0x08,0x00,0x00,0x60,0x00,0x30,0x60,0x00,0x0c,0x00,0x00,0x40,0x00,0xc0,
- 0x1f,0x00,0x04,0x00,0x00,0xc0,0x00,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x80,0x0f,0xc0,0x0f,0x00,0x00,0x00,
- 0x00,0x40,0x10,0x20,0x10,0x00,0x00,0x00,0x00,0x20,0x60,0x30,0x20,0x00,0x00,
- 0x00,0x00,0x20,0xc0,0x18,0x20,0x00,0x00,0xc0,0x7f,0x10,0x80,0x0d,0x40,0xe0,
- 0x01,0x70,0xc0,0x18,0x00,0x05,0x40,0x1c,0x06,0x10,0x00,0x0f,0x00,0x05,0x80,
- 0x07,0x08,0x08,0x00,0x06,0x00,0x05,0x80,0x01,0x08,0x08,0x00,0x18,0x00,0x05,
- 0xc0,0x00,0x10,0x04,0x00,0x30,0x00,0x05,0x30,0x00,0x10,0x04,0x00,0x00,0x80,
- 0x08,0x18,0x00,0x20,0x04,0x00,0x00,0x80,0x08,0x00,0x00,0x20,0x04,0x00,0x00,
- 0x40,0x10,0x00,0x00,0x20,0x24,0x00,0x00,0x40,0x10,0x00,0x00,0x22,0x24,0x00,
- 0x00,0x40,0x10,0x00,0x00,0x22,0x44,0x00,0x00,0x40,0x10,0x00,0x00,0x11,0x84,
- 0x01,0x00,0xc0,0x18,0x00,0xc0,0x10,0x08,0x00,0x00,0x80,0x08,0x00,0x00,0x08,
- 0x30,0x00,0x00,0x80,0x08,0x00,0x00,0x04,0xe0,0xff,0xff,0xff,0xf8,0xff,0xff,
- 0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_left_front_width 64
-#define nose_left_front_height 64
-static unsigned char nose_left_front_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xc0,0xff,0xff,0x07,0x00,0x00,0x00,0x00,0x40,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,
- 0x00,0x00,0x04,0x00,0x00,0x00,0x00,0x40,0x00,0x00,0x04,0x00,0x00,0x00,0x00,
- 0x40,0x00,0x00,0x04,0x00,0x00,0x00,0xf8,0xff,0xff,0xff,0xff,0x3f,0x00,0x00,
- 0x08,0x00,0xe0,0x0f,0x00,0x20,0x00,0x00,0x08,0x00,0x18,0x30,0x00,0x20,0x00,
- 0x00,0xf8,0xff,0x07,0xc0,0xff,0x3f,0x00,0x00,0x00,0x02,0x01,0x00,0x81,0x00,
- 0x00,0x00,0x00,0x83,0x00,0x00,0x82,0x01,0x00,0x00,0x00,0x41,0x00,0x00,0x04,
- 0x01,0x00,0x00,0x80,0x40,0x00,0x00,0x04,0x02,0x00,0x00,0x80,0x20,0x00,0x00,
- 0x08,0x02,0x00,0x00,0x40,0x20,0x00,0x00,0x08,0x04,0x00,0x00,0x40,0x10,0x00,
- 0x00,0x10,0x04,0x00,0x00,0x60,0x10,0x00,0x00,0x10,0x0c,0x00,0x00,0x20,0x10,
- 0x00,0x00,0x10,0x08,0x00,0x00,0x30,0x10,0x00,0x00,0x10,0x08,0x00,0x00,0x10,
- 0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,
- 0x10,0x10,0x00,0x00,0x10,0x10,0x00,0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,
- 0x00,0x10,0x20,0x00,0x00,0x08,0x10,0x00,0x00,0x10,0x40,0x00,0x00,0x04,0x10,
- 0x00,0x00,0x30,0x40,0x00,0x00,0x04,0x10,0x00,0x00,0x20,0x80,0x00,0x00,0x02,
- 0x18,0x00,0x00,0x20,0x00,0x01,0x00,0x01,0x08,0x00,0x00,0x60,0x00,0x06,0xc0,
- 0x00,0x08,0x00,0x00,0x80,0x00,0x18,0x30,0x00,0x0c,0x00,0x00,0x80,0x00,0xe0,
- 0x0f,0x00,0x04,0x00,0x00,0x80,0x01,0x00,0x00,0x00,0x06,0x00,0x00,0x00,0x01,
- 0x00,0x00,0x00,0x02,0x00,0x00,0x00,0xfe,0xff,0xff,0xff,0x01,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf8,0x0f,0x00,0x00,0x00,
- 0x00,0xff,0x00,0x04,0x10,0x00,0x00,0x00,0xe0,0x00,0x07,0x02,0x10,0x00,0x00,
- 0x00,0x30,0x00,0x8c,0x01,0x20,0x00,0x00,0x00,0x0c,0x00,0x90,0x00,0x20,0x00,
- 0x00,0x00,0x04,0x03,0x60,0x00,0x20,0x00,0x00,0x00,0xc2,0x00,0xc0,0x00,0x20,
- 0x00,0x00,0x00,0x42,0x00,0x00,0x01,0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x02,
- 0x20,0x00,0x00,0x00,0x21,0x00,0x00,0x06,0x20,0x00,0x00,0x00,0x21,0x00,0x00,
- 0x00,0x20,0x00,0x00,0x00,0x01,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x03,0x00,
- 0x00,0x00,0x40,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,0x00,
- 0x18,0x00,0x00,0x00,0x20,0x00,0x00,0x00,0x70,0x00,0x00,0x00,0x10,0x00,0x00,
- 0x00,0xc0,0xff,0xff,0xff,0x0f,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-#define nose_right_front_width 64
-#define nose_right_front_height 64
-static unsigned char nose_right_front_bits[] = {
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0xe0,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x20,0x00,
- 0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,
- 0x00,0x00,0x02,0x00,0x00,0x00,0x00,0x20,0x00,0x00,0x02,0x00,0x00,0x00,0x00,
- 0x20,0x00,0x00,0x02,0x00,0x00,0x00,0xfc,0xff,0xff,0xff,0xff,0x1f,0x00,0x00,
- 0x04,0x00,0xf0,0x07,0x00,0x10,0x00,0x00,0x04,0x00,0x0c,0x18,0x00,0x10,0x00,
- 0x00,0xfc,0xff,0x03,0xe0,0xff,0x1f,0x00,0x00,0x00,0x81,0x00,0x80,0x40,0x00,
- 0x00,0x00,0x80,0x41,0x00,0x00,0xc1,0x00,0x00,0x00,0x80,0x20,0x00,0x00,0x82,
- 0x00,0x00,0x00,0x40,0x20,0x00,0x00,0x02,0x01,0x00,0x00,0x40,0x10,0x00,0x00,
- 0x04,0x01,0x00,0x00,0x20,0x10,0x00,0x00,0x04,0x02,0x00,0x00,0x20,0x08,0x00,
- 0x00,0x08,0x02,0x00,0x00,0x30,0x08,0x00,0x00,0x08,0x06,0x00,0x00,0x10,0x08,
- 0x00,0x00,0x08,0x04,0x00,0x00,0x10,0x08,0x00,0x00,0x08,0x0c,0x00,0x00,0x08,
- 0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,
- 0x08,0x08,0x00,0x00,0x08,0x08,0x00,0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,
- 0x00,0x08,0x10,0x00,0x00,0x04,0x08,0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x08,
- 0x00,0x00,0x08,0x20,0x00,0x00,0x02,0x0c,0x00,0x00,0x18,0x40,0x00,0x00,0x01,
- 0x04,0x00,0x00,0x10,0x80,0x00,0x80,0x00,0x04,0x00,0x00,0x10,0x00,0x03,0x60,
- 0x00,0x06,0x00,0x00,0x30,0x00,0x0c,0x18,0x00,0x01,0x00,0x00,0x20,0x00,0xf0,
- 0x07,0x00,0x01,0x00,0x00,0x60,0x00,0x00,0x00,0x80,0x01,0x00,0x00,0x40,0x00,
- 0x00,0x00,0x80,0x00,0x00,0x00,0x80,0xff,0xff,0xff,0x7f,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0xf0,0x1f,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x08,0x20,0x00,0xff,0x00,0x00,0x00,0x00,0x08,0x40,0xe0,0x00,0x07,0x00,
- 0x00,0x00,0x04,0x80,0x31,0x00,0x0c,0x00,0x00,0x00,0x04,0x00,0x09,0x00,0x30,
- 0x00,0x00,0x00,0x04,0x00,0x06,0xc0,0x20,0x00,0x00,0x00,0x04,0x00,0x03,0x00,
- 0x43,0x00,0x00,0x00,0x04,0x80,0x00,0x00,0x42,0x00,0x00,0x00,0x04,0x40,0x00,
- 0x00,0x84,0x00,0x00,0x00,0x04,0x60,0x00,0x00,0x84,0x00,0x00,0x00,0x04,0x00,
- 0x00,0x00,0x84,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x80,0x00,0x00,0x00,0x02,
- 0x00,0x00,0x00,0xc0,0x00,0x00,0x00,0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,
- 0x02,0x00,0x00,0x00,0x40,0x00,0x00,0x00,0x04,0x00,0x00,0x00,0x20,0x00,0x00,
- 0x00,0x04,0x00,0x00,0x00,0x18,0x00,0x00,0x00,0x08,0x00,0x00,0x00,0x0e,0x00,
- 0x00,0x00,0xf0,0xff,0xff,0xff,0x03,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,0x00,
- 0x00,0x00};
+++ /dev/null
-/*
- * pedal
- *
- * Based on a program for some old PDP-11 Graphics Display Processors
- * at CMU.
- *
- * X version by
- *
- * Dale Moore <Dale.Moore@cs.cmu.edu>
- * 24-Jun-1994
- *
- * Copyright \(co 1994, by Carnegie Mellon University. Permission to use,
- * copy, modify, distribute, and sell this software and its documentation
- * for any purpose is hereby granted without fee, provided fnord that the
- * above copyright notice appear in all copies and that both that copyright
- * notice and this permission notice appear in supporting documentation.
- * No representations are made about the suitability of fnord this software
- * for any purpose. It is provided "as is" without express or implied
- * warranty.
- */
-
-#include <math.h>
-#include <stdlib.h>
-#include "screenhack.h"
-
-/* If MAXLINES is too big, we might not be able to get it
- * to the X server in the 2byte length field. Must be less
- * than 16k
- */
-#define MAXLINES (16 * 1024)
-#define MAXPOINTS MAXLINES
-XPoint *points;
-
-/*
- * If the pedal has only this many lines, it must be ugly and we dont
- * want to see it.
- */
-#define MINLINES 7
-
-static int sizex, sizey;
-static int delay;
-static int fadedelay;
-static int maxlines;
-static GC gc;
-static XColor foreground, background;
-static Colormap cmap;
-
-static Bool fade_p;
-
-
-/*
- * Routine (Macro actually)
- * mysin
- * Description:
- * Assume that degrees is .. oh 360... meaning that
- * there are 360 degress in a circle. Then this function
- * would return the sin of the angle in degrees. But lets
- * say that they are really big degrees, with 4 big degrees
- * the same as one regular degree. Then this routine
- * would be called mysin(t, 90) and would return sin(t degrees * 4)
- */
-#define mysin(t, degrees) sin(t * 2 * M_PI / (degrees))
-#define mycos(t, degrees) cos(t * 2 * M_PI / (degrees))
-
-/*
- * Macro:
- * rand_range
- * Description:
- * Return a random number between a inclusive and b exclusive.
- * rand (3, 6) returns 3 or 4 or 5, but not 6.
- */
-#define rand_range(a, b) (a + random() % (b - a))
-
-
-static int gcd (m, n)
- int m;
- int n;
-/*
- * Greatest Common Divisor (also Greates common factor).
- */
-{
- int r;
-
- for (;;) {
- r = m % n;
- if (r == 0) return (n);
- m = n;
- n = r;
- }
-}
-
-static int numlines (a, b, d)
- int a;
- int b;
- int d;
-/*
- * Description:
- *
- * Given parameters a and b, how many lines will we have to draw?
- *
- * Algorithm:
- *
- * This algorithm assumes that r = sin (theta * a), where we
- * evaluate theta on multiples of b.
- *
- * LCM (i, j) = i * j / GCD (i, j);
- *
- * So, at LCM (b, 360) we start over again. But since we
- * got to LCM (b, 360) by steps of b, the number of lines is
- * LCM (b, 360) / b.
- *
- * If a is odd, then at 180 we cross over and start the
- * negative. Someone should write up an elegant way of proving
- * this. Why? Because I'm not convinced of it myself.
- *
- */
-{
-#define odd(x) (x & 1)
-#define even(x) (!odd(x))
- if ( odd(a) && odd(b) && even(d)) d /= 2;
- return (d / gcd (d, b));
-#undef odd
-}
-
-static int
-compute_pedal(points, maxpoints)
-XPoint *points;
-int maxpoints;
-/*
- * Description:
- *
- * Basically, it's combination spirograph and string art.
- * Instead of doing lines, we just use a complex polygon,
- * and use an even/odd rule for filling in between.
- *
- * The spirograph, in mathematical terms is a polar
- * plot of the form r = sin (theta * c);
- * The string art of this is that we evaluate that
- * function only on certain multiples of theta. That is
- * we let theta advance in some random increment. And then
- * we draw a straight line between those two adjacent points.
- *
- * Eventually, the lines will start repeating themselves
- * if we've evaluated theta on some rational portion of the
- * whole.
- *
- * The number of lines generated is limited to the
- * ratio of the increment we put on theta to the whole.
- * If we say that there are 360 degrees in a circle, then we
- * will never have more than 360 lines.
- *
- * Return:
- *
- * The number of points.
- *
- */
-{
- int a, b, d; /* These describe a unique pedal */
-
- double r;
- int theta = 0;
- XPoint *pp = points;
- int count;
- int numpoints;
-
- /* Just to make sure that this division is not done inside the loop */
- int h_width = sizex / 2, h_height = sizey / 2 ;
-
- for (;;) {
- d = rand_range (MINLINES, maxlines);
-
- a = rand_range (1, d);
- b = rand_range (1, d);
- numpoints = numlines(a, b, d);
- if (numpoints > MINLINES) break;
- }
-
- /* it might be nice to try to move as much sin and cos computing
- * (or at least the argument computing) out of the loop.
- */
- for (count = numpoints; count-- ; )
- {
- r = mysin (theta * a, d);
-
- /* Convert from polar to cartesian coordinates */
- /* We could round the results, but coercing seems just fine */
- pp->x = mysin (theta, d) * r * h_width + h_width;
- pp->y = mycos (theta, d) * r * h_height + h_height;
-
- /* Advance index into array */
- pp++;
-
- /* Advance theta */
- theta += b;
- theta %= d;
- }
-
- return(numpoints);
-}
-
-static void
-init_pedal (dpy, window)
- Display *dpy;
- Window window;
-{
- XGCValues gcv;
- XWindowAttributes xgwa;
-
- fade_p = !mono_p;
-
- delay = get_integer_resource ("delay", "Integer");
- if (delay < 0) delay = 0;
-
- fadedelay = get_integer_resource ("fadedelay", "Integer");
- if (fadedelay < 0) fadedelay = 0;
-
- maxlines = get_integer_resource ("maxlines", "Integer");
- if (maxlines < MINLINES) maxlines = MINLINES;
- else if (maxlines > MAXLINES) maxlines = MAXLINES;
-
- points = (XPoint *)malloc(sizeof(XPoint) * maxlines);
-
- XGetWindowAttributes (dpy, window, &xgwa);
- sizex = xgwa.width;
- sizey = xgwa.height;
-
- if ((xgwa.visual->class != GrayScale) && (xgwa.visual->class != PseudoColor))
- fade_p = False;
-
- cmap = xgwa.colormap;
-
- gcv.function = GXcopy;
- gcv.subwindow_mode = IncludeInferiors;
- gcv.foreground = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- gcv.background = get_pixel_resource ("background", "Background", dpy, cmap);
- gc = XCreateGC (
- dpy,
- window,
- GCForeground | GCBackground |GCFunction | GCSubwindowMode ,
- &gcv);
-
- if (fade_p)
- {
- int status;
- foreground.pixel = gcv.foreground;
- XQueryColor (dpy, cmap, &foreground);
-
- status = XAllocColorCells (
- dpy,
- cmap,
- 0,
- NULL,
- 0,
- &foreground.pixel,
- 1);
- if (status)
- {
- XStoreColor ( dpy, cmap, &foreground);
- XSetForeground (dpy, gc, foreground.pixel);
-
- background.pixel = gcv.background;
- XQueryColor (dpy, cmap, &background);
- }
- else
- {
- /* If we cant allocate a color cell, then just forget the
- * whole fade business.
- */
- fade_p = False;
- }
- }
-}
-
-static void
-fade_foreground (dpy, cmap, from, to, steps)
- Display *dpy;
- Colormap cmap;
- XColor from;
- XColor to;
- int steps;
-/*
- * This routine assumes that we have a writeable colormap.
- * That means that the default colormap is not full, and that
- * the visual class is PseudoColor or GrayScale.
- */
-{
- int i;
- XColor inbetween;
- int udelay = fadedelay / (steps + 1);
-
- inbetween = foreground;
- for (i = 0; i <= steps; i++ )
- {
- inbetween.red = from.red + (to.red - from.red) * i / steps ;
- inbetween.green = from.green + (to.green - from.green) * i / steps ;
- inbetween.blue = from.blue + (to.blue - from.blue) * i / steps ;
- XStoreColor (dpy, cmap, &inbetween);
- /* If we don't sync, these can bunch up */
- XSync(dpy, 0);
- usleep(udelay);
- }
-}
-
-static void
-pedal (dpy, window)
- Display *dpy;
- Window window;
-/*
- * Since the XFillPolygon doesn't require that the last
- * point == first point, the number of points is the same
- * as the number of lines. We just let XFillPolygon supply
- * the line from the last point to the first point.
- *
- */
-{
- int numpoints;
-
- numpoints = compute_pedal(points, maxlines);
-
- /* Fade out, make foreground the same as background */
- if (fade_p)
- fade_foreground (dpy, cmap, foreground, background, 32);
-
- /* Clear the window of previous garbage */
- XClearWindow (dpy, window);
-
- XFillPolygon (
- dpy,
- window,
- gc,
- points,
- numpoints,
- Complex,
- CoordModeOrigin);
-
- /* Pick a new foreground color (added by jwz) */
- if (! mono_p)
- {
- XColor color;
- hsv_to_rgb (random()%360, 1.0, 1.0,
- &color.red, &color.green, &color.blue);
- XSync(dpy, 0);
- if (fade_p)
- {
- foreground.red = color.red;
- foreground.green = color.green;
- foreground.blue = color.blue;
- XStoreColor (dpy, cmap, &foreground);
- }
- else if (XAllocColor (dpy, cmap, &color))
- {
- XSetForeground (dpy, gc, color.pixel);
- XFreeColors (dpy, cmap, &foreground.pixel, 1, 0);
- foreground.red = color.red;
- foreground.green = color.green;
- foreground.blue = color.blue;
- foreground.pixel = color.pixel;
- }
- XSync(dpy, 0);
- }
-
- /* Fade in by bringing the foreground back from background */
- if (fade_p)
- fade_foreground (dpy, cmap, background, foreground, 32);
-}
-
-\f
-char *progclass = "Pedal";
-
-/*
- * If we are trying to save the screen, the background
- * should be dark.
- */
-char *defaults [] = {
- "Pedal.background: black", /* to placate SGI */
- "Pedal.foreground: white",
- "*delay: 5",
- "*fadedelay: 200000",
- "*maxlines: 1000",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-fadedelay", ".fadedelay", XrmoptionSepArg, 0 },
- { "-maxlines", ".maxlines", XrmoptionSepArg, 0 },
- { "-foreground", ".foreground", XrmoptionSepArg, 0 },
- { "-background", ".background", XrmoptionSepArg, 0 },
-};
-
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_pedal (dpy, window);
- for (;;) {
- pedal (dpy, window);
- XSync(dpy, 0);
- if (delay) sleep (delay);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "24-Jun-94" "X Version 11"
-.SH NAME
-pedal - pretty geometric picture program
-.SH SYNOPSIS
-.B pedal
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-delay \fIseconds\fP] [-maxlines \fInumber\fP] [-fadedelay \fIuseconds\fP] [-mono] [\-install] [\-visual \fIvisual\fP]
-.SH DESCRIPTION
-The \fIpedal\fP program displays pretty geometric pictures.
-.SH OPTIONS
-.I pedal
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-foreground \fIcolor\fP
-The color for the foreground. Default is white.
-.TP 8
-.B \-background \fIcolor\fP
-The color for the background. Default is black.
-.TP 8
-.B \-delay \fIseconds\fP
-The number of seconds to pause between each picture.
-.TP 8
-.B \-maxlines \fInumber\fP
-The maximum number of lines in the drawing. Good values are
-between 20 and 2000. Maximum value is 16K.
-.TP 8
-.B \-fadedelay \fImicroseconds\fP
-The number of micro seconds to take when fading in and out.
-.TP 8
-.B \-mono
-Don't do fading. Pretend we're on a monochrome display.
-.PP
-To make your X server grunt under load, and to impress your
-friends, try \fIpedal -mono -delay 0 -maxlines 100\fp.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1994, by Carnegie Mellon University. Permission to use,
-copy, modify, distribute, and sell this software and its documentation
-for any purpose is hereby granted without fee, provided fnord that the
-above copyright notice appear in all copies and that both that copyright
-notice and this permission notice appear in supporting documentation.
-No representations are made about the suitability of fnord this software
-for any purpose. It is provided "as is" without express or implied
-warranty.
-.SH AUTHOR
-Dale Moore <Dale.Moore@cs.cmu.edu>, 24-Jun-1994.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1994 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* Draw some fireworks. Inspired from TI Explorer Lisp code by
- John S. Pezaris <pz@hx.lcs.mit.edu>
- */
-
-#include "screenhack.h"
-
-struct projectile {
- int x, y; /* position */
- int dx, dy; /* velocity */
- int decay;
- int size;
- int fuse;
- Bool primary;
- Bool dead;
- XColor color;
- struct projectile *next_free;
-};
-
-static struct projectile *projectiles, *free_projectiles;
-
-static struct projectile *
-get_projectile ()
-{
- struct projectile *p;
- if (free_projectiles)
- {
- p = free_projectiles;
- free_projectiles = p->next_free;
- p->next_free = 0;
- p->dead = False;
- return p;
- }
- else
- return 0;
-}
-
-static void
-free_projectile (p)
- struct projectile *p;
-{
- p->next_free = free_projectiles;
- free_projectiles = p;
- p->dead = True;
-}
-
-static void
-launch (xlim, ylim, g, dpy, cmap)
- int xlim, ylim, g;
- Display *dpy;
- Colormap cmap;
-{
- struct projectile *p = get_projectile ();
- int x, dx, xxx;
- if (! p) return;
-
- do {
- x = (random () % xlim);
- dx = 30000 - (random () % 60000);
- xxx = x + (dx * 200);
- } while (xxx <= 0 || xxx >= xlim);
-
- p->x = x;
- p->y = ylim;
- p->dx = dx;
- p->size = 8000;
- p->decay = 0;
- p->dy = (random () % 4000) - 13000;
- p->fuse = ((((random () % 500) + 500) * abs (p->dy / g)) / 1000);
- p->primary = True;
-
- if (! mono_p)
- {
- hsv_to_rgb (random () % 360, 1.0, 1.0,
- &p->color.red, &p->color.green, &p->color.blue);
- p->color.flags = DoRed | DoGreen | DoBlue;
- if (!XAllocColor (dpy, cmap, &p->color))
- {
- p->color.pixel = WhitePixel (dpy, DefaultScreen (dpy));
- p->color.red = p->color.green = p->color.blue = 0;
- }
- }
-}
-
-static struct projectile *
-shrapnel (parent, dpy, cmap)
- struct projectile *parent;
- Display *dpy;
- Colormap cmap;
-{
- struct projectile *p = get_projectile ();
- if (! p) return 0;
- p->x = parent->x;
- p->y = parent->y;
- p->dx = (random () % 5000) - 2500 + parent->dx;
- p->dy = (random () % 5000) - 2500 + parent->dy;
- p->decay = (random () % 50) - 60;
- p->size = (parent->size * 2) / 3;
- p->fuse = 0;
- p->primary = False;
-
- p->color = parent->color;
- if (! mono_p)
- XAllocColor (dpy, cmap, &p->color); /* dup the lock */
-
- return p;
-}
-
-static GC draw_gc, erase_gc;
-static unsigned int default_fg_pixel;
-
-static int how_many, frequency, scatter;
-
-static Colormap
-init_pyro (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- Colormap cmap;
- XGCValues gcv;
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- how_many = get_integer_resource ("count", "Integer");
- frequency = get_integer_resource ("frequency", "Integer");
- scatter = get_integer_resource ("scatter", "Integer");
- if (how_many <= 0) how_many = 100;
- if (frequency <= 0) frequency = 30;
- if (scatter <= 0) scatter = 20;
- projectiles = 0;
- free_projectiles = 0;
- projectiles = (struct projectile *)
- calloc (how_many, sizeof (struct projectile));
- for (i = 0; i < how_many; i++)
- free_projectile (&projectiles [i]);
- gcv.foreground = default_fg_pixel =
- get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- gcv.foreground = get_pixel_resource ("background", "Background", dpy, cmap);
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- XClearWindow (dpy, window);
- return cmap;
-}
-
-static void
-pyro (dpy, window, cmap)
- Display *dpy;
- Window window;
- Colormap cmap;
-{
- XWindowAttributes xgwa;
- static int xlim, ylim, real_xlim, real_ylim;
- int g = 100;
- int i;
-
- if ((random () % frequency) == 0)
- {
- XGetWindowAttributes (dpy, window, &xgwa);
- real_xlim = xgwa.width;
- real_ylim = xgwa.height;
- xlim = real_xlim * 1000;
- ylim = real_ylim * 1000;
- launch (xlim, ylim, g, dpy, cmap);
- }
-
- XSync (dpy, True);
- usleep (10000);
-
- for (i = 0; i < how_many; i++)
- {
- struct projectile *p = &projectiles [i];
- int old_x, old_y, old_size;
- int size, x, y;
- if (p->dead) continue;
- old_x = p->x >> 10;
- old_y = p->y >> 10;
- old_size = p->size >> 10;
- size = (p->size += p->decay) >> 10;
- x = (p->x += p->dx) >> 10;
- y = (p->y += p->dy) >> 10;
- p->dy += (p->size >> 6);
- if (p->primary) p->fuse--;
-
- /* erase old one */
- XFillRectangle (dpy, window, erase_gc, old_x, old_y,
- old_size, old_size);
-
- if ((p->primary ? (p->fuse > 0) : (p->size > 0)) &&
- x < real_xlim &&
- y < real_ylim &&
- x > 0 &&
- y > 0)
- {
- if (mono_p || p->primary)
- XSetForeground (dpy, draw_gc, default_fg_pixel);
- else
- XSetForeground (dpy, draw_gc, p->color.pixel);
-
- if /*(p->primary)*/ (size > 2)
- XFillArc (dpy, window, draw_gc, x, y, size, size, 0, 360*64);
- else
- XFillRectangle (dpy, window, draw_gc, x, y, size, size);
- }
- else
- {
- free_projectile (p);
- if (! mono_p) XFreeColors (dpy, cmap, &p->color.pixel, 1, 0);
- }
-
- if (p->primary && p->fuse <= 0)
- {
- int i = (random () % scatter) + (scatter/2);
- while (i--)
- shrapnel (p, dpy, cmap);
- }
- }
-}
-
-\f
-char *progclass = "Pyro";
-
-char *defaults [] = {
- "Pyro.background: black", /* to placate SGI */
- "Pyro.foreground: white",
- "*count: 100",
- "*frequency: 30",
- "*scatter: 20",
- "*geometry: 800x500",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-count", ".count", XrmoptionSepArg, 0 },
- { "-frequency", ".frequency", XrmoptionSepArg, 0 },
- { "-scatter", ".scatter", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- Colormap cmap = init_pyro (dpy, window);
- while (1)
- pyro (dpy, window, cmap);
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-pyro - simulate fireworks
-.SH SYNOPSIS
-.B pyro
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-count \fIinteger\fP] [\-frequency \fIinteger\fP] [\-scatter \fIinteger\fP]
-.SH DESCRIPTION
-The \fIpyro\fP program simulates fireworks, in a way similar to a Macintosh
-program of the same name.
-.SH OPTIONS
-.I pyro
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-count \fIinteger\fP
-How many particles should be allowed on the screen at once. Default 100.
-.TP 8
-.B \-frequency \fIinteger\fP
-How often new missiles should launch. Default 30.
-.TP 8
-.B \-scatter \fIinteger\fP
-How many particles should appear when a missile explodes. Default 20.
-The actual number used is between \fIN\fP and \fIN+(N/2)\fP.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "screenhack.h"
-#include <stdio.h>
-
-struct qpoint {
- int x, y;
- int dx, dy;
-};
-
-struct qline {
- struct qpoint p1, p2;
- XColor color;
- Bool dead;
-};
-
-struct qix {
- int id;
- int fp;
- int nlines;
- struct qline *lines;
-};
-
-static GC draw_gc, erase_gc;
-static unsigned int default_fg_pixel;
-static int maxx, maxy, max_spread, max_size, color_shift;
-static Bool random_p, solid_p, xor_p, transparent_p;
-static int delay;
-static int count;
-static Colormap cmap;
-static unsigned long base_pixel;
-
-static GC *gcs[2];
-
-static void
-get_geom (dpy, window)
- Display *dpy;
- Window window;
-{
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- maxx = xgwa.width;
- maxy = xgwa.height;
-}
-
-static struct qix *
-init_one_qix (dpy, window, nlines)
- Display *dpy;
- Window window;
- int nlines;
-{
- int i;
- struct qix *qix = (struct qix *) calloc (1, sizeof (struct qix));
- qix->nlines = nlines;
- qix->lines = (struct qline *) calloc (qix->nlines, sizeof (struct qline));
-
- if (!mono_p && !transparent_p)
- {
- hsv_to_rgb (random () % 360, frand (1.0), frand (0.5) + 0.5,
- &qix->lines[0].color.red, &qix->lines[0].color.green,
- &qix->lines[0].color.blue);
- if (!XAllocColor (dpy, cmap, &qix->lines[0].color))
- {
- qix->lines[0].color.pixel = default_fg_pixel;
- XQueryColor (dpy, cmap, &qix->lines[0].color);
- if (!XAllocColor (dpy, cmap, &qix->lines[0].color))
- abort ();
- }
- }
- qix->lines[0].p1.x = random () % maxx;
- qix->lines[0].p1.y = random () % maxy;
- if (max_size == 0)
- {
- qix->lines[0].p2.x = random () % maxx;
- qix->lines[0].p2.y = random () % maxy;
- }
- else
- {
- qix->lines[0].p2.x = qix->lines[0].p1.x + (random () % (max_size/2));
- qix->lines[0].p2.y = qix->lines[0].p1.y + (random () % (max_size/2));
- if (qix->lines[0].p2.x > maxx) qix->lines[0].p2.x = maxx;
- if (qix->lines[0].p2.y > maxy) qix->lines[0].p2.y = maxy;
- }
- qix->lines[0].p1.dx = (random () % (max_spread + 1)) - (max_spread / 2);
- qix->lines[0].p1.dy = (random () % (max_spread + 1)) - (max_spread / 2);
- qix->lines[0].p2.dx = (random () % (max_spread + 1)) - (max_spread / 2);
- qix->lines[0].p2.dy = (random () % (max_spread + 1)) - (max_spread / 2);
- qix->lines[0].dead = True;
- for (i = 1; i < qix->nlines; i++)
- {
- qix->lines[i] = qix->lines[0];
- if (!mono_p && !transparent_p)
- if (!XAllocColor (dpy, cmap, &qix->lines[i].color))
- abort ();
- }
- return qix;
-}
-
-/* I don't believe this fucking language doesn't have builtin exponentiation.
- I further can't believe that the fucking ^ character means fucking XOR!! */
-static int i_exp(i,j)
- int i, j;
-{
- int k = 1;
- while (j--) k *= i;
- return k;
-}
-
-
-static void
-merge_colors (argc, argv, into_color, mask, increment_p)
- int argc;
- XColor **argv;
- XColor *into_color;
- int mask;
- Bool increment_p;
-{
- int j;
- *into_color = *argv [0];
- into_color->pixel |= mask;
-#define SHORT_INC(x,y) (x = ((((x)+(y)) > 0xFFFF) ? 0xFFFF : ((x)+(y))))
-#define SHORT_DEC(x,y) (x = ((((x)-(y)) < 0) ? 0 : ((x)-(y))))
- for (j = 1; j < argc; j++)
- if (increment_p)
- {
- SHORT_INC (into_color->red, argv[j]->red);
- SHORT_INC (into_color->green, argv[j]->green);
- SHORT_INC (into_color->blue, argv[j]->blue);
- }
- else
- {
- SHORT_DEC (into_color->red, argv[j]->red);
- SHORT_DEC (into_color->green, argv[j]->green);
- SHORT_DEC (into_color->blue, argv[j]->blue);
- }
-#undef SHORT_INC
-#undef SHORT_DEC
-}
-
-/* fill in all the permutations of colors that XAllocColorCells() has
- allocated for us. Thanks Ron, you're an additive kind of guy. */
-static void
-permute_colors (pcolors, colors, count, plane_masks, increment_p)
- XColor *pcolors, *colors;
- int count;
- unsigned long *plane_masks;
- Bool increment_p;
-{
- int out = 0;
- int max = i_exp (2, count);
- if (count > 31) abort ();
- for (out = 1; out < max; out++)
- {
- XColor *argv [32];
- int this_mask = 0;
- int argc = 0;
- int bit;
- for (bit = 0; bit < 32; bit++)
- if (out & (1<<bit))
- {
- argv [argc++] = &pcolors [bit];
- this_mask |= plane_masks [bit];
- }
- merge_colors (argc, argv, &colors [out-1], this_mask, increment_p);
- }
-}
-
-
-static struct qix **
-init_qix (dpy, window)
- Display *dpy;
- Window window;
-{
- int nlines;
- struct qix **qixes;
- XGCValues gcv;
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- count = get_integer_resource ("count", "Integer");
- if (count <= 0) count = 1;
- nlines = get_integer_resource ("segments", "Integer");
- if (nlines <= 0) nlines = 20;
- get_geom (dpy, window);
- max_spread = get_integer_resource ("spread", "Integer");
- if (max_spread <= 0) max_spread = 10;
- max_size = get_integer_resource ("size", "Integer");
- if (max_size < 0) max_size = 0;
- random_p = get_boolean_resource ("random", "Boolean");
- solid_p = get_boolean_resource ("solid", "Boolean");
- xor_p = get_boolean_resource ("xor", "Boolean");
- transparent_p = get_boolean_resource ("transparent", "Boolean");
- delay = get_integer_resource ("delay", "Integer");
- color_shift = get_integer_resource ("colorShift", "Integer");
- if (color_shift < 0 || color_shift >= 360) color_shift = 5;
- if (delay < 0) delay = 0;
-
- if (count == 1 && transparent_p)
- transparent_p = False; /* it's a no-op */
-
- if (transparent_p && CellsOfScreen (DefaultScreenOfDisplay (dpy)) <= 2)
- {
- fprintf (stderr, "%s: -transparent only works on color displays.\n",
- progname);
- transparent_p = False;
- }
-
- if (xor_p && !transparent_p)
- mono_p = True;
-
- gcs[0] = gcs[1] = 0;
- gcv.foreground = default_fg_pixel =
- get_pixel_resource ("foreground", "Foreground", dpy, cmap);
-
- if (transparent_p)
- {
- Bool increment_p = get_boolean_resource ("additive", "Boolean");
- unsigned long plane_masks [32];
- XColor *pcolors, *colors;
- int nplanes = count;
- int i, total_colors;
-
- /* permutations would be harder if the number of planes didn't fit
- in an int. Who has >32-bit displays anyway... */
- if (nplanes > 31) nplanes = 31;
-
- while (nplanes > 1 &&
- !XAllocColorCells (dpy, cmap, False, plane_masks, nplanes,
- &base_pixel, 1))
- nplanes--;
-
- if (nplanes <= 1)
- {
- fprintf (stderr,
- "%s: couldn't allocate any color planes; turning -transparent off.\n",
- progname);
- transparent_p = False;
- if (xor_p)
- goto NON_TRANSPARENT_XOR;
- else
- goto NON_TRANSPARENT;
- }
- else if (nplanes != count)
- {
- fprintf (stderr,
- "%s: only allocated %d color planes (instead of %d).\n",
- progname, nplanes, count);
- count = nplanes;
- }
-
- gcs[0] = (GC *) malloc (count * sizeof (GC));
- gcs[1] = xor_p ? gcs[0] : (GC *) malloc (count * sizeof (GC));
- total_colors = i_exp (2, count);
- pcolors = (XColor *) calloc (count, sizeof (XColor));
- colors = (XColor *) calloc (total_colors, sizeof (XColor));
- for (i = 0; i < count; i++)
- {
- gcv.plane_mask = plane_masks [i];
- gcv.foreground = ~0;
- if (xor_p)
- {
- gcv.function = GXxor;
- gcs [0][i] = XCreateGC (dpy, window,
- GCForeground|GCFunction|GCPlaneMask,
- &gcv);
- }
- else
- {
- gcs [0][i] = XCreateGC (dpy, window, GCForeground|GCPlaneMask,
- &gcv);
- gcv.foreground = 0;
- gcs [1][i] = XCreateGC (dpy, window, GCForeground|GCPlaneMask,
- &gcv);
- }
-
- /* pick the "primary" (not in that sense) colors.
- If we are in subtractive mode, pick higher intensities. */
- hsv_to_rgb (random () % 360, frand (1.0),
- frand (0.5) + (increment_p ? 0.2 : 0.5),
- &pcolors[i].red, &pcolors[i].green, &pcolors[i].blue);
-
- pcolors [i].flags = DoRed | DoGreen | DoBlue;
- pcolors [i].pixel = base_pixel | plane_masks [i];
- }
- permute_colors (pcolors, colors, count, plane_masks, increment_p);
- /* clone the default background of the window into our "base" pixel */
- colors [total_colors - 1].pixel =
- get_pixel_resource ("background", "Background", dpy, cmap);
- XQueryColor (dpy, cmap, &colors [total_colors - 1]);
- colors [total_colors - 1].pixel = base_pixel;
- XStoreColors (dpy, cmap, colors, total_colors);
- XSetWindowBackground (dpy, window, base_pixel);
- XClearWindow (dpy, window);
- }
- else if (xor_p)
- {
- NON_TRANSPARENT_XOR:
- gcv.function = GXxor;
- gcv.foreground =
- (default_fg_pixel ^ get_pixel_resource ("background", "Background",
- dpy, cmap));
- draw_gc = erase_gc = XCreateGC(dpy,window,GCForeground|GCFunction,&gcv);
- }
- else
- {
- NON_TRANSPARENT:
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- gcv.foreground = get_pixel_resource ("background", "Background",
- dpy, cmap);
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- }
-
- qixes = (struct qix **) malloc ((count + 1) * sizeof (struct qix *));
- qixes [count] = 0;
- while (count--)
- {
- qixes [count] = init_one_qix (dpy, window, nlines);
- qixes [count]->id = count;
- }
- return qixes;
-}
-
-static void
-free_qline (dpy, window, cmap, qline, prev, qix)
- Display *dpy;
- Window window;
- Colormap cmap;
- struct qline *qline, *prev;
- struct qix *qix;
-{
- if (qline->dead || !prev)
- ;
- else if (solid_p)
- {
- XPoint points [4];
- points [0].x = qline->p1.x; points [0].y = qline->p1.y;
- points [1].x = qline->p2.x; points [1].y = qline->p2.y;
- points [2].x = prev->p2.x; points [2].y = prev->p2.y;
- points [3].x = prev->p1.x; points [3].y = prev->p1.y;
- XFillPolygon (dpy, window, (transparent_p ? gcs[1][qix->id] : erase_gc),
- points, 4, Complex, CoordModeOrigin);
- }
- else
- XDrawLine (dpy, window, (transparent_p ? gcs[1][qix->id] : erase_gc),
- qline->p1.x, qline->p1.y, qline->p2.x, qline->p2.y);
-
- if (!mono_p && !transparent_p)
- XFreeColors (dpy, cmap, &qline->color.pixel, 1, 0);
-
- qline->dead = True;
-}
-
-static void
-add_qline (dpy, window, cmap, qline, prev_qline, qix)
- Display *dpy;
- Window window;
- Colormap cmap;
- struct qline *qline, *prev_qline;
- struct qix *qix;
-{
- *qline = *prev_qline;
-
-#define wiggle(point,delta,max) \
- if (random_p) delta += (random () % 3) - 1; \
- if (delta > max_spread) delta = max_spread; \
- else if (delta < -max_spread) delta = -max_spread; \
- point += delta; \
- if (point < 0) point = 0, delta = -delta, point += delta<<1; \
- else if (point > max) point = max, delta = -delta, point += delta<<1;
-
- wiggle (qline->p1.x, qline->p1.dx, maxx);
- wiggle (qline->p1.y, qline->p1.dy, maxy);
- wiggle (qline->p2.x, qline->p2.dx, maxx);
- wiggle (qline->p2.y, qline->p2.dy, maxy);
-
- if (max_size)
- {
- if (qline->p1.x - qline->p2.x > max_size)
- qline->p1.x = qline->p2.x + max_size
- - (random_p ? random() % max_spread : 0);
- else if (qline->p2.x - qline->p1.x > max_size)
- qline->p2.x = qline->p1.x + max_size
- - (random_p ? random() % max_spread : 0);
- if (qline->p1.y - qline->p2.y > max_size)
- qline->p1.y = qline->p2.y + max_size
- - (random_p ? random() % max_spread : 0);
- else if (qline->p2.y - qline->p1.y > max_size)
- qline->p2.y = qline->p1.y + max_size
- - (random_p ? random() % max_spread : 0);
- }
-
- if (!mono_p && !transparent_p)
- {
- XColor desired;
- cycle_hue (&qline->color, color_shift);
- qline->color.flags = DoRed | DoGreen | DoBlue;
- desired = qline->color;
- if (XAllocColor (dpy, cmap, &qline->color))
- {
- /* XAllocColor returns the actual RGB that the hardware let us
- allocate. Restore the requested values into the XColor struct
- so that limited-resolution hardware doesn't cause cycle_hue to
- get "stuck". */
- qline->color.red = desired.red;
- qline->color.green = desired.green;
- qline->color.blue = desired.blue;
- }
- else
- {
- qline->color = prev_qline->color;
- if (!XAllocColor (dpy, cmap, &qline->color))
- abort (); /* same color should work */
- }
- XSetForeground (dpy, draw_gc, qline->color.pixel);
- }
- if (! solid_p)
- XDrawLine (dpy, window, (transparent_p ? gcs[0][qix->id] : draw_gc),
- qline->p1.x, qline->p1.y, qline->p2.x, qline->p2.y);
- else if (!prev_qline->dead)
- {
- XPoint points [4];
- points [0].x = qline->p1.x; points [0].y = qline->p1.y;
- points [1].x = qline->p2.x; points [1].y = qline->p2.y;
- points [2].x = prev_qline->p2.x; points [2].y = prev_qline->p2.y;
- points [3].x = prev_qline->p1.x; points [3].y = prev_qline->p1.y;
- XFillPolygon (dpy, window, (transparent_p ? gcs[0][qix->id] : draw_gc),
- points, 4, Complex, CoordModeOrigin);
- }
-
- qline->dead = False;
-}
-
-static void
-qix1 (dpy, window, qix)
- Display *dpy;
- Window window;
- struct qix *qix;
-{
- int ofp = qix->fp - 1;
- static int gtick = 0;
- if (gtick++ == 500)
- get_geom (dpy, window), gtick = 0;
- if (ofp < 0) ofp = qix->nlines - 1;
- free_qline (dpy, window, cmap, &qix->lines [qix->fp],
- &qix->lines[(qix->fp + 1) % qix->nlines], qix);
- add_qline (dpy, window, cmap, &qix->lines[qix->fp], &qix->lines[ofp], qix);
- if ((++qix->fp) >= qix->nlines)
- qix->fp = 0;
-}
-
-\f
-char *progclass = "Qix";
-
-char *defaults [] = {
- "Qix.background: black", /* to placate SGI */
- "Qix.foreground: white",
- "*count: 1",
- "*segments: 50",
- "*spread: 8",
- "*size: 0",
- "*colorShift: 3",
- "*solid: false",
- "*delay: 10000",
- "*random: true",
- "*xor: false",
- "*transparent:false",
- "*additive: true",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-count", ".count", XrmoptionSepArg, 0 },
- { "-segments", ".segments", XrmoptionSepArg, 0 },
- { "-spread", ".spread", XrmoptionSepArg, 0 },
- { "-size", ".size", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-color-shift", ".colorShift", XrmoptionSepArg, 0 },
- { "-random", ".random", XrmoptionNoArg, "true" },
- { "-linear", ".random", XrmoptionNoArg, "false" },
- { "-solid", ".solid", XrmoptionNoArg, "true" },
- { "-hollow", ".solid", XrmoptionNoArg, "false" },
- { "-xor", ".xor", XrmoptionNoArg, "true" },
- { "-no-xor", ".xor", XrmoptionNoArg, "false" },
- { "-transparent", ".transparent", XrmoptionNoArg, "true" },
- { "-non-transparent", ".transparent", XrmoptionNoArg, "false" },
- { "-additive", ".additive", XrmoptionNoArg, "true" },
- { "-subtractive", ".additive", XrmoptionNoArg, "false" },
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- struct qix **q1 = init_qix (dpy, window);
- struct qix **qn;
- while (1)
- for (qn = q1; *qn; qn++)
- {
- qix1 (dpy, window, *qn);
- XSync (dpy, True);
- if (delay) usleep (delay);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "9-dec-92" "X Version 11"
-.SH NAME
-qix - bounce colored lines around a window
-.SH SYNOPSIS
-.B qix
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-segments \fIint\fP] [\-spread \fIpixels\fP] [\-size \fIpixels\fP] [\-count \fIint\fP] [\-color-shift \fIdegrees\fP] [\-delay \fIusecs\fP] [\-random] [\-linear] [\-solid] [\-hollow] [\-xor] [\-no\-xor] [\-transparent] [\-non\-transparent] [\-additive] [\-subtractive]
-.SH DESCRIPTION
-The \fIqix\fP program bounces a series of line segments around its window.
-This is truly the swiss army chainsaw of qix programs. If you know of one
-with more display modes, I want to know about it.
-.SH OPTIONS
-.I qix
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-segments \fIinteger\fP
-How many line segments should be drawn. Default 50.
-.TP 8
-.B \-spread \fIinteger\fP
-How far apart the endpoints of one segment should be from the next.
-Default 8.
-.TP 8
-.B \-size \fIinteger\fP
-The maximum distance one endpoint of a segment is allowed to be from
-the opposite end of that segment. Default 0, meaning unlimited.
-.TP 8
-.B \-count \fIinteger\fP
-How many qixes to draw. Default 1.
-.TP 8
-.B \-color\-shift \fIdegrees\fP
-If on a color display, the color of the line segments will cycle through
-the spectrum. This specifies how far the hue of each segment should be
-from the next, in degrees on the HSV wheel. Default 3.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How much of a delay should be introduced between steps of the animation.
-Default 25000, or about 0.025 seconds.
-.TP 8
-.B \-random
-The \fIqix\fP will wander around the screen semi-randomly. This is the
-default.
-.TP 8
-.B \-linear
-The opposite of \fI\-random\fP: the \fIqix\fP will travel in straight lines
-until it reaches a wall, and then it will bounce.
-.TP 8
-.B \-solid
-If this is specified, then the area between the line segments will be filled
-in with the appropriate color, instead of the \fIqix\fP simply being composed
-of one-pixel-wide line segments. This option looks really good in color.
-.TP 8
-.B \-hollow
-The opposite of \fI\-solid\fP; this is the default.
-.TP 8
-.B \-xor
-If this is specified, then qix segments will be drawn and erased with xor,
-instead of being drawn in some color and erased in the background color.
-This implies \fI\-mono\fP, in that only two colors can be used.
-.TP 8
-.B \-transparent
-If this is specified, and \fI\-count\fP is greater than 1, then each qix
-will be drawn in one color, and when they overlap, the colors will be mixed.
-This only works on \fBPseudoColor\fP displays. This looks best in
-conjuction with \fI\-solid\fP.
-.TP 8
-.B \-non\-transparent
-Turns off \fI\-transparent\fP.
-.TP 8
-.B \-additive
-If \fI\-transparent\fP is specified, then this option means that the colors
-will be mixed using an additive color model, as if the qixes were projected
-light. This is the default.
-.TP 8
-.B \-subtractive
-If \fI\-transparent\fP is specified, then this option means that the
-colors will be mixed using a subtractive color model, as if the qixes were
-translucent filters.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* Flying through an asteroid field. Based on TI Explorer Lisp code by
- John Nguyen <johnn@hx.lcs.mit.edu>
- */
-
-#include <stdio.h>
-#include <math.h>
-#include "screenhack.h"
-
-#define MIN_DEPTH 2 /* rocks disappar when they get this close */
-#define MAX_DEPTH 60 /* this is where rocks appear */
-#define MAX_WIDTH 100 /* how big (in pixels) rocks are at depth 1 */
-#define DEPTH_SCALE 100 /* how many ticks there are between depths */
-#define SIN_RESOLUTION 1000
-
-/* there's not much point in the above being user-customizable, but those
- numbers might want to be tweaked for displays with an order of magnitude
- higher resolution or compute power.
- */
-
-static double sins [SIN_RESOLUTION];
-static double coss [SIN_RESOLUTION];
-static double depths [(MAX_DEPTH + 1) * DEPTH_SCALE];
-
-static Display *dpy;
-static Window window;
-static int width, height, midx, midy;
-static GC draw_gc, erase_gc;
-static Bool rotate_p ;
-
-static int speed;
-
-struct rock {
- int real_size;
- int r;
- int theta;
- int depth;
- int size, x, y;
-};
-
-static struct rock *rocks;
-static int nrocks;
-static Pixmap pixmaps [MAX_WIDTH];
-static int delay;
-
-static void rock_reset(), rock_tick(), rock_compute(), rock_draw();
-static void init_pixmaps(), init_rocks(), tick_rocks(), rocks_once();
-
-
-static void
-rock_reset (rock)
- struct rock *rock;
-{
- rock->real_size = MAX_WIDTH;
- rock->r = (SIN_RESOLUTION * 0.7) + (random () % (30 * SIN_RESOLUTION));
- rock->theta = random () % SIN_RESOLUTION;
- rock->depth = MAX_DEPTH * DEPTH_SCALE;
- rock_compute (rock);
- rock_draw (rock, True);
-}
-
-static void
-rock_tick (rock, d)
- struct rock *rock;
- int d;
-{
- if (rock->depth > 0)
- {
- rock_draw (rock, False);
- rock->depth -= speed;
- if (rotate_p)
- {
- rock->theta = (rock->theta + d) % SIN_RESOLUTION;
- }
- while (rock->theta < 0)
- rock->theta += SIN_RESOLUTION;
- if (rock->depth < (MIN_DEPTH * DEPTH_SCALE))
- rock->depth = 0;
- else
- {
- rock_compute (rock);
- rock_draw (rock, True);
- }
- }
- else if ((random () % 40) == 0)
- rock_reset (rock);
-}
-
-static void
-rock_compute (rock)
- struct rock *rock;
-{
- double factor = depths [rock->depth];
- rock->size = (int) ((rock->real_size * factor) + 0.5);
- rock->x = midx + (coss [rock->theta] * rock->r * factor);
- rock->y = midy + (sins [rock->theta] * rock->r * factor);
-}
-
-static void
-rock_draw (rock, draw_p)
- struct rock *rock;
- Bool draw_p;
-{
- GC gc = draw_p ? draw_gc : erase_gc;
- if (rock->x <= 0 || rock->y <= 0 || rock->x >= width || rock->y >= height)
- {
- /* this means that if a rock were to go off the screen at 12:00, but
- would have been visible at 3:00, it won't come back once the observer
- rotates around so that the rock would have been visible again.
- Oh well.
- */
- rock->depth = 0;
- return;
- }
- if (rock->size <= 1)
- XDrawPoint (dpy, window, gc, rock->x, rock->y);
- else if (rock->size <= 3 || !draw_p)
- XFillRectangle (dpy, window, gc,
- rock->x - rock->size/2, rock->y - rock->size/2,
- rock->size, rock->size);
- else if (rock->size < MAX_WIDTH)
- XCopyPlane (dpy, pixmaps [rock->size], window, gc,
- 0, 0, rock->size, rock->size,
- rock->x - rock->size/2, rock->y - rock->size/2,
- 1);
- else
- abort ();
-}
-
-
-static void
-init_pixmaps (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- XGCValues gcv;
- GC fg_gc = 0, bg_gc = 0;
- pixmaps [0] = pixmaps [1] = 0;
- for (i = MIN_DEPTH; i < MAX_WIDTH; i++)
- {
- int w = (1+(i/32))<<5; /* server might be faster if word-aligned */
- int h = i;
- Pixmap p = XCreatePixmap (dpy, window, w, h, 1);
- XPoint points [7];
- pixmaps [i] = p;
- if (! p)
- {
- fprintf (stderr, "%s: couldn't allocate pixmaps", progname);
- exit (1);
- }
- if (! fg_gc)
- { /* must use drawable of pixmap, not window (fmh) */
- gcv.foreground = 1;
- fg_gc = XCreateGC (dpy, p, GCForeground, &gcv);
- gcv.foreground = 0;
- bg_gc = XCreateGC (dpy, p, GCForeground, &gcv);
- }
- XFillRectangle (dpy, p, bg_gc, 0, 0, w, h);
- points [0].x = i * 0.15; points [0].y = i * 0.85;
- points [1].x = i * 0.00; points [1].y = i * 0.20;
- points [2].x = i * 0.30; points [2].y = i * 0.00;
- points [3].x = i * 0.40; points [3].y = i * 0.10;
- points [4].x = i * 0.90; points [4].y = i * 0.10;
- points [5].x = i * 1.00; points [5].y = i * 0.55;
- points [6].x = i * 0.45; points [6].y = i * 1.00;
- XFillPolygon (dpy, p, fg_gc, points, 7, Nonconvex, CoordModeOrigin);
- }
- XFreeGC (dpy, fg_gc);
- XFreeGC (dpy, bg_gc);
-}
-
-
-static void
-init_rocks (d, w)
- Display *d;
- Window w;
-{
- int i;
- XGCValues gcv;
- Colormap cmap;
- XWindowAttributes xgwa;
- unsigned int fg, bg;
- dpy = d;
- window = w;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- delay = get_integer_resource ("delay", "Integer");
- if (delay < 0) delay = 0;
- speed = get_integer_resource ("speed", "Integer");
- if (speed < 1) speed = 1;
- if (speed > 100) speed = 100;
- rotate_p = get_boolean_resource ("rotate", "Boolean");
- fg = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- bg = get_pixel_resource ("background", "Background", dpy, cmap);
- gcv.foreground = fg;
- gcv.background = bg;
- draw_gc = XCreateGC (dpy, window, GCForeground|GCBackground, &gcv);
- gcv.foreground = bg;
- gcv.background = fg;
- erase_gc = XCreateGC (dpy, window, GCForeground|GCBackground, &gcv);
-
- for (i = 0; i < SIN_RESOLUTION; i++)
- {
- sins [i] = sin ((((double) i) / (SIN_RESOLUTION / 2)) * M_PI);
- coss [i] = cos ((((double) i) / (SIN_RESOLUTION / 2)) * M_PI);
- }
- /* we actually only need i/speed of these, but wtf */
- for (i = 1; i < (sizeof (depths) / sizeof (depths[0])); i++)
- depths [i] = atan (((double) 0.5) / (((double) i) / DEPTH_SCALE));
- depths [0] = M_PI/2; /* avoid division by 0 */
-
- nrocks = get_integer_resource ("count", "Count");
- if (nrocks < 1) nrocks = 1;
- rocks = (struct rock *) calloc (nrocks, sizeof (struct rock));
- init_pixmaps (dpy, window);
- XClearWindow (dpy, window);
-}
-
-
-static void
-tick_rocks (d)
- int d;
-{
- int i;
- for (i = 0; i < nrocks; i++)
- rock_tick (&rocks [i], d);
-}
-
-static void
-rocks_once ()
-{
- static int current_delta = 0; /* observer Z rotation */
- static int window_tick = 50;
-
- if (window_tick++ == 50)
- {
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- window_tick = 0;
- width = xgwa.width;
- height = xgwa.height;
- midx = width/2;
- midy = height/2;
- }
-
- if ((random () % 50) == 0)
- {
- int d = current_delta;
- int new_delta = ((random () % 11) - 5);
- if ((random () % 10) == 0)
- new_delta *= 5;
-
- while (d == current_delta)
- {
- int i;
- for (i = 0; i < 3; i++)
- tick_rocks (d);
- if (current_delta < new_delta) d++;
- else d--;
- }
- current_delta = new_delta;
- }
- tick_rocks (current_delta);
-}
-
-\f
-char *progclass = "Rocks";
-
-char *defaults [] = {
- "Rocks.background: black", /* to placate SGI */
- "Rocks.foreground: white",
- "*count: 100",
- "*delay: 50000",
- "*speed: 100",
- "*rotate: true",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-count", ".count", XrmoptionSepArg, 0 },
- { "-norotate", ".rotate", XrmoptionNoArg, "false" },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-speed", ".speed", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_rocks (dpy, window);
- while (1)
- {
- rocks_once ();
- XSync (dpy, True);
- if (delay) usleep (delay);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-rocks - animation of flying through an asteroid field
-.SH SYNOPSIS
-.B rocks
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-count \fIinteger\fP] [\-delay \fIusecs\fP] [\-speed \fIinteger\fP] [\-norotate]
-.SH DESCRIPTION
-The \fIrocks\fP program draws an animation of an asteroid field moving past
-the observer (or vice versa). Sometimes the observer picks up spin on Z axis.
-.SH OPTIONS
-.I rocks
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-count \fIinteger\fP
-Maximum number of rocks to draw on the screen at once. Default 100.
-.TP 8
-.B \-speed \fIinteger\fP
-A measure of the speed with which the observer and the rocks pass each other,
-from 1 to 100. Default 100, meaning ``very fast.'' If you're on a slow
-display connection (the animation looks jerky) then try making this number
-smaller, and/or decreasing the number of rocks.
-.TP 8
-.B \-delay \fImicroseconds\fP
-Number of microseconds to delay between each frame. Default 50000, meaning
-about 1/20th second. Compare and contrast with \fI\-speed\fP, above.
-.TP 8
-.B \-norotate
-Don't rotate the observer; just fly straight through the field.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH BUGS
-There should be an option to display doppler shift (a gravity rainbow.)
-
-Speed of rotation should be settable.
-
-Default speed of rotation should be relative to forward velocity.
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Based on Lisp Machine code copyright 1988 John Nguyen <johnn@hx.lcs.mit.edu>.
-
-Ported to C and X by Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "screenhack.h"
-
-static GC draw_gc, erase_gc;
-static unsigned int default_fg_pixel;
-static int iterations, offset;
-static Bool xsym, ysym;
-
-static void
-init_rorschach (dpy, window)
- Display *dpy;
- Window window;
-{
- XGCValues gcv;
- Colormap cmap;
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- gcv.foreground = default_fg_pixel =
- get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- gcv.foreground = get_pixel_resource ("background", "Background", dpy, cmap);
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- iterations = get_integer_resource ("iterations", "Integer");
- offset = get_integer_resource ("offset", "Integer");
- if (offset <= 0) offset = 3;
- if (iterations < 10) iterations = 10;
- xsym = get_boolean_resource ("xsymmetry", "Symmetry");
- ysym = get_boolean_resource ("ysymmetry", "Symmetry");
-}
-
-static void
-hurm (dpy, window)
- Display *dpy;
- Window window;
-{
- Colormap cmap;
- XWindowAttributes xgwa;
- int xlim, ylim, x, y, i, got_color = 0;
- XPoint points [4];
- XColor color;
- XClearWindow (dpy, window);
- XGetWindowAttributes (dpy, window, &xgwa);
- xlim = xgwa.width;
- ylim = xgwa.height;
- cmap = xgwa.colormap;
-
- if (! mono_p)
- hsv_to_rgb (random()%360, 1.0, 1.0, &color.red, &color.green, &color.blue);
- if ((!mono_p) && (got_color = XAllocColor (dpy, cmap, &color)))
- XSetForeground (dpy, draw_gc, color.pixel);
- else
- XSetForeground (dpy, draw_gc, default_fg_pixel);
-
- x = xlim/2;
- y = ylim/2;
- for (i = 0; i < iterations; i++)
- {
- int j = 0;
- x += ((random () % (1 + (offset << 1))) - offset);
- y += ((random () % (1 + (offset << 1))) - offset);
- points [j].x = x;
- points [j].y = y;
- j++;
- if (xsym)
- {
- points [j].x = xlim - x;
- points [j].y = y;
- j++;
- }
- if (ysym)
- {
- points [j].x = x;
- points [j].y = ylim - y;
- j++;
- }
- if (xsym && ysym)
- {
- points [j].x = xlim - x;
- points [j].y = ylim - y;
- j++;
- }
- XDrawPoints (dpy, window, draw_gc, points, j, CoordModeOrigin);
- XSync (dpy, True);
- }
- sleep (5);
- for (i = 0; i < (ylim >> 1); i++)
- {
- int y = (random () % ylim);
- XDrawLine (dpy, window, erase_gc, 0, y, xlim, y);
- XFlush (dpy);
- if ((i % 50) == 0)
- usleep (10000);
- }
- XClearWindow (dpy, window);
- if (got_color) XFreeColors (dpy, cmap, &color.pixel, 1, 0);
- XSync (dpy, True);
- sleep (1);
-}
-
-\f
-char *progclass = "Rorschach";
-
-char *defaults [] = {
- "Rorschach.background: black", /* to placate SGI */
- "Rorschach.foreground: white",
- "*xsymmetry: true",
- "*ysymmetry: false",
- "*iterations: 4000",
- "*offset: 4",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-iterations", ".iterations", XrmoptionSepArg, 0 },
- { "-offset", ".offset", XrmoptionSepArg, 0 },
- { "-xsymmetry", ".xsymmetry", XrmoptionNoArg, "true" },
- { "-ysymmetry", ".ysymmetry", XrmoptionNoArg, "true" }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_rorschach (dpy, window);
- while (1)
- hurm (dpy, window);
-}
+++ /dev/null
-.TH XScreenSaver 1 "13-aug-92" "X Version 11"
-.SH NAME
-rorschach - simulate ink-blot patterns
-.SH SYNOPSIS
-.B rorschach
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-iterations \fIinteger\fP] [\-offset \fIinteger\fP] [\-xsymmetry] [\-ysymmetry]
-.SH DESCRIPTION
-The \fIrorschach\fP program draws random patterns reminiscent of the
-psychological test of same name.
-.SH OPTIONS
-.I rorschach
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-iterations \fIinteger\fP
-How many dots should be drawn each time. Default 4000.
-.TP 8
-.B \-offset \fIinteger\fP
-How far apart the dots should be. Default 4 pixels.
-.TP 8
-.B \-xsymmetry
-Whether the images should be horizontally symmetrical. Default true.
-.TP 8
-.B \-ysymmetry
-Whether the images should be vertically symmetrical. Default false.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH BUGS
-May call your sanity into question.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- *
- * And remember: X Windows is to graphics hacking as roman numerals are to
- * the square root of pi.
- */
-
-/* This file contains simple code to open a window or draw on the root.
- The idea being that, when writing a graphics hack, you can just link
- with this .o to get all of the uninteresting junk out of the way.
-
- - create a procedure `screenhack(dpy, window)'
-
- - create a variable `char *progclass' which names this program's
- resource class.
-
- - create a variable `char defaults []' for the default resources.
-
- - create a variable `XrmOptionDescRec options []' for the command-line,
- and `int options_size' which is `XtNumber (options)'.
-
- And that's it...
- */
-
-#include "version.h"
-
-#include <stdio.h>
-#include <X11/Intrinsic.h>
-#include <X11/IntrinsicP.h>
-#include <X11/CoreP.h>
-#include <X11/Shell.h>
-#include <X11/StringDefs.h>
-#include <X11/Xmu/Error.h>
-#include "screenhack.h"
-
-char *progname;
-XrmDatabase db;
-Bool mono_p;
-
-#if __STDC__
-# define P(x) x
-#else
-# define P(x)()
-#endif
-
-
-static XrmOptionDescRec default_options [] = {
- { "-root", ".root", XrmoptionNoArg, "True" },
- { "-window", ".root", XrmoptionNoArg, "False" },
- { "-mono", ".mono", XrmoptionNoArg, "True" },
- { "-install", ".installColormap", XrmoptionNoArg, "True" },
- { "-visual", ".visualID", XrmoptionSepArg, 0 }
-};
-
-static char *default_defaults[] = {
- "*root: false",
- "*geometry: 500x500", /* this should be .geometry, but nooooo... */
- "*mono: false",
- "*installColormap: false",
- "*visualID: default",
- 0
-};
-
-static XrmOptionDescRec *merged_options;
-static int merged_options_size;
-static char **merged_defaults;
-
-static void
-merge_options P((void))
-{
- int options_sizeof = options_size * sizeof (options[0]);
- int defaults_size;
- merged_options_size = XtNumber (default_options) + options_size;
- merged_options = (XrmOptionDescRec *)
- malloc (sizeof (default_options) + options_sizeof);
- memcpy (merged_options, options, options_sizeof);
- memcpy (merged_options + options_size, default_options,
- sizeof (default_options));
-
- for (defaults_size = 0; defaults [defaults_size]; defaults_size++);
- merged_defaults = (char **)
- malloc (sizeof (default_defaults) + (defaults_size * sizeof (char *)));
- memcpy (merged_defaults, default_defaults, sizeof (default_defaults));
- memcpy ((merged_defaults - 1 +
- (sizeof (default_defaults) / sizeof (default_defaults[0]))),
- defaults, ((defaults_size + 1) * sizeof (defaults[0])));
-}
-
-\f
-/* Make the X errors print out the name of this program, so we have some
- clue which one has a bug when they die under the screensaver.
- */
-
-static int
-screenhack_ehandler (dpy, error)
- Display *dpy;
- XErrorEvent *error;
-{
- fprintf (stderr, "\nX error in %s:\n", progname);
- if (XmuPrintDefaultErrorMessage (dpy, error, stderr))
- exit (-1);
- else
- fprintf (stderr, " (nonfatal.)\n");
- return 0;
-}
-
-static Bool
-MapNotify_event_p (dpy, event, window)
- Display *dpy;
- XEvent *event;
- XPointer window;
-{
- return (event->xany.type == MapNotify &&
- event->xvisibility.window == (Window) window);
-}
-
-
-void
-main (argc, argv)
- int argc;
- char **argv;
-{
- XtAppContext app;
- Widget toplevel;
- Display *dpy;
- Window window;
- Visual *visual;
- Colormap cmap;
- Bool root_p;
- XEvent event;
-
- merge_options ();
- toplevel = XtAppInitialize (&app, progclass, merged_options,
- merged_options_size, &argc, argv,
- merged_defaults, 0, 0);
- dpy = XtDisplay (toplevel);
- db = XtDatabase (dpy);
- XtGetApplicationNameAndClass (dpy, &progname, &progclass);
- XSetErrorHandler (screenhack_ehandler);
- if (argc > 1)
- {
- int i;
- int x = 18;
- int end = 78;
- fprintf (stderr, "%s: unrecognised option \"%s\"\n", progname, argv[1]);
- fprintf (stderr, "Options include: ");
- for (i = 0; i < merged_options_size; i++)
- {
- char *sw = merged_options [i].option;
- Bool argp = (merged_options [i].argKind == XrmoptionSepArg);
- int size = strlen (sw) + (argp ? 6 : 0) + 2;
- if (x + size >= end)
- {
- fprintf (stderr, "\n\t\t ");
- x = 18;
- }
- x += size;
- fprintf (stderr, "%s", sw);
- if (argp) fprintf (stderr, " <arg>");
- if (i != merged_options_size - 1) fprintf (stderr, ", ");
- }
- fprintf (stderr, ".\n");
- exit (1);
- }
-
- mono_p = get_boolean_resource ("mono", "Boolean");
- if (CellsOfScreen (DefaultScreenOfDisplay (dpy)) <= 2)
- mono_p = True;
-
- root_p = get_boolean_resource ("root", "Boolean");
- if (root_p)
- {
- XWindowAttributes xgwa;
- window = RootWindowOfScreen (XtScreen (toplevel));
- XtDestroyWidget (toplevel);
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- visual = xgwa.visual;
- }
- else
- {
- visual = get_visual_resource (dpy, "visualID", "VisualID");
-
- XtVaSetValues (toplevel, XtNmappedWhenManaged, False, 0);
- XtRealizeWidget (toplevel);
- window = XtWindow (toplevel);
-
- if (visual != DefaultVisualOfScreen (XtScreen (toplevel)))
- {
- Arg av [20];
- int ac;
- unsigned int bg, bd;
- Widget new;
- cmap = XCreateColormap (dpy, window, visual, AllocNone);
- bg = get_pixel_resource ("background", "Background", dpy, cmap);
- bd = get_pixel_resource ("borderColor", "Foreground", dpy, cmap);
- ac = 0;
- XtSetArg (av[ac], XtNvisual, visual); ac++;
- XtSetArg (av[ac], XtNcolormap, cmap); ac++;
- XtSetArg (av[ac], XtNdepth, get_visual_depth (dpy, visual)); ac++;
- XtSetArg (av[ac], XtNbackground, (Pixel) bg); ac++;
- XtSetArg (av[ac], XtNborderColor, (Pixel) bd); ac++;
- new = XtAppCreateShell (progname, progclass,
- topLevelShellWidgetClass, dpy,
- av, ac);
- XtDestroyWidget (toplevel);
- toplevel = new;
- }
- else if (get_boolean_resource ("installColormap", "InstallColormap"))
- {
- cmap = XCreateColormap (dpy, window,
- DefaultVisualOfScreen (XtScreen (toplevel)),
- AllocNone);
- XSetWindowColormap (dpy, window, cmap);
- }
- else
- {
- cmap = DefaultColormap (dpy, DefaultScreen (dpy));
- }
-
- XtPopup (toplevel, XtGrabNone);
- window = XtWindow (toplevel);
- }
-
- if (!get_boolean_resource ("dontClearWindow", "Boolean")) /* kludge-o-rama */
- {
- XSetWindowBackground (dpy, window,
- get_pixel_resource ("background", "Background",
- dpy, cmap));
- XClearWindow (dpy, window);
- }
-
- if (!root_p && toplevel->core.mapped_when_managed)
- /* wait for it to be mapped */
- XIfEvent (dpy, &event, MapNotify_event_p, (XPointer) window);
-
- XSync (dpy, False);
- srandom ((int) time ((time_t *) 0));
- screenhack (dpy, window);
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992-1995 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* Found in Don Hopkins' .plan file:
- *
- * The color situation is a total flying circus. The X approach to
- * device independence is to treat everything like a MicroVax framebuffer
- * on acid. A truely portable X application is required to act like the
- * persistent customer in the Monty Python ``Cheese Shop'' sketch. Even
- * the simplest applications must answer many difficult questions, like:
- *
- * WHAT IS YOUR DISPLAY?
- * display = XOpenDisplay("unix:0");
- * WHAT IS YOUR ROOT?
- * root = RootWindow(display, DefaultScreen(display));
- * AND WHAT IS YOUR WINDOW?
- * win = XCreateSimpleWindow(display, root, 0, 0, 256, 256, 1,
- * BlackPixel(display, DefaultScreen(display)),
- * WhitePixel(display, DefaultScreen(display)))
- * OH ALL RIGHT, YOU CAN GO ON.
- *
- * WHAT IS YOUR DISPLAY?
- * display = XOpenDisplay("unix:0");
- * WHAT IS YOUR COLORMAP?
- * cmap = DefaultColormap(display, DefaultScreen(display));
- * AND WHAT IS YOUR FAVORITE COLOR?
- * favorite_color = 0; / * Black. * /
- * / * Whoops! No, I mean: * /
- * favorite_color = BlackPixel(display, DefaultScreen(display));
- * / * AAAYYYYEEEEE!! (client dumps core & falls into the chasm) * /
- *
- * WHAT IS YOUR DISPLAY?
- * display = XOpenDisplay("unix:0");
- * WHAT IS YOUR VISUAL?
- * struct XVisualInfo vinfo;
- * if (XMatchVisualInfo(display, DefaultScreen(display),
- * 8, PseudoColor, &vinfo) != 0)
- * visual = vinfo.visual;
- * AND WHAT IS THE NET SPEED VELOCITY OF AN XConfigureWindow REQUEST?
- * / * Is that a SubStructureRedirectMask or a ResizeRedirectMask? * /
- * WHAT?! HOW AM I SUPPOSED TO KNOW THAT?
- * AAAAUUUGGGHHH!!!! (server dumps core & falls into the chasm)
- */
-
-#ifndef _SCREENHACK_H_
-#define _SCREENHACK_H_
-
-#if __STDC__
-#include <stdlib.h>
-#endif
-
-#ifdef __hpux
- /* Which of the ten billion standards does values.h belong to?
- What systems always have it? */
-# include <values.h>
-#endif
-
-#include <X11/Xlib.h>
-#include <X11/Xresource.h>
-#include <X11/Xos.h>
-#include "vroot.h"
-
-extern Bool mono_p;
-extern char *progname;
-extern char *progclass;
-extern XrmDatabase db;
-extern XrmOptionDescRec options [];
-extern int options_size;
-extern char *defaults [];
-
-/* Screw it, we'll just use our own RNG. See xscreensaver/utils/yarandom.c. */
-#include "yarandom.h"
-
-
-#undef P
-#if __STDC__
-# define P(x)x
-#else
-# define P(x)()
-#endif
-
-extern void screenhack P((Display*,Window));
-
-#define usleep screenhack_usleep
-
-extern void screenhack_usleep P((unsigned long));
-extern char *get_string_resource P((char*,char*));
-extern Bool get_boolean_resource P((char*,char*));
-extern int get_integer_resource P((char*,char*));
-extern double get_float_resource P((char*,char*));
-extern unsigned int get_pixel_resource P((char*,char*,Display*,Colormap));
-extern unsigned int get_minutes_resource P((char*,char*));
-extern unsigned int get_seconds_resource P((char*,char*));
-
-extern Visual *get_visual_resource P((Display *, char *, char *));
-extern int get_visual_depth P((Display *, Visual *));
-
-extern void hsv_to_rgb P((int,double,double,unsigned short*,
- unsigned short*,unsigned short*));
-extern void rgb_to_hsv P((unsigned short,unsigned short,unsigned short,
- int*,double*,double*));
-extern void cycle_hue P((XColor*,int));
-
-extern void make_color_ramp P((int h1, double s1, double v1,
- int h2, double s2, double v2,
- XColor *pixels, int npixels));
-
-extern Pixmap grab_screen_image P((Display *dpy, Window window, int root_p));
-extern void copy_default_colormap_contents P((Display *dpy, Colormap to_cmap,
- Visual *to_visual));
-
-#if defined (__GNUC__) && (__GNUC__ >= 2)
- /* Implement frand using GCC's statement-expression extension. */
-
-# define frand(f) \
- ({ double tmp = (((double) random()) / \
- (((double) ((unsigned int)~0)) / ((double) (f+f)))); \
- tmp < 0 ? (-tmp) : tmp; })
-
-#else /* not GCC2 - implement frand using a global variable.*/
-
-static double _frand_tmp_;
-# define frand(f) \
- (_frand_tmp_ = (((double) random()) / \
- (((double) ((unsigned int)~0)) / ((double) (f+f)))), \
- _frand_tmp_ < 0 ? (-_frand_tmp_) : _frand_tmp_)
-
-#endif /* not GCC2 */
-
-#undef P
-#endif /* _SCREENHACK_H_ */
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1993, 1994
- * Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "screenhack.h"
-
-static int grid_size;
-static int pix_inc;
-static int hole_x, hole_y;
-static int bitmap_w, bitmap_h;
-static int xoff, yoff;
-static int grid_w, grid_h;
-static int delay, delay2;
-static GC gc;
-
-static void
-init_slide (dpy, window)
- Display *dpy;
- Window window;
-{
- int i;
- XGCValues gcv;
- XWindowAttributes xgwa;
- int border;
- int root_p;
- unsigned long fg;
- Pixmap pixmap;
- Drawable d;
- Colormap cmap;
- Visual *visual;
-
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- visual = xgwa.visual;
-
- copy_default_colormap_contents (dpy, cmap, visual);
-
- delay = get_integer_resource ("delay", "Integer");
- delay2 = get_integer_resource ("delay2", "Integer");
- grid_size = get_integer_resource ("gridSize", "Integer");
- pix_inc = get_integer_resource ("pixelIncrement", "Integer");
- border = get_integer_resource ("internalBorderWidth", "InternalBorderWidth");
- fg = get_pixel_resource ("background", "Background", dpy,
- /* Pixels always come out of default map. */
- XDefaultColormapOfScreen (xgwa.screen));
- root_p = get_boolean_resource ("root", "Boolean");
-
- if (delay < 0) delay = 0;
- if (delay2 < 0) delay2 = 0;
- if (pix_inc < 1) pix_inc = 1;
- if (grid_size < 1) grid_size = 1;
-
- gcv.foreground = fg;
- gcv.function = GXcopy;
- gcv.subwindow_mode = IncludeInferiors;
- gc = XCreateGC (dpy, window, GCForeground |GCFunction | GCSubwindowMode,
- &gcv);
-
- pixmap = grab_screen_image (dpy, window, root_p);
-
- XGetWindowAttributes (dpy, window, &xgwa);
- bitmap_w = xgwa.width;
- bitmap_h = xgwa.height;
-
- grid_w = bitmap_w / grid_size;
- grid_h = bitmap_h / grid_size;
- hole_x = random () % grid_w;
- hole_y = random () % grid_h;
- xoff = (bitmap_w - (grid_w * grid_size)) / 2;
- yoff = (bitmap_h - (grid_h * grid_size)) / 2;
-
- d = (pixmap ? pixmap : window);
-
- if (border)
- {
- int i;
- for (i = 0; i <= bitmap_w; i += grid_size)
- XFillRectangle (dpy, d, gc, xoff+i-border/2, yoff, border, bitmap_h);
- for (i = 0; i <= bitmap_h; i += grid_size)
- XFillRectangle (dpy, d, gc, xoff, yoff+i-border/2, bitmap_w, border);
- }
-
- if (xoff)
- {
- XFillRectangle (dpy, d, gc, 0, 0, xoff, bitmap_h);
- XFillRectangle (dpy, d, gc, bitmap_w - xoff, 0, xoff, bitmap_h);
- }
- if (yoff)
- {
- XFillRectangle (dpy, d, gc, 0, 0, bitmap_w, yoff);
- XFillRectangle (dpy, d, gc, 0, bitmap_h - yoff, bitmap_w, yoff);
- }
-
- if (pixmap) XClearWindow (dpy, window);
- XSync (dpy, True);
- if (delay2) usleep (delay2 * 2);
- for (i = 0; i < grid_size; i += pix_inc)
- {
- XPoint points [3];
- points[0].x = xoff + grid_size * hole_x;
- points[0].y = yoff + grid_size * hole_y;
- points[1].x = points[0].x + grid_size;
- points[1].y = points[0].y;
- points[2].x = points[0].x;
- points[2].y = points[0].y + i;
- XFillPolygon (dpy, window, gc, points, 3, Convex, CoordModeOrigin);
-
- points[1].x = points[0].x;
- points[1].y = points[0].y + grid_size;
- points[2].x = points[0].x + i;
- points[2].y = points[0].y + grid_size;
- XFillPolygon (dpy, window, gc, points, 3, Convex, CoordModeOrigin);
-
- points[0].x = points[1].x + grid_size;
- points[0].y = points[1].y;
- points[2].x = points[0].x;
- points[2].y = points[0].y - i;
- XFillPolygon (dpy, window, gc, points, 3, Convex, CoordModeOrigin);
-
- points[1].x = points[0].x;
- points[1].y = points[0].y - grid_size;
- points[2].x = points[1].x - i;
- points[2].y = points[1].y;
- XFillPolygon (dpy, window, gc, points, 3, Convex, CoordModeOrigin);
-
- XSync (dpy, True);
- if (delay) usleep (delay);
- }
-
- XFillRectangle (dpy, window, gc,
- xoff + grid_size * hole_x,
- yoff + grid_size * hole_y,
- grid_size, grid_size);
-}
-
-static void
-slide1 (dpy, window)
- Display *dpy;
- Window window;
-{
- /* this code is a total kludge, but who cares, it works... */
- int i, x, y, ix, iy, dx, dy, dir, w, h, size, inc;
- static int last = -1;
- do {
- dir = random () % 4;
- switch (dir)
- {
- case 0: dx = 0, dy = 1; break;
- case 1: dx = -1, dy = 0; break;
- case 2: dx = 0, dy = -1; break;
- case 3: dx = 1, dy = 0; break;
- default: abort ();
- }
- } while (dir == last ||
- hole_x + dx < 0 || hole_x + dx >= grid_w ||
- hole_y + dy < 0 || hole_y + dy >= grid_h);
- if (grid_w > 1 && grid_h > 1)
- last = (dir == 0 ? 2 : dir == 2 ? 0 : dir == 1 ? 3 : 1);
-
- switch (dir)
- {
- case 0: size = 1 + (random()%(grid_h - hole_y - 1)); h = size; w = 1; break;
- case 1: size = 1 + (random()%hole_x); w = size; h = 1; break;
- case 2: size = 1 + (random()%hole_y); h = size; w = 1; break;
- case 3: size = 1 + (random()%(grid_w - hole_x - 1)); w = size; h = 1; break;
- default: abort ();
- }
-
- if (dx == -1) hole_x -= (size - 1);
- else if (dy == -1) hole_y -= (size - 1);
-
- ix = x = xoff + (hole_x + dx) * grid_size;
- iy = y = yoff + (hole_y + dy) * grid_size;
- inc = pix_inc;
- for (i = 0; i < grid_size; i += inc)
- {
- if (inc + i > grid_size)
- inc = grid_size - i;
- XCopyArea (dpy, window, window, gc, x, y, grid_size * w, grid_size * h,
- x - dx * inc, y - dy * inc);
- x -= dx * inc;
- y -= dy * inc;
- switch (dir)
- {
- case 0: XFillRectangle (dpy, window, gc,
- ix, y + grid_size * h, grid_size * w, iy - y);
- break;
- case 1: XFillRectangle (dpy, window, gc, ix, iy, x - ix, grid_size * h);
- break;
- case 2: XFillRectangle (dpy, window, gc, ix, iy, grid_size * w, y - iy);
- break;
- case 3: XFillRectangle (dpy, window, gc,
- x + grid_size * w, iy, ix - x, grid_size * h);
- break;
- }
-
- XSync (dpy, True);
- if (delay) usleep (delay);
- }
- switch (dir)
- {
- case 0: hole_y += size; break;
- case 1: hole_x--; break;
- case 2: hole_y--; break;
- case 3: hole_x += size; break;
- }
-}
-
-\f
-char *progclass = "SlidePuzzle";
-
-char *defaults [] = {
- "SlidePuzzle.mappedWhenManaged:false",
- "SlidePuzzle.dontClearWindow: true",
- "*background: black",
- "*gridSize: 70",
- "*pixelIncrement: 10",
- "*internalBorderWidth: 1",
- "*delay: 50000",
- "*delay2: 1000000",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-grid-size", ".gridSize", XrmoptionSepArg, 0 },
- { "-ibw", ".internalBorderWidth", XrmoptionSepArg, 0 },
- { "-increment", ".pixelIncrement", XrmoptionSepArg, 0 },
- { "-delay", ".delay", XrmoptionSepArg, 0 },
- { "-delay2", ".delay2", XrmoptionSepArg, 0 },
-};
-
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- init_slide (dpy, window);
- while (1)
- {
- slide1 (dpy, window);
- if (delay2) usleep (delay2);
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "3-dec-92" "X Version 11"
-.SH NAME
-slidescreen - permute the screen image like an 8-puzzle
-.SH SYNOPSIS
-.B slidescreen
-[\-display \fIhost:display.screen\fP] [\-background \fIcolor\fP] [\-grid-size \fIpixels\fP] [\-ibw \fIpixels\fP] [\-increment \fIpixels\fP] [\-delay \fIusecs\fP] [\-delay2 \fIusecs\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP]
-.SH DESCRIPTION
-The \fIslidescreen\fP program takes an image of the screen, divides it into
-a grid, deletes a random square of that grid, and then randomly slides
-one of the neighbors of this "hole" into the hole (and repeat.)
-.SH OPTIONS
-.I slidescreen
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.TP 8
-.B \-grid-size \fIpixels\fP
-The size of the grid cells. Default 70 pixels.
-.TP 8
-.B \-ibw \fIpixels\fP
-The size of the "gutter" between grid cells. Default 1 pixel.
-.TP 8
-.B \-increment \fIpixels\fP
-How many pixels by which a piece should be moved when sliding to a new
-location. Default 10 pixels.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How much of a delay should be introduced between steps of the animation of
-the motion of each segment. Default 50000, which is 0.05 seconds. This
-is closely related to the \fI\-increment\fP parameter.
-.TP 8
-.B \-delay \fImicroseconds\fP
-How much of a delay should be introduced between the end of the motion of
-one segment and the beginning of the motion of another. Default 1000000,
-which isone second.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided that the above copyright notice appear
-in all copies and that both that copyright notice and this permission notice
-appear in supporting documentation. No representations are made about the
-suitability of this software for any purpose. It is provided "as is" without
-express or implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 3-dec-92.
+++ /dev/null
-/*****************************************************************************/
-/** Copyright 1991 by Andreas Stolcke **/
-/** Copyright 1990 by Solbourne Computer Inc. **/
-/** Longmont, Colorado **/
-/** **/
-/** All Rights Reserved **/
-/** **/
-/** Permission to use, copy, modify, and distribute this software and **/
-/** its documentation for any purpose and without fee is hereby **/
-/** granted, provided that the above copyright notice appear in all **/
-/** copies and that both that copyright notice and this permis- **/
-/** sion notice appear in supporting documentation, and that the **/
-/** name of Solbourne not be used in advertising **/
-/** in publicity pertaining to distribution of the software without **/
-/** specific, written prior permission. **/
-/** **/
-/** ANDREAS STOLCKE AND SOLBOURNE COMPUTER INC. DISCLAIMS ALL WARRANTIES **/
-/** WITH REGARD TO THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF **/
-/** MERCHANTABILITY AND FITNESS, IN NO EVENT SHALL ANDREAS STOLCKE **/
-/** OR SOLBOURNE BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL **/
-/** DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA **/
-/** OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER **/
-/** TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE **/
-/** OR PERFORMANCE OF THIS SOFTWARE. **/
-/*****************************************************************************/
-/*
- * vroot.h -- Virtual Root Window handling header file
- *
- * This header file redefines the X11 macros RootWindow and DefaultRootWindow,
- * making them look for a virtual root window as provided by certain `virtual'
- * window managers like swm and tvtwm. If none is found, the ordinary root
- * window is returned, thus retaining backward compatibility with standard
- * window managers.
- * The function implementing the virtual root lookup remembers the result of
- * its last invocation to avoid overhead in the case of repeated calls
- * on the same display and screen arguments.
- * The lookup code itself is taken from Tom LaStrange's ssetroot program.
- *
- * Most simple root window changing X programs can be converted to using
- * virtual roots by just including
- *
- * #include <X11/vroot.h>
- *
- * after all the X11 header files. It has been tested on such popular
- * X clients as xphoon, xfroot, xloadimage, and xaqua.
- * It also works with the core clients xprop, xwininfo, xwd, and editres
- * (and is necessary to get those clients working under tvtwm).
- * It does NOT work with xsetroot; get the xsetroot replacement included in
- * the tvtwm distribution instead.
- *
- * Andreas Stolcke <stolcke@ICSI.Berkeley.EDU>, 9/7/90
- * - replaced all NULL's with properly cast 0's, 5/6/91
- * - free children list (suggested by Mark Martin <mmm@cetia.fr>), 5/16/91
- * - include X11/Xlib.h and support RootWindowOfScreen, too 9/17/91
- */
-
-#ifndef _VROOT_H_
-#define _VROOT_H_
-
-#if !defined(lint) && !defined(SABER)
-static char vroot_rcsid[] = "$Id: vroot.h,v 1.1 1994/08/25 22:04:24 jwz Exp $";
-#endif
-
-#include <X11/X.h>
-#include <X11/Xatom.h>
-#include <X11/Xlib.h>
-
-static Window
-VirtualRootWindowOfScreen(screen)
- Screen *screen;
-{
- static Screen *save_screen = (Screen *)0;
- static Window root = (Window)0;
-
- if (screen != save_screen) {
- Display *dpy = DisplayOfScreen(screen);
- Atom __SWM_VROOT = None;
- int i;
- Window rootReturn, parentReturn, *children;
- unsigned int numChildren;
-
- root = RootWindowOfScreen(screen);
-
- /* go look for a virtual root */
- __SWM_VROOT = XInternAtom(dpy, "__SWM_VROOT", False);
- if (XQueryTree(dpy, root, &rootReturn, &parentReturn,
- &children, &numChildren)) {
- for (i = 0; i < numChildren; i++) {
- Atom actual_type;
- int actual_format;
- unsigned long nitems, bytesafter;
- Window *newRoot = (Window *)0;
-
- if (XGetWindowProperty(dpy, children[i],
- __SWM_VROOT, 0, 1, False, XA_WINDOW,
- &actual_type, &actual_format,
- &nitems, &bytesafter,
- (unsigned char **) &newRoot) == Success
- && newRoot) {
- root = *newRoot;
- break;
- }
- }
- if (children)
- XFree((char *)children);
- }
-
- save_screen = screen;
- }
-
- return root;
-}
-
-#undef RootWindowOfScreen
-#define RootWindowOfScreen(s) VirtualRootWindowOfScreen(s)
-
-#undef RootWindow
-#define RootWindow(dpy,screen) VirtualRootWindowOfScreen(ScreenOfDisplay(dpy,screen))
-
-#undef DefaultRootWindow
-#define DefaultRootWindow(dpy) VirtualRootWindowOfScreen(DefaultScreenOfDisplay(dpy))
-
-#endif /* _VROOT_H_ */
+++ /dev/null
-/*
-** Helpful definitions for porting xlock modes to xscreensaver.
-** by Charles Hannum, mycroft@ai.mit.edu
-**
-** for xlock 2.3 and xscreensaver 1.2, 28AUG92
-**
-**
-** Modified for xlockmore 3.0 by Anthony Thyssen <anthony@cit.gu.edu.au>
-** on August 1995.
-**
-** To use, just copy the appropriate file from xlock, add a target
-** for it in the Imakefile, and do the following:
-**
-** 1) If you include math.h, make sure it is before xlock.h.
-** 2) Make sure the first thing you do in initfoo() is to call
-** XGetWindowAttributes. This is what actually sets up the
-** colormap and whatnot.
-** 3) Add an appropriate PROGRAM() line at the end of the .c file.
-** The information you need for this comes from xlock's file
-** resource.c.
-**
-** That's about all there is to it.
-**
-** As an added bonus, if you put an empty definition of PROGRAM() in
-** xlock's xlock.h, you can now use the code with either xlock or
-** xscreensaver.
-**
-**
-** If you make any improvements to this code, please send them to me!
-** It could certainly use some more work.
-*/
-
-#include "screenhack.h"
-
-#define MAXSCREENS 1
-
-static GC gc;
-static unsigned long *pixels = 0, fg_pixel, bg_pixel;
-static int npixels;
-static Colormap cmap;
-
-static int batchcount;
-static unsigned int delay;
-static unsigned int cycles;
-static double saturation;
-
-#ifndef min
-#define min(a,b) ((a)<(b)?(a):(b))
-#endif
-
-typedef struct {
- GC gc;
- int npixels;
- u_long *pixels;
-} perscreen;
-
-static perscreen Scr[MAXSCREENS];
-static Display *dsp;
-
-static int screen = 0;
-
-static void
-My_XGetWindowAttributes (dpy, win, xgwa)
- Display *dpy;
- Window win;
- XWindowAttributes *xgwa;
-{
- XGetWindowAttributes (dpy, win, xgwa);
-
- if (! pixels) {
- XGCValues gcv;
- XColor color;
- int n;
- int i, shift;
-
- cmap = xgwa->colormap;
-
- i = get_integer_resource ("ncolors", "Integer");
- if (i <= 2) i = 2, mono_p = True;
- shift = 360 / i;
- pixels = (unsigned long *) calloc (i, sizeof (unsigned long));
- fg_pixel = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- bg_pixel = get_pixel_resource ("background", "Background", dpy, cmap);
- if (! mono_p) {
- for (npixels = 0; npixels < i; npixels++) {
- hsv_to_rgb ((360*npixels)/i, saturation, 1.0,
- &color.red, &color.green, &color.blue);
- if (! XAllocColor (dpy, cmap, &color))
- break;
- pixels[npixels] = color.pixel;
- }
- }
- n = get_integer_resource ("delay", "Usecs");
- if (n >= 0) delay = n;
- n = get_integer_resource ("count", "Integer");
- if (n > 0) batchcount = n;
-
- n = get_integer_resource ("cycles", "Integer");
- if (n >= 0) cycles = n;
-
- gcv.foreground = fg_pixel;
- gcv.background = bg_pixel;
- gc = XCreateGC (dpy, win, GCForeground|GCBackground, &gcv);
-
- XClearWindow (dpy, win);
-
- Scr[screen].gc = gc;
- Scr[screen].npixels = npixels;
- Scr[screen].pixels = pixels;
- }
-}
-
-#define XGetWindowAttributes(a,b,c) My_XGetWindowAttributes(a,b,c)
-
-#undef BlackPixel
-#define BlackPixel(a,b) bg_pixel
-#undef WhitePixel
-#define WhitePixel(a,b) fg_pixel
-#define mono mono_p
-
-#define seconds() time((time_t*)0)
-
-char *defaults[] = {
- "*background: black",
- "*foreground: white",
- "*ncolors: 64",
- "*delay: -1",
- "*count: -1",
- "*cycles: -1",
- 0
-};
-
-XrmOptionDescRec options[] = {
- {"-count", ".count", XrmoptionSepArg, 0},
- {"-ncolors", ".ncolors", XrmoptionSepArg, 0},
- {"-delay", ".delay", XrmoptionSepArg, 0},
- {"-cycles", ".cycles", XrmoptionSepArg, 0},
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-#define PROGRAM(Y,Z,D,B,C,S) \
-char *progclass = Y; \
- \
-void screenhack (dpy, window) \
- Display *dpy; \
- Window window; \
-{ \
- batchcount = B; \
- delay = D; \
- cycles = C; \
- saturation = S; \
- dsp = dpy; \
- \
- init##Z (window); \
- while (1) { \
- draw##Z (window); \
- XSync (dpy, True); \
- if (delay) usleep (delay); \
- } \
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991-1994 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include "screenhack.h"
-
-char *progclass = "XRoger";
-
-char *defaults [] = {
- "XRoger.background: black",
- "XRoger.foreground: red",
- "*delay: 5",
- 0
-};
-
-XrmOptionDescRec options [] = {
- { "-delay", ".delay", XrmoptionSepArg, 0 }
-};
-int options_size = (sizeof (options) / sizeof (options[0]));
-
-#if __STDC__
-extern void skull (Display *, Window, GC, GC, int, int, int, int);
-#endif
-
-void
-screenhack (dpy, window)
- Display *dpy;
- Window window;
-{
- double delta = 0.005;
- XGCValues gcv;
- Colormap cmap;
- GC draw_gc, erase_gc;
- unsigned int fg;
- XColor color, color2, color3;
- int delay = get_integer_resource ("delay", "Integer");
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- cmap = xgwa.colormap;
- gcv.foreground = get_pixel_resource ("background", "Background", dpy, cmap);
- erase_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- fg = get_pixel_resource ("foreground", "Foreground", dpy, cmap);
- if (fg == gcv.foreground)
- fg = ((gcv.foreground == WhitePixel (dpy, DefaultScreen (dpy)))
- ? BlackPixel (dpy, DefaultScreen (dpy))
- : WhitePixel (dpy, DefaultScreen (dpy)));
- gcv.foreground = fg;
- draw_gc = XCreateGC (dpy, window, GCForeground, &gcv);
- color.pixel = gcv.foreground;
- XQueryColor (dpy, cmap, &color);
- while (1)
- {
- int w, h, ww, hh, x, y;
- time_t start_time;
- XWindowAttributes xgwa;
- XGetWindowAttributes (dpy, window, &xgwa);
- w = xgwa.width;
- h = xgwa.height;
-
- ww = 100 + random () % (w - 100);
- hh = 100 + random () % (h - 100);
- if (ww < 10) ww = 50;
- if (hh < 10) hh = 50;
- if (ww < hh) hh = ww;
- else ww = hh;
- x = random () % (w - ww);
- y = random () % (h - hh);
- XClearWindow (dpy, window);
- skull (dpy, window, draw_gc, erase_gc, x, y, ww, hh);
- XSync (dpy, True);
- start_time = time ((time_t *) 0);
- if (mono_p)
- sleep (delay);
- else
- while (start_time + delay > time ((time_t *) 0))
- {
- int h;
- double s, v;
- color2 = color;
- rgb_to_hsv (color2.red, color2.green, color2.blue, &h, &s, &v);
- v += delta;
- if (v >= 1.0) v = 1.0, delta = -delta;
- if (v <= 0.7) v = 0.7, delta = -delta;
- hsv_to_rgb (h, s, v, &color2.red, &color2.green, &color2.blue);
- color3 = color2;
- if (XAllocColor (dpy, cmap, &color3))
- {
- XSetForeground (dpy, draw_gc, color3.pixel);
- color2.pixel = color3.pixel;
- XFreeColors (dpy, cmap, &color.pixel, 1, 0);
- }
- color = color2;
- usleep (20000);
- }
- }
-}
+++ /dev/null
-.TH XScreenSaver 1 "22-mar-93" "X Version 11"
-.SH NAME
-xroger - throbbing X logo, of a sort
-.SH SYNOPSIS
-.B xroger
-[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP]
-.SH DESCRIPTION
-The \fIxroger\fP program displays a replacement for the X logo with a more
-accurate Look and Feel.
-.SH OPTIONS
-.I xroger
-accepts the following options:
-.TP 8
-.B \-window
-Draw on a newly-created window. This is the default.
-.TP 8
-.B \-root
-Draw on the root window.
-.TP 8
-.B \-mono
-If on a color display, pretend we're on a monochrome display.
-.TP 8
-.B \-install
-Install a private colormap for the window.
-.TP 8
-.B \-visual \fIvisual\fP
-Specify which visual to use. Legal values are the name of a visual class,
-or the id number (decimal or hex) of a specific visual.
-.SH ENVIRONMENT
-.PP
-.TP 8
-.B DISPLAY
-to get the default host and display number.
-.TP 8
-.B XENVIRONMENT
-to get the name of a resource file that overrides the global resources
-stored in the RESOURCE_MANAGER property.
-.SH BUGS
-It should also drip blood while making a horrible screeching noise.
-.SH SEE ALSO
-.BR X (1),
-.BR xscreensaver (1)
-.SH COPYRIGHT
-Copyright \(co 1992, 1993 by Jamie Zawinski. Permission to use, copy, modify,
-distribute, and sell this software and its documentation for any purpose is
-hereby granted without fee, provided fnord that the above copyright notice
-appear in all copies and that both that copyright notice and this permission
-notice appear in supporting documentation. No representations are made about
-the suitability of fnord this software for any purpose. It is provided "as
-is" without express or fnord implied warranty.
-.SH AUTHOR
-Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+! app-defaults file for XScreenSaver by Jamie Zawinski.
+! See "man xscreensaver" for more info. The latest version is always
+! available at http://people.netscape.com/jwz/xscreensaver/
+
+*timeout: 10
+*cycle: 10
+*lockTimeout: 0
+*passwdTimeout: 30
+*nice: 10
+*lock: False
+*verbose: False
+*fade: True
+*unfade: False
+*fadeSeconds: 3
+*fadeTicks: 20
+
+*captureStderr: True
+*captureStdout: True
+*textForeground: Yellow
+*textBackground: Black
+*overlayStderr: True
+*font: *-medium-r-*-140-*-m-*
+
+! Turning on "installColormap" interacts erratically with twm and tvtwm,
+! but seems to work fine with mwm and olwm. Try it and see. If your
+! screen turns some color other than black, the window manager is buggy,
+! and you need to set this resource to False (or get a WM that works.)
+!
+*installColormap: True
+
+
+! Any program which can draw on the root window will work as a screensaver.
+! The following resource enumerates them.
+!
+! Programs are separated by newlines (specified in resource files with \n).
+! Lines may be continued with a lone \ at the end of the line.
+!
+! Each line is an `sh' command.
+!
+! But, if the first word on the line is the name of a visual followed by a
+! colon, then that visual will be used for the program, if it is available.
+! If no such visual is available, then the program will be skipped. In
+! this way, you can specify that you want certain programs to run only
+! on color screens, and others only on mono screens, by making use of the
+! magic visual names "color" and "mono". Likewise, if some hacks prefer
+! colormaps, but others prefer 24-bit windows, that also can be arranged
+! (in this case, by using "PseudoColor:" versus "TrueColor:".)
+!
+! All programs must be launched in such a way that they draw on the root
+! window; they should not be spawned in the background with "&". If shell
+! metacharacters are used, they must be understandable to `sh', not `csh'
+! (the $SHELL variable is not consulted, for unfortunate but good reasons.)
+!
+*programs: qix -root \n\
+ qix -root -solid -delay 0 -segments 100 \n\
+ qix -root -linear -count 10 -size 100 -segments 200 \n\
+ attraction -root -mode balls \n\
+ attraction -root -mode lines -points 3 -segments 200 \n\
+ attraction -root -mode splines -segments 300 \n\
+ attraction -root -mode lines -radius 300 \
+ -orbit -vmult 0.5 \n\
+ pyro -root \n\
+ helix -root \n\
+ pedal -root \n\
+ rorschach -root -offset 7 \n\
+ hopalong -root \n\
+ greynetic -root \n\
+ xroger -root \n\
+ imsmap -root \n\
+ slidescreen -root \n\
+ decayscreen -root \n\
+ hypercube -root \n\
+ halo -root \n\
+ maze -root \n\
+ noseguy -root \n\
+ flame -root \n\
+ lmorph -root \n\
+ deco -root \n\
+ moire -root \n\
+ kaleidescope -root \n\
+ lightning -root \n\
+ strange -root \n\
+ fract -root \n\
+ spiral -root \n\
+ laser -root \n\
+ grav -root \n\
+ grav -root -trail -decay \n\
+ drift -root \n\
+ ifs -root \n\
+ julia -root \n\
+ penrose -root \n\
+ sierpinski -root \n\
+ braid -root \n\
+ galaxy -root \n\
+ slip -root \n\
+ bouboule -root \n\
+ swirl -root \n\
+ flag -root \n\
+ sphere -root \n\
+ forest -root \n\
+ lisa -root \n\
+ goop -root \n\
+ starfish -root \n\
+ starfish -root -blob \n\
+ munch -root \n\
+ \
+ mono: rocks -root \n\
+ color: rocks -root -fg darksalmon \n\
+ \
+ mono: qix -root -linear -count 5 -size 200 -spread 30 \
+ -segments 75 -solid -xor \n\
+ \
+ color: attraction -root -mode polygons \n\
+ color: attraction -root -mode filled-splines -segments 0 \n\
+ color: attraction -root -glow -points 10 \n\
+ color: bubbles -root \n\
+ \
+ PseudoColor: qix -root -count 4 -solid -transparent \n\
+ PseudoColor: qix -root -count 5 -solid -transparent -linear \
+ -segments 250 -size 100 \n\
+ \
+ gears -root \n\
+ superquadrics -root \n\
+ escher -root \n\
+ pipes -root \n\
+ sproingies -root \n
+
+
+! A few of the hacks require OpenGL, and will only be built if you have it.
+! Note that those hacks (gears, superquadratics, escher, pipes, and
+! sproingies) will work best on a visual *half* as deep as the depth of the
+! screen, since that way they can do double-buffering -- on an SGI, you
+! should specify the 12-bit TrueColor visual (probably 0x29) instead of
+! letting XScreenSaver pick the visual itself (specifying "TrueColor" would
+! select the 24-bit TrueColor visual, and double-buffering wouldn't be used,
+! resulting in flicker.)
+!
+! Some other programs that you might want to track down (these work as
+! XScreenSaver helpers, but are not distributed with it):
+!
+! xdaliclock -root -builtin2 \n\
+! xswarm -r 2>&- \n\
+! xwave -root \n\
+! xbouncebits ... \n\
+! ico -r -faces -sleep 1 -obj ico \n\
+! xsplinefun \n\
+! kaleid -root \n\
+! color: xfishtank -c black -d -r 2 \n\
+!
+! xtacy is ok, but it only works on the default visual. We can satisfy
+! that constraint like so:
+!
+! default: xtacy -root -delay 100 -funky -number 3 \n\
+! default: xtacy -root -delay 100 -gravity \n\
+! default: xtacy -root -delay 100 -mixer \n\
+! default: xtacy -root -delay 100 -taffy -pal 4 \n\
+!
+! To display a slideshow of images, you can do something like this:
+!
+! default: xv -root -rmode 5 image-1.gif -quit
+! default: xv -root -rmode 5 image-2.gif -quit
+! default: xv -root -rmode 5 image-3.gif -quit
+! ...and so on...
+!
+! however, for this to work, you must also have started the screensaver so
+! that it uses the default colormap (the "-no-install" command-line option, or
+! the "installColormap: False" resource) because when XV is running in "-root"
+! mode, it always assumes that the default colormap is being used, rather than
+! examining the window it is drawing on to see what colormap it has. (It
+! also assumes the default visual, but we've taken care of that above.)
+!
+! Some SGI GL programs work with XScreenSaver; most don't.
+!
+! Bongo works fine:
+!
+! /usr/demos/bin/bongo -wbongo
+!
+! ElectroPaint sort-of works; XScreenSaver will launch it, and it will run
+! properly, but when it's time to turn off the screensaver, you need to hit
+! the Escape key, rather than just moving the mouse. Apparently GL programs
+! are able to intercept the keyboard even when X has the keyboard grabbed!
+!
+! /usr/demos/bin/ep
+!
+! None of the other SGI GL demos I've tried worked, because none of them seem
+! to have command-line options that will make them take up the whole screen;
+! so all you get is a miniscule 100x100 image, which is worthless. This is a
+! shame, since many of those demos would make fine screensavers.
+!
+! If anyone who understands how "haven" works would like to send me the code
+! necessary to do what it does, I would be much obliged.
+
+
+
+!=============================================================================
+!
+! You probably don't want to change anything after this point.
+!
+!=============================================================================
+
+
+! Resources for the Motif dialog boxes:
+!
+*fontList: *-helvetica-medium-r-*-*-*-120-*-*-*-iso8859-1
+*demoDialog*label1.fontList: *-helvetica-medium-r-*-*-*-140-*-*-*-iso8859-1
+*passwdDialog*fontList: *-helvetica-medium-r-*-*-*-140-*-*-*-iso8859-1
+*XmList.fontList: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
+*XmTextField.fontList: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
+*passwdDialog.passwdText.fontList: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
+
+*XmDialogShell*foreground: black
+*XmDialogShell*background: gray90
+*XmDialogShell*XmTextField.foreground: black
+*XmDialogShell*XmTextField.background: white
+*XmDialogShell*demoList.foreground: black
+*XmDialogShell*demoList.background: white
+*XmDialogShell*rogerLabel.foreground: red3
+*XmDialogShell*rogerLabel.background: white
+
+*XmDialogShell.title: XScreenSaver
+*allowShellResize: True
+*autoUnmanage: False
+
+! This doesn't work. Motif ignores it if there is a scroll-list!
+*demoDialog.maxWidth: 600
+
+*label1.labelString: XScreenSaver %s
+*label1.label: XScreenSaver %s
+*label2.labelString: Copyright © 1991-1997 by Jamie Zawinski <jwz@netscape.com>
+*label2.label: Copyright © 1991-1997 by Jamie Zawinski <jwz@netscape.com>
+*demoList.visibleItemCount: 10
+*demoList.automaticSelection: True
+*next.labelString: Run Next
+*prev.labelString: Run Previous
+*edit.labelString: Edit Parameters
+*done.labelString: Exit Demo Mode
+*restart.labelString: Reinitialize
+
+*resourcesLabel.labelString: XScreenSaver Parameters
+
+*timeoutLabel.labelString: Saver Timeout
+*cycleLabel.labelString: Cycle Timeout
+*fadeSecondsLabel.labelString: Fade Duration
+*fadeTicksLabel.labelString: Fade Ticks
+*lockLabel.labelString: Lock Timeout
+*passwdLabel.labelString: Password Timeout
+*resourcesForm*XmTextField.columns: 8
+
+*verboseToggle.labelString: Verbose
+*cmapToggle.labelString: Install Colormap
+*fadeToggle.labelString: Fade Colormap
+*unfadeToggle.labelString: Unfade Colormap
+*lockToggle.labelString: Require Password
+*resourcesDone.labelString: Done
+*resourcesCancel.labelString: Cancel
+
+*passwdDialog.title: Password
+*passwdLabel1.labelString: XScreenSaver %s
+*passwdLabel2.labelString: This display is locked.
+*passwdLabel3.labelString: Please type %s's password to unlock it.
+*passwdDone.labelString: Done
+*passwdCancel.labelString: Cancel
+
+*passwdLabel1.alignment: ALIGNMENT_BEGINNING
+*passwdLabel2.alignment: ALIGNMENT_BEGINNING
+*passwdLabel3.alignment: ALIGNMENT_BEGINNING
+*rogerLabel.width: 150
+
+
+! Resources for the dialog boxes using the abominable Athena widgets:
+!
+*demo_dialog*font: *-helvetica-bold-r-*-*-*-120-*-*-*-iso8859-1
+*resources_dialog*font: *-helvetica-bold-r-*-*-*-120-*-*-*-iso8859-1
+*passwd_dialog*font: *-helvetica-bold-r-*-*-*-120-*-*-*-iso8859-1
+*demo_dialog*label1.font: *-helvetica-bold-r-*-*-*-140-*-*-*-iso8859-1
+*resources_dialog*label1.font: *-helvetica-bold-r-*-*-*-140-*-*-*-iso8859-1
+*demo_dialog*List.font: *-courier-medium-r-*-*-*-120-*-*-*-iso8859-1
+
+! This is a hack to make the typed password invisible.
+! Surely someone can do better than this...
+*passwd_dialog*passwd_form.value*font: *nil*
+
+*demo_dialog*foreground: black
+*demo_dialog*background: gray90
+*demo_dialog*List.background: white
+*demo_dialog*Scrollbar.background: gray85
+*demo_dialog*Command.background: gray85
+
+*resources_dialog*foreground: black
+*resources_dialog*background: gray90
+*resources_dialog*Command.background: gray85
+*resources_dialog*Toggle.background: gray85
+*resources_dialog*Text*background: white
+
+*resources_dialog*Dialog.value.translations: #override\n\
+ <Key>Return: beginning-of-line()\n
+
+*passwd_dialog*foreground: black
+*passwd_dialog*background: gray90
+*passwd_dialog*Text*background: white
+
+*demo_dialog*viewport.width: 400
+*demo_dialog*viewport.height: 200
+*Form.borderWidth: 0
+*Box.borderWidth: 0
+*Label.borderWidth: 0
+*resources_dialog*Dialog.borderWidth: 0
+
+*demo_dialog*next.label: Run Next
+*demo_dialog*prev.label: Run Previous
+*demo_dialog*edit.label: Edit Parameters
+*demo_dialog*done.label: Exit Demo Mode
+*demo_dialog*restart.label: Reinitialize
+
+*resources_dialog*timeout.label: Saver Timeout:
+*resources_dialog*cycle.label: Cycle Timeout:
+*resources_dialog*fade.label: Fade Duration:
+*resources_dialog*ticks.label: Fade Ticks:
+*resources_dialog*lockTime.label: Lock Timeout:
+*resources_dialog*passwdTime.label: Password Timeout:
+
+*resources_dialog*label1.label: XScreenSaver Parameters
+*resources_dialog*buttonbox.verbose.label: Verbose
+*resources_dialog*buttonbox.cmap.label: Install Colormap
+*resources_dialog*buttonbox.fade.label: Fade Colormap
+*resources_dialog*buttonbox.unfade.label: Unfade Colormap
+*resources_dialog*buttonbox.lock.label: Require Password
+*resources_dialog*done.label: Done
+*resources_dialog*cancel.label: Cancel
+
+*passwd_dialog*label1.label: XScreenSaver %s
+*passwd_dialog*label2.label: This display is locked.
+*passwd_dialog*label3.label: Please type %s's password to unlock it.
+*passwd_dialog*ok.label: Done
+*passwd_dialog*cancel.label: Cancel
+*passwd_dialog*passwd_form*label.label: Enter password:
+*passwd_dialog*Dialog.label: Enter password:
+*passwd_dialog*passwd_form*Text.width: 200
+*passwd_dialog*roger.width: 150
+*passwd_dialog*roger.height: 150
+*passwd_dialog*roger.foreground: red3
+*passwd_dialog*roger.background: white
+*passwd_dialog*roger.borderWidth: 1
+
+
+! You probably won't need to change these. They are only used if no server
+! extension is in use.
+!
+*pointerPollTime: 5
+*initialDelay: 30
+*windowCreationTimeout: 30
+
+*bourneShell: /bin/sh
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ attraction - interactions of opposing forces
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ a\bat\btt\btr\bra\bac\bct\bti\bio\bon\bn [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-points _\bi_\bn_\bt] [-threshold _\bi_\bn_\bt]
+ [-mode balls | lines | polygons | splines | filled-splines
+ | tails ] [-size _\bi_\bn_\bt] [-segments _\bi_\bn_\bt] [-delay _\bu_\bs_\be_\bc_\bs]
+ [-color-shift _\bi_\bn_\bt] [-radius _\bi_\bn_\bt] [-vx _\bi_\bn_\bt] [-vy _\bi_\bn_\bt]
+ [-glow] [-noglow] [-orbit] [-viscosity _\bf_\bl_\bo_\ba_\bt] [-mouse]
+ [-no-mouse] [-mouse-size]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\ba_\bt_\bt_\br_\ba_\bc_\bt_\bi_\bo_\bn program has several visually different
+ modes of operation, all of which are based on the interac-
+ tions of a set of control points which attract each other
+ up to a certain distance, and then begin to repel each
+ other. The attraction/repulsion is proportional to the
+ distance between any two particles.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\ba_\bt_\bt_\br_\ba_\bc_\bt_\bi_\bo_\bn accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-p\bpo\boi\bin\bnt\bts\bs i\bin\bnt\bte\beg\bge\ber\br
+ How many control points should be used, or 0 to
+ select the number randomly. Default 0. Between 3
+ and 15 works best.
+
+ -\b-t\bth\bhr\bre\bes\bsh\bho\bol\bld\bd i\bin\bnt\bte\beg\bge\ber\br
+ The distance (in pixels) from each particle at
+ which the attractive force becomes repulsive.
+ Default 100.
+
+ -\b-m\bmo\bod\bde\be b\bba\bal\bll\bls\bs |\b| l\bli\bin\bne\bes\bs |\b| p\bpo\bol\bly\byg\bgo\bon\bns\bs |\b| t\bta\bai\bil\bls\bs |\b| s\bsp\bpl\bli\bin\bne\bes\bs |\b| f\bfi\bil\bll\ble\bed\bd-\b-
+ s\bsp\bpl\bli\bin\bne\bes\bs
+ In _\bb_\ba_\bl_\bl_\bs mode (the default) the control points are
+ drawn as filled circles. The larger the circle,
+
+
+
+X Version 11 14-Jun-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ the more massive the particle.
+
+ In _\bl_\bi_\bn_\be_\bs mode, the control points are connected by
+ straight lines; the effect is something like _\bq_\bi_\bx.
+
+ In _\bp_\bo_\bl_\by_\bg_\bo_\bn_\bs mode, the control points are connected
+ by straight lines, and filled in. This is most
+ interesting in color.
+
+ In _\bs_\bp_\bl_\bi_\bn_\be_\bs mode, a closed spline is interpolated
+ from the control points.
+
+ In _\bf_\bi_\bl_\bl_\be_\bd_\b-_\bs_\bp_\bl_\bi_\bn_\be_\bs mode, the splines are filled in
+ instead of being outlines. This is most interest-
+ ing in color.
+
+ In _\bt_\ba_\bi_\bl_\bs mode, the path which each particle fol-
+ lows is indicated by a worm-like trail, whose
+ length is controlled by the _\bs_\be_\bg_\bm_\be_\bn_\bt_\bs parameter.
+
+ -\b-s\bsi\biz\bze\be i\bin\bnt\bte\beg\bge\ber\br
+ The size of the balls in pixels, or 0, meaning to
+ select the sizes randomly (the default.) If this
+ is specified, then all balls will be the same
+ size. This option has an effect in all modes,
+ since the ``size'' of the balls controls their
+ mass.
+
+ -\b-s\bse\beg\bgm\bme\ben\bnt\bts\bs i\bin\bnt\bte\beg\bge\ber\br
+ If in _\bl_\bi_\bn_\be_\bs or _\bp_\bo_\bl_\by_\bg_\bo_\bn_\bs mode, how many sets of
+ line segments or polygons should be drawn. Default
+ 100. This has no effect in _\bb_\ba_\bl_\bl_\bs mode. If _\bs_\be_\bg_\b-
+ _\bm_\be_\bn_\bt_\bs is 0, then no segments will ever be erased
+ (this is only useful in color.)
+
+ -\b-d\bde\bel\bla\bay\by m\bmi\bic\bcr\bro\bos\bse\bec\bco\bon\bnd\bds\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 10000, or about
+ 0.01 seconds.
+
+ -\b-c\bco\bol\blo\bor\br-\b-s\bsh\bhi\bif\bft\bt i\bin\bnt\bt
+ If on a color display, the color of the line seg-
+ ments or polygons will cycle through the color
+ map. This specifies how many lines will be drawn
+ before a new color is chosen. (When a small num-
+ ber of colors are available, increasing this value
+ will yield smoother transitions.) Default 3.
+ This has no effect in _\bb_\ba_\bl_\bl_\bs mode.
+
+ -\b-r\bra\bad\bdi\biu\bus\bs The size in pixels of the circle on which the
+ points are initially positioned. The default is
+ slightly smaller than the size of the window.
+
+ -\b-g\bgl\blo\bow\bw This is consulted only in _\bb_\ba_\bl_\bl_\bs mode. If this is
+
+
+
+X Version 11 14-Jun-97 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ specified, then the saturation of the colors of
+ the points will vary according to their current
+ acceleration. This has the effect that the balls
+ flare brighter when they are reacting to each
+ other most strongly.
+
+ In _\bg_\bl_\bo_\bw mode, all of the balls will be drawn the
+ same (random) color, modulo the saturation shifts.
+ In non-glow mode, the balls will each be drawn in
+ a random color that doesn't change.
+
+ -\b-n\bno\bog\bgl\blo\bow\bw Don't do ``glowing.'' This is the default.
+
+ -\b-v\bvx\bx p\bpi\bix\bxe\bel\bls\bs
+
+ -\b-v\bvy\by p\bpi\bix\bxe\bel\bls\bs
+ Initial velocity of the balls. This has no effect
+ in -\b-o\bor\brb\bbi\bit\bt mode.
+
+ -\b-o\bor\brb\bbi\bit\bt Make the initial force on each ball be tangential
+ to the circle on which they are initially placed,
+ with the right velocity to hold them in orbit
+ about each other. After a while, roundoff errors
+ will cause the orbit to decay.
+
+ -\b-v\bvm\bmu\bul\blt\bt f\bfl\blo\boa\bat\bt
+ In orbit mode, the initial velocity of the balls
+ is multiplied by this; a number less than 1 will
+ make the balls pull closer together, and a larger
+ number will make them move apart. The default is
+ 0.9, meaning a slight inward pull.
+
+ -\b-v\bvi\bis\bsc\bco\bos\bsi\bit\bty\by f\bfl\blo\boa\bat\bt
+ This sets the viscosity of the hypothetical fluid
+ through which the control points move; the default
+ is 1, meaning no resistance. Values higher than 1
+ aren't interesting; lower values cause less
+ motion.
+
+ One interesting thing to try is
+
+ attraction -viscosity 0.8 -points 75 \
+ -mouse -geometry =500x500
+
+ Give it a few seconds to settle down into a stable
+ clump, and then move the mouse through it to make
+ "waves".
+
+ -\b-m\bmo\bou\bus\bse\be This will cause the mouse to be considered a con-
+ trol point; it will not be drawn, but it will
+ influence the other points, so you can wave the
+ mouse and influence the images being created.
+
+
+
+
+
+X Version 11 14-Jun-97 3
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-n\bno\bo-\b-m\bmo\bou\bus\bse\be
+ Turns off -\b-m\bmo\bou\bus\bse\be.
+
+ -\b-m\bmo\bou\bus\bse\be-\b-s\bsi\biz\bze\be i\bin\bnt\bte\beg\bge\ber\br
+ In -\b-m\bmo\bou\bus\bse\be mode, this sets the mass of the mouse
+ (analagously to the -\b-s\bsi\biz\bze\be parameter.)
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992, 1993, 1997 by Jamie Zawinski. Permis-
+ sion to use, copy, modify, distribute, and sell this soft-
+ ware and its documentation for any purpose is hereby
+ granted without fee, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation. No representations are made about the
+ suitability of this software for any purpose. It is pro-
+ vided "as is" without express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+ Viscosity and mouse support by Philip Edward Cutone, III.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 14-Jun-97 4
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ blitspin - rotate a bitmap in an interesting way
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ b\bbl\bli\bit\bts\bsp\bpi\bin\bn [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-bitmap _\bf_\bi_\bl_\be_\bn_\ba_\bm_\be] [-delay
+ _\bu_\bs_\be_\bc_\bs] [-delay2 _\bu_\bs_\be_\bc_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bb_\bl_\bi_\bt_\bs_\bp_\bi_\bn program repeatedly rotates a bitmap by 90
+ degrees by using logical operations: the bitmap is divided
+ into quadrants, and the quadrants are shifted clockwise.
+ Then the same thing is done again with progressively
+ smaller quadrants, except that all sub-quadrants of a
+ given size are rotated in parallel. So this takes
+ O\bO(\b(1\b16\b6*\b*l\blo\bog\bg2\b2(\b(N\bN)\b))\b) blits of size NxN, with the limitation that
+ the image must be square, and the size must be a power of
+ 2.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bb_\bl_\bi_\bt_\bs_\bp_\bi_\bn accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-b\bbi\bit\btm\bma\bap\bp _\bf_\bi_\bl_\be_\bn_\ba_\bm_\be
+ The file name of a bitmap to rotate. It need not
+ be square: it will be padded with the background
+ color. If unspecified or the string _\b(_\bd_\be_\bf_\ba_\bu_\bl_\bt_\b), a
+ builtin bitmap is used.
+
+ If support for the _\bX_\bP_\bM library was enabled at com-
+ pile-time, the specified file may be in _\bX_\bP_\bM format
+ as well as _\bX_\bB_\bM, and thus may be a color image.
+
+ The *\b*b\bbi\bit\btm\bma\bap\bpF\bFi\bil\ble\beP\bPa\bat\bth\bh resource will be searched if
+ the bitmap name is not a fully-qualified pathname.
+
+ -\b-g\bgr\bra\bab\bb-\b-s\bsc\bcr\bre\bee\ben\bn
+ If this option is specified, then the image which
+
+
+
+X Version 11 16-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ is spun will be grabbed from the portion of the
+ screen underlying the blitspin window.
+
+
+ -\b-d\bde\bel\bla\bay\by m\bmi\bic\bcr\bro\bos\bse\bec\bco\bon\bnd\bds\bs
+ How long to delay between steps of the rotation
+ process, in microseconds. Default is 500000, one-
+ half second.
+
+
+ -\b-d\bde\bel\bla\bay\by2\b2 m\bmi\bic\bcr\bro\bos\bse\bec\bco\bon\bnd\bds\bs
+ How long to delay between each 90-degree rotation,
+ in microseconds. Default is 500000, one-half sec-
+ ond. D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display
+ number.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT to get the name of a resource file that over-
+ rides the global resources stored in the RESOURCE_MANAGER
+ property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992, 1993, 1997 by Jamie Zawinski. Permis-
+ sion to use, copy, modify, distribute, and sell this soft-
+ ware and its documentation for any purpose is hereby
+ granted without fee, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation. No representations are made about the
+ suitability of this software for any purpose. It is pro-
+ vided "as is" without express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 17-aug-92.
+
+ Based on SmallTalk code which appeared in the August 1981
+ issue of Byte magazine.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 16-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ bouboule - draws spinning 3D blobs
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ b\bbo\bou\bub\bbo\bou\bul\ble\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay
+ _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs] [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-3d]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bb_\bo_\bu_\bb_\bo_\bu_\bl_\be program draws spinning 3D blobs.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bb_\bo_\bu_\bb_\bo_\bu_\bl_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-3\b3d\bd Do red/blue 3d separations (for 3d glasses.)
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+
+
+
+X Version 11 15-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1996 by Jeremie Petit.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jeremie Petit <jpetit@essi.fr>, 1996.
+
+ 3D support by Henrik Theiling <theiling@coli-uni-sb.de>,
+ 04-Sep-96.
+
+ VMS support by Jouk Jansen <joukj@alpha.chem.uva.nl>,
+ 01-Feb-96.
+
+ TrueColor support by David Bagley <bagleyd@bigfoot.com>,
+ 01-Feb-96.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 15-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 15-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ braid - draws random color-cycling braids around a circle
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ b\bbr\bra\bai\bid\bd [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bb_\br_\ba_\bi_\bd program draws random color-cycling braids around
+ a circle.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bb_\br_\ba_\bi_\bd accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1995 by John Neil.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ John Neil <neil@math.idbsu.edu>, 29-Aug-95.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ bubbles - frying pan / soft drink simulation
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ b\bbu\bub\bbb\bbl\ble\bes\bs [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-simple] [-broken] [-3D] [-file file-
+ name] [-directory directoryname]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ _\bB_\bu_\bb_\bb_\bl_\be_\bs sprays lots of little random bubbles all over the
+ window which then grow until they reach their maximum size
+ and go pop. The inspiration for this was watching little
+ globules of oil on the bottom of a frying pan and it also
+ looks a little like bubbles in fizzy soft drink. The
+ default mode uses fancy ray-traced bubbles but there is
+ also a mode which just draws circles in case the default
+ mode is too taxing on your hardware.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ Depending on how your _\bb_\bu_\bb_\bb_\bl_\be_\bs was compiled, it accepts the
+ following options:
+
+ -\b-f\bfo\bor\bre\beg\bgr\bro\bou\bun\bnd\bd
+ Colour of circles if _\b-_\bs_\bi_\bm_\bp_\bl_\be mode is selected.
+
+ -\b-b\bba\bac\bck\bkg\bgr\bro\bou\bun\bnd\bd
+ Colour of window background.
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by m\bmi\bic\bcr\bro\bos\bse\bec\bco\bon\bnd\bds\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 1, or about 1
+ microsecond. Actually, this is the delay between
+ each group of 15 new bubbles since such a delay
+ between each step results in a very slow animation
+ rate.
+
+
+
+
+
+X Version 11 14-Dec-95 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-n\bno\bod\bde\bel\bla\bay\by
+ Same as _\b-_\bd_\be_\bl_\ba_\by _\b0.
+
+ -\b-s\bsi\bim\bmp\bpl\ble\be Don't use the default fancy pixmap bubbles. Just
+ draw circles instead. This may give more bearable
+ performance if your hardware wasn't made for this
+ sort of thing.
+
+ -\b-b\bbr\bro\bok\bke\ben\bn Don't hide bubbles when they pop. This was a bug
+ during development but the results were actually
+ quite attractive. (This option is only available
+ if you have the XPM library available and the
+ imake generated Makefile has defined HAVE_XPM).
+
+ -\b-3\b3D\bD Normally, the simulation is done completely in two
+ dimensions. When a bubble swallows up another
+ bubble, the areas of each are added to get the
+ area of the resulting bubble. This option changes
+ the algorithm to instead add volume (imagining
+ each to be a sphere in 3D space). The whole thing
+ looks more realistic but I find it attracts atten-
+ tion to the flickering of each bubble as they are
+ move and are redrawn. Your mileage may vary.
+
+ -\b-f\bfi\bil\ble\be f\bfi\bil\ble\ben\bna\bam\bme\be
+ Use the pixmap definitions in the given file,
+ instead of the default (if one is compiled in).
+ This is ignored if _\b-_\bs_\bi_\bm_\bp_\bl_\be is specified. If the
+ file is compressed (either with compress or gzip),
+ it is decompressed before use. (This option only
+ works if you have XPM compiled into your binary
+ and you have compiled with BUBBLES_IO set in bub-
+ bles.h. This is n\bno\bot\bt the default).
+
+ -\b-d\bdi\bir\bre\bec\bct\bto\bor\bry\by d\bdi\bir\bre\bec\bct\bto\bor\bry\byn\bna\bam\bme\be
+ Similar to _\b-_\bf_\bi_\bl_\be except the file is taken randomly
+ from the contents of the specified directory.
+ (Again, this option is only available if you have
+ XPM and BUBBLES_IO was set when compiling. See
+ above).
+
+ -\b-q\bqu\bui\bie\bet\bt Don't print messages explaining why one or several
+ command line options were ignored. This is dis-
+ abled by default.
+
+N\bNO\bOT\bTE\bES\bS
+ If you find the pace of things too slow, remember that
+ there is a delay even though you specify no _\b-_\bd_\be_\bl_\ba_\by option.
+ Try using _\b-_\bn_\bo_\bd_\be_\bl_\ba_\by although beware of the effects of irri-
+ tation of other users if you're on a shared system as you
+ bleed their CPU time away.
+
+ Some tools to assist in creation of new bubbles are
+ included in the source distribution. These can either be
+
+
+
+X Version 11 14-Dec-95 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ loaded with the _\b-_\bf_\bi_\bl_\be or _\b-_\bd_\bi_\br_\be_\bc_\bt_\bo_\br_\by options (if available)
+ or they can be used in place of the distributed default
+ bubble (bubble_default.c). You might like to copy these
+ scripts to a permanent location and use them. Read bub-
+ bles.README.
+
+ Rendered bubbles are not supported on monochrome displays.
+ I'm not convinced that small bubbles, even dithered prop-
+ erly are going to look like anything more than a jumble of
+ random dots.
+
+B\bBU\bUG\bGS\bS
+ There is a delay before something appears on the screen
+ when using rendered bubbles. The XPM library seems to
+ take a l\blo\bon\bng\bg time to make pixmaps out of raw data. This
+ can be irritating on slower systems.
+
+ The movement of the bubbles looks jerky if an incomplete
+ set of bubbles is used.
+
+ The hide/display algorithm could do with some work to
+ avoid flickering when _\b-_\bn_\bo_\bd_\be_\bl_\ba_\by is set.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+D\bDI\bIS\bST\bTR\bRI\bIB\bBU\bUT\bTI\bIO\bON\bN P\bPO\bOL\bLI\bIC\bCY\bY
+ This work is Copyright (C) 1995, 1996 by James Macnicol.
+ Distribution is allowed under the terms of the GNU General
+ Public License. Look at the sources for the legalese.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ James Macnicol <J.Macnicol@student.anu.edu.au>.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 14-Dec-95 3
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ decayscreen - make a screen meltdown.
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ d\bde\bec\bca\bay\bys\bsc\bcr\bre\bee\ben\bn [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-window]
+ [-root] [-mono] [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-delay _\bu_\bs_\be_\bc_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bd_\be_\bc_\ba_\by_\bs_\bc_\br_\be_\be_\bn program creates a melting effect by ran-
+ domly shifting rectangles around the screen.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bd_\be_\bc_\ba_\by_\bs_\bc_\br_\be_\be_\bn accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ Slow it down.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X(1), xscreensaver(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright 1992 by Vivek Khera. Permission to use, copy,
+ modify, distribute, and sell this software and its docu-
+ mentation for any purpose is hereby granted without fee,
+ provided that the above copyright notice appear in all
+ copies and that both that copyright notice and this per-
+ mission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+
+
+X Version 11 05-aug-93 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Vivek Khera <khera@cs.duke.edu>, 05-Aug-93; based on code
+ by David Wald, 1988.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 05-aug-93 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ deco - draw tacky 70s basement wall panelling
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ d\bde\bec\bco\bo [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-delay _\bs_\be_\bc_\bo_\bn_\bd_\bs] [-max-depth _\bi_\bn_\bt]
+ [-min-width _\bi_\bn_\bt] [-min-height _\bi_\bn_\bt] [-cycle] [-no-cycle]
+ [-cycle-delay]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bd_\be_\bc_\bo program subdivides and colors rectangles ran-
+ domly. It looks kind of like Brady-Bunch-era rec-room
+ wall paneling. (Raven says: "this screensaver is ugly
+ enough to peel paint.")
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bd_\be_\bc_\bo accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long to wait before starting over. Default 5
+ seconds.
+
+ -\b-m\bma\bax\bx-\b-d\bde\bep\bpt\bth\bh _\bi_\bn_\bt_\be_\bg_\be_\br
+ How deep to subdivide. Default 12. Default 8.
+
+ -\b-m\bmi\bin\bn-\b-w\bwi\bid\bdt\bth\bh _\bi_\bn_\bt_\be_\bg_\be_\br
+ -\b-m\bmi\bin\bn-\b-h\bhe\bei\big\bgh\bht\bt _\bi_\bn_\bt_\be_\bg_\be_\br The size of the smallest rect-
+ angle to draw. Default 20x20.
+
+ -\b-c\bcy\byc\bcl\ble\be
+
+ -\b-n\bno\bo-\b-c\bcy\byc\bcl\ble\be
+ Whether to do color cycling. Default False.
+
+ -\b-c\bcy\byc\bcl\ble\be-\b-d\bde\bel\bla\bay\by _\bu_\bs_\be_\bc_\bs
+ If color cycling, how often to change the colors.
+ Default 1000000, or 1 second.
+
+
+
+X Version 11 27-Apr-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 26-Apr-97, based on
+ code by Michael D. Bayne <mdb@go2net.com>.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 27-Apr-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ drift - draws drifting recursive fractal cosmic flames
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ d\bdr\bri\bif\bft\bt [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-grow] [-no-grow] [-liss] [-no-liss]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bd_\br_\bi_\bf_\bt program draws drifting recursive fractal cosmic
+ flames
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bd_\br_\bi_\bf_\bt accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-g\bgr\bro\bow\bw
+
+ -\b-n\bno\bo-\b-g\bgr\bro\bow\bw
+ Whether fractals should grow; otherwise, they are
+ animated.
+
+
+ -\b-l\bli\bis\bss\bs
+
+ -\b-n\bno\bo-\b-l\bli\bis\bss\bs
+ Whether we should use lissojous figures to get
+ points.
+
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ f\bfl\bla\bam\bme\be(1), X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1991, 1995 by Scott Draves.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Scott Draves <spot@cs.cmu.edu>, 06-Jun-91, 01-Jun-95.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ flag - draws a waving flag, containing text or an image
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ f\bfl\bla\bag\bg [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-size _\bi_\bn_\bt_\be_\bg_\be_\br] [-text _\bs_\bt_\br_\bi_\bn_\bg] [-font
+ _\bf_\bo_\bn_\bt] [-bitmap _\bx_\bb_\bm_\b-_\bf_\bi_\bl_\be]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bf_\bl_\ba_\bg program draws a waving flag that contains text or
+ a bitmap.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bf_\bl_\ba_\bg accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-s\bsi\biz\bze\be _\bi_\bn_\bt_\be_\bg_\be_\br
+ How large the pixels in the flag should be, from 1
+ to 8. If this is a negative number, the pixel
+ size is chosen randomly from the range 1 to -size.
+ Default -7.
+
+ -\b-t\bte\bex\bxt\bt _\bt_\be_\bx_\bt
+ The text to display in the flag. Multiple lines
+ of text are allowed; the lines will be displayed
+ centered atop one another. Default: none. If the
+
+
+
+X Version 11 24-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ text is the magic string _\b"_\b(_\bd_\be_\bf_\ba_\bu_\bl_\bt_\b)_\b", then the
+ text used will be the local machine name; a new-
+ line; and the local OS version.
+
+ -\b-b\bbi\bit\btm\bma\bap\bp _\bx_\bb_\bm_\b-_\bf_\bi_\bl_\be
+ The bitmap to display in the flag; this must be an
+ XBM file (color XPMs are not allowed.) Default:
+ none. If the bitmap is the magic string
+ _\b"_\b(_\bd_\be_\bf_\ba_\bu_\bl_\bt_\b)_\b", then the bitmap used will be a charm-
+ ing little picture of J. R. "Bob" Dobbs.
+
+ If neither _\b-_\bt_\be_\bx_\bt nor _\b-_\bb_\bi_\bt_\bm_\ba_\bp are specified, then
+ either the builtin text or the builtin bitmap will
+ be chosen randomly.
+
+ -\b-f\bfo\bon\bnt\bt _\bf_\bo_\bn_\bt
+ The font in which to draw the text; the default is
+ "-*-helvetica-bold-r-*-240-*".
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1996 Charles Vidal.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Charles Vidal <vidalc@univ-mlv.fr>, 1996.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br, and the
+ -text and -bitmap options, added by Jamie Zawinski
+ <jwz@netscape.com>, 24-May-97.
+
+
+
+
+
+
+
+
+
+
+X Version 11 24-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ flame - draw weird cosmic fractals
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ f\bfl\bla\bam\bme\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-colors _\bi_\bn_\bt_\be_\bg_\be_\br] [-iterations _\bi_\bn_\bt_\be_\bg_\be_\br]
+ [-points _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs] [-delay2 _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\b-
+ _\bo_\bn_\bd_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bf_\bl_\ba_\bm_\be program generates colorful fractal displays.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bf_\bl_\ba_\bm_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-c\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64.
+
+ -\b-i\bit\bte\ber\bra\bat\bti\bio\bon\bns\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many fractals to generate. Default 25.
+
+ -\b-p\bpo\boi\bin\bnt\bts\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many pixels to draw for each fractal. Default
+ 10000.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long we should wait between drawing each frac-
+ tal. Default 50000, or about 1/20th second.
+
+ -\b-d\bde\bel\bla\bay\by2\b2 _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long we should wait before clearing the screen
+ when each run ends. Default 2000000, or two sec-
+ onds.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1991 by Patrick J. Naughton
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Scott Graves <spot@cs.cmu.edu>, 06-Jun-91.n
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 18-Oct-93.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ forest - draws a fractal forest
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ f\bfo\bor\bre\bes\bst\bt [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bf_\bo_\br_\be_\bs_\bt program draws a fractal forest.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bf_\bo_\br_\be_\bs_\bt accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 100.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+
+
+
+
+X Version 11 27-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1995 by Pascal Pensa.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Pascal Pensa <pensa@aurora.unice.fr>, 1995.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 27-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 27-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ fract - draws pseudo-fractal geometric patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ f\bfr\bra\bac\bct\bt [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bf_\br_\ba_\bc_\bt program is yet another geometric pattern genera-
+ tor, this one's claim to fame being a pseudo-fractal look-
+ ing vine like pattern that creates nifty whorls and loops.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bf_\br_\ba_\bc_\bt accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors are chosen randomly.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Tracy Camp.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Tracy Camp <campt@hurrah.com>, 1997.
+
+ Tweaked by David Hansen <dhansen@metapath.com>, 21-Mar-97.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ galaxy - draws spinning galaxies
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ g\bga\bal\bla\bax\bxy\by [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-size _\bi_\bn_\bt_\be_\bg_\be_\br]
+ [-trail] [-no-trail]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bg_\ba_\bl_\ba_\bx_\by program draws spinning galaxies.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bg_\ba_\bl_\ba_\bx_\by accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-s\bsi\biz\bze\be _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-t\btr\bra\bai\bil\bl
+
+ -\b-n\bno\bo-\b-t\btr\bra\bai\bil\bl
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1994 by Hubert Feyrer.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Original Amiga version by Uli Siegmund <uli@wom-
+ bat.okapi.sub.org>
+ for EGS in Cluster.
+
+ Ported from Cluster/EGS to C/Intuition by Harald Backert.
+
+ Ported to X11 and xlockmore by Hubert Feyrer
+ <hubert.feyrer@rz.uni-regensburg.de>, 30-Sep-94.
+
+ Modified by David Bagley <bagleyd@bigfoot.com>, 23-Oct-94.
+
+ Modified by Dave Mitchell <davem@magnet.com>, 7-Apr-97.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ goop - squishy transparent oil and bubble screenhack
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ g\bgo\boo\bop\bp [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-transparent] [-non-transparent] [-addi-
+ tive] [-subtractive] [-xor] [-no-xor]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bg_\bo_\bo_\bp program draws a simulation of bubbles in layers
+ of overlapping multicolored translucent fluid.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bg_\bo_\bo_\bp accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many bubbles to draw per layer. Default: ran-
+ dom.
+
+ -\b-l\bla\bay\bye\ber\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many layers to draw. Default: random, based
+ on screen depth.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 100000, or about
+ 1/10th second.
+
+ -\b-t\btr\bra\ban\bns\bsp\bpa\bar\bre\ben\bnt\bt
+ If _\b-_\bl_\ba_\by_\be_\br_\bs is greater than 1, then each layer will
+ be drawn in one color, and when they overlap, the
+ colors will be mixed. This only works on P\bPs\bse\beu\bud\bdo\bo-\b-
+ C\bCo\bol\blo\bor\br displays. This is the default.
+
+ -\b-n\bno\bon\bn-\b-t\btr\bra\ban\bns\bsp\bpa\bar\bre\ben\bnt\bt
+ Turns off _\b-_\bt_\br_\ba_\bn_\bs_\bp_\ba_\br_\be_\bn_\bt.
+
+
+
+
+X Version 11 11-Jun-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-a\bad\bdd\bdi\bit\bti\biv\bve\be
+ If _\b-_\bt_\br_\ba_\bn_\bs_\bp_\ba_\br_\be_\bn_\bt is specified, then this option
+ means that the colors will be mixed using an addi-
+ tive color model, as if the blobs were projected
+ light. This is the default.
+
+ -\b-s\bsu\bub\bbt\btr\bra\bac\bct\bti\biv\bve\be
+ If _\b-_\bt_\br_\ba_\bn_\bs_\bp_\ba_\br_\be_\bn_\bt is specified, then this option
+ means that the colors will be mixed using a sub-
+ tractive color model, as if the blobs were
+ translucent filters.
+
+ -\b-x\bxo\bor\br Draw with xor instead of the other color tricks.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 11-Jun-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 11-Jun-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ grav - draws a simple orbital simulation
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ g\bgr\bra\bav\bv [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-decay] [-no-decay] [-trail] [-no-trail]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bg_\br_\ba_\bv program draws a simple orbital simulation
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bg_\br_\ba_\bv accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors are chosen randomly.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ Default 12.
+
+ -\b-d\bde\bec\bca\bay\by
+
+ -\b-n\bno\bo-\b-e\bec\bca\bay\by
+ Whether orbits should decay.
+
+
+ -\b-t\btr\bra\bai\bil\bl
+
+ -\b-n\bno\bo-\b-t\btr\bra\bai\bil\bl
+ Whether the objects should leave trails behind
+ them (makes it look vaguely like a cloud-chamber.
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1993 by Greg Bowering.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Greg Bowering <greg@smug.student.adelaide.edu.au>, 1993.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ greynetic - draw random stippled/color rectangles
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ g\bgr\bre\bey\byn\bne\bet\bti\bic\bc [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-delay _\bu_\bs_\be_\bc_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bg_\br_\be_\by_\bn_\be_\bt_\bi_\bc program draws random rectangles.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bg_\br_\be_\by_\bn_\be_\bt_\bi_\bc accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ Slow it down.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ halo - draw circular patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ h\bha\bal\blo\bo [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-count _\bi_\bn_\bt] [-delay _\bu_\bs_\be_\bc_\bs] [-mode seuss
+ | ramp | random ] [-animate] [-colors _\bi_\bn_\bt_\be_\bg_\be_\br] [-cycle]
+ [-no-cycle] [-cycle-delay _\bu_\bs_\be_\bc_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bh_\ba_\bl_\bo program draws cool patterns based on circles.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bh_\ba_\bl_\bo accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many circles to draw. Default 0, meaning ran-
+ dom.
+
+ -\b-m\bmo\bod\bde\be s\bse\beu\bus\bss\bs |\b| r\bra\bam\bmp\bp |\b| r\bra\ban\bnd\bdo\bom\bm
+ In _\bs_\be_\bu_\bs_\bs mode, alternating striped curves will be
+ drawn.
+
+ In _\br_\ba_\bm_\bp mode, a color ramp will be drawn.
+
+ _\br_\ba_\bn_\bd_\bo_\bm means pick the mode randomly.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 100000, or about
+ 0.1 second.
+
+ -\b-c\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors to use. Default 100.
+
+ -\b-a\ban\bni\bim\bma\bat\bte\be
+ If specified, then the centerpoints of the circles
+
+
+
+X Version 11 12-Jun-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ will bounce around. Otherwise, the circles will
+ be drawn once, erased, and a new set of circles
+ will be drawn.
+
+ -\b-c\bcy\byc\bcl\ble\be
+
+ -\b-n\bno\bo-\b-c\bcy\byc\bcl\ble\be
+ Whether to do colormap cycling. Default is to
+ cycle.
+
+ -\b-c\bcy\byc\bcl\ble\be-\b-d\bde\bel\bla\bay\by
+ Number of microseconds between shifts of the col-
+ ormap; default 100000, or 1/10th second.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1993 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 6-jul-93.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 12-Jun-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ helix - draw helical string-art patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ h\bhe\bel\bli\bix\bx [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bh_\be_\bl_\bi_\bx program draws interesting patterns composed of
+ line segments in random colors.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bh_\be_\bl_\bi_\bx accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ hopalong - draw real plane fractals
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ h\bho\bop\bpa\bal\blo\bon\bng\bg [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay
+ _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs] [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-jong]
+ [-no-jong] [-jong] [-no-sine]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bh_\bo_\bp_\ba_\bl_\bo_\bn_\bg program generates real plane fractals as
+ described in the September 1986 issue of Scientific Ameri-
+ can.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bh_\bo_\bp_\ba_\bl_\bo_\bn_\bg accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How long to run each batch. Default 2500 pixels.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many pixels should be drawn before a color
+ change. Default 1000.
+
+ -\b-j\bjo\bon\bng\bg _\bi_\bn_\bt_\be_\bg_\be_\br
+
+ -\b-n\bno\bo-\b-j\bjo\bon\bng\bg _\bi_\bn_\bt_\be_\bg_\be_\br
+ Whether to use the Jong format (default is to
+ choose randomly.)
+
+
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-s\bsi\bin\bne\be _\bi_\bn_\bt_\be_\bg_\be_\br
+
+ -\b-n\bno\bo-\b-s\bsi\bin\bne\be _\bi_\bn_\bt_\be_\bg_\be_\br
+ Whether to use the Sine format (default is to
+ choose randomly.)
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1988-91 by Patrick J. Naughton.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Patrick J. Naughton <naughton@eng.sun.com>, 23-mar-88.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92, and again on
+ 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ hypercube - 2d projection of a 4d object
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ h\bhy\byp\bpe\ber\brc\bcu\bub\bbe\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-color[0-7] _\bc_\bo_\bl_\bo_\br] [-xy _\bf_\bl_\bo_\ba_\bt]
+ [-xz _\bf_\bl_\bo_\ba_\bt] [-yz _\bf_\bl_\bo_\ba_\bt] [-xw _\bf_\bl_\bo_\ba_\bt] [-yw _\bf_\bl_\bo_\ba_\bt] [-zw
+ _\bf_\bl_\bo_\ba_\bt] [-observer-z _\bi_\bn_\bt] [-delay _\bu_\bs_\be_\bc_\bs] [-window] [-root]
+ [-mono] [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bh_\by_\bp_\be_\br_\bc_\bu_\bb_\be program displays a wireframe projection of a
+ hypercube which is rotating at user-specified rates around
+ any or all of its four axes.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bh_\by_\bp_\be_\br_\bc_\bu_\bb_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 100000, or about
+ 1/10th second.
+
+ -\b-o\bob\bbs\bse\ber\brv\bve\ber\br-\b-z\bz _\bi_\bn_\bt
+ How far away the observer is from the center of
+ the cube (the cube is one unit per side.) Default
+ 5.
+
+ -\b-c\bco\bol\blo\bor\br0\b0 _\bc_\bo_\bl_\bo_\br
+
+ -\b-c\bco\bol\blo\bor\br1\b1 _\bc_\bo_\bl_\bo_\br
+
+ -\b-c\bco\bol\blo\bor\br2\b2 _\bc_\bo_\bl_\bo_\br
+
+ -\b-c\bco\bol\blo\bor\br3\b3 _\bc_\bo_\bl_\bo_\br
+
+ -\b-c\bco\bol\blo\bor\br4\b4 _\bc_\bo_\bl_\bo_\br
+
+
+
+
+X Version 11 6-dec-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-c\bco\bol\blo\bor\br5\b5 _\bc_\bo_\bl_\bo_\br
+
+ -\b-c\bco\bol\blo\bor\br6\b6 _\bc_\bo_\bl_\bo_\br
+
+ -\b-c\bco\bol\blo\bor\br7\b7 _\bc_\bo_\bl_\bo_\br
+ The colors used to draw the line segments border-
+ ing the eight faces of the cube. Some of the
+ faces have only two of their border-lines drawn in
+ the specified color, and some have all four.
+
+ -\b-x\bxw\bw _\bf_\bl_\bo_\ba_\bt
+
+ -\b-x\bxy\by _\bf_\bl_\bo_\ba_\bt
+
+ -\b-x\bxz\bz _\bf_\bl_\bo_\ba_\bt
+
+ -\b-y\byw\bw _\bf_\bl_\bo_\ba_\bt
+
+ -\b-y\byz\bz _\bf_\bl_\bo_\ba_\bt
+
+ -\b-z\bzw\bw _\bf_\bl_\bo_\ba_\bt
+ The amount that the cube should be rotated around
+ the specified axis at each frame of the animation,
+ expressed in radians. These should be small
+ floating-point values (less than 0.05 works best.)
+ Default: xy=0.01, xz=0.005, yw=0.01.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 6-dec-92.
+
+
+
+
+
+
+X Version 11 6-dec-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ ifs - draws spinning, colliding iterated-function-system
+ images
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ i\bif\bfs\bs [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bi_\bf_\bs program draws spinning, colliding iterated-func-
+ tion-system images.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bi_\bf_\bs accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Massimino Pascal.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Massimino Pascal <Pascal.Massimon@ens.fr>, 1997.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ imsmap - generate fractal maps
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ i\bim\bms\bsm\bma\bap\bp [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt] [-delay _\bs_\be_\bc_\bo_\bn_\bd_\bs] [-itera-
+ tions _\bi_\bn_\bt] [-mode h|s|v|random] [-cycle] [-no-cycle]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bi_\bm_\bs_\bm_\ba_\bp program generates map or cloud-like patterns.
+ It looks quite different in monochrome and color.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bi_\bm_\bs_\bm_\ba_\bp accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors to use. Default 50.
+
+ -\b-d\bde\bel\bla\bay\by _\bi_\bn_\bt_\be_\bg_\be_\br
+ How long to delay between images. Default 10 sec-
+ onds.
+
+ -\b-i\bit\bte\ber\bra\bat\bti\bio\bon\bns\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ A measure of the resolution of the resultant
+ image, from 0 to 7. Default 7.
+
+ -\b-m\bmo\bod\bde\be [\b[ h\bhu\bue\be |\b| s\bsa\bat\btu\bur\bra\bat\bti\bio\bon\bn |\b| v\bva\bal\blu\bue\be |\b| r\bra\ban\bnd\bdo\bom\bm ]\b]
+ The axis upon which colors should be interpolated
+ between the foreground and background color.
+ Default random.
+
+ -\b-c\bcy\byc\bcl\ble\be
+
+ -\b-n\bno\bo-\b-c\bcy\byc\bcl\ble\be
+ Whether to do colormap cycling. Default is to
+ cycle.
+
+
+
+
+X Version 11 17-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-c\bcy\byc\bcl\ble\be-\b-d\bde\bel\bla\bay\by
+ Number of microseconds between shifts of the col-
+ ormap; default 100000, or 1/10th second.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Juergen Nickelsen <nickel@cs.tu-berlin.de>, 23-aug-92.
+
+ Hacked on by Jamie Zawinski <jwz@netscape.com>, 24-aug-92,
+ 17-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 17-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ julia - draws spinning, animating julia-set fractals
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ j\bju\bul\bli\bia\ba [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-mouse] [-nomouse]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bj_\bu_\bl_\bi_\ba program draws spinning, animating julia-set
+ fractals.
+
+ It uses ifs {w0 = sqrt(x-c), w1 = -sqrt(x-c)} with random
+ iteration to plot the julia set, and sinusoidially varied
+ parameters for the set, and plots parameters with a cir-
+ cle.
+
+ One thing to note is that count is the _\bd_\be_\bp_\bt_\bh of the search
+ tree, so the number of points computed is (2^count)-1. I
+ use 8 or 9 on a dx266 and it looks okay. The sinusoidal
+ variation of the parameter might not be as interesting as
+ it could, but it still gives an idea of the effect of the
+ parameter.
+
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bj_\bu_\bl_\bi_\ba accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+
+
+
+X Version 11 28-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-m\bmo\bou\bus\bse\be
+
+ -\b-n\bno\bom\bmo\bou\bus\bse\be
+ If _\b-_\bm_\bo_\bu_\bs_\be is specified, the control point of the
+ Julia set will be derived from the position of the
+ mouse in the window. When the mouse is not in the
+ window, the control point is chosen the normal
+ way.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1995 by Sean McCullough.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Sean McCullough <bankshot@mailhost.nmt.edu>, 1995.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 28-May-97 2
+
+
--- /dev/null
+
+
+
+Kaleidescpe(1) Kaleidescpe(1)
+
+
+N\bNA\bAM\bME\bE
+ Kaleidescope - rotating line segments
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ k\bka\bal\ble\bei\bid\bde\bes\bsc\bco\bop\bpe\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-color_mode _\bm_\bo_\bn_\bo _\b| _\bn_\bi_\bc_\be _\b| _\bg_\br_\be_\be_\bd_\by]
+ [-nsegments _\bi_\bn_\bt] [-ntrails _\bi_\bn_\bt] [-local_rotation _\bi_\bn_\bt]
+ [-global_rotation _\bi_\bn_\bt] [-delay _\bu_\bs_\be_\bc_\bs] [-redmin _\bi_\bn_\bt]
+ [-greenmin _\bi_\bn_\bt] [-bluemin _\bi_\bn_\bt] [-redrange _\bi_\bn_\bt] [-green-
+ range _\bi_\bn_\bt] [-bluerange _\bi_\bn_\bt]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bk_\ba_\bl_\be_\bi_\bd_\be_\bs_\bc_\bo_\bp_\be program draws line segments in a symmet-
+ ric pattern that evolves over time.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bk_\ba_\bl_\be_\bi_\bd_\be_\bs_\bc_\bo_\bp_\be accepts the following options:
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-c\bco\bol\blo\bor\br_\b_m\bmo\bod\bde\be m\bmo\bon\bno\bo |\b| n\bni\bic\bce\be |\b| g\bgr\bre\bee\bed\bdy\by
+ Specify how kaleidescope uses colors. Mono uses
+ just the default foreground and background colors.
+ Nice uses one color for each segment (specified by
+ nsegments). Greedy uses (ntrails * nsegments) + 1
+ colors.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bns\bse\beg\bgm\bme\ben\bnt\bts\bs i\bin\bnt\bte\beg\bge\ber\br
+ The number of segments to draw. Default is 7.
+
+ -\b-n\bnt\btr\bra\bai\bil\bls\bs i\bin\bnt\bte\beg\bge\ber\br
+ The number of trails to draw. Default is 100.
+
+ -\b-l\blo\boc\bca\bal\bl_\b_r\bro\bot\bta\bat\bti\bio\bon\bn i\bin\bnt\bte\beg\bge\ber\br
+ The rate at which segments rotate around their
+ center. Default is -59.
+
+ -\b-g\bgl\blo\bob\bba\bal\bl_\b_r\bro\bot\bta\bat\bti\bio\bon\bn i\bin\bnt\bte\beg\bge\ber\br
+ The rate at which segments rotate around the cen-
+ ter of the window. Default is 1.
+
+ -\b-r\bre\bed\bdm\bmi\bin\bn,\b, -\b-g\bgr\bre\bee\ben\bnm\bmi\bin\bn,\b, -\b-b\bbl\blu\bue\bem\bmi\bin\bn,\b, -\b-r\bre\bed\bdr\bra\ban\bng\bge\be,\b, -\b-g\bgr\bre\bee\ben\bnr\bra\ban\bng\bge\be,\b,
+ -\b-b\bbl\blu\bue\ber\bra\ban\bng\bge\be
+ All take an integer argument. When colors are ran-
+ domly chosen, they are chosen from the interval
+
+
+
+X Version 11 14-Dec-95 1
+
+
+
+
+
+Kaleidescpe(1) Kaleidescpe(1)
+
+
+ min to min plus range. The minimums default to
+ 30000. The ranges default to 20000.
+
+ -\b-d\bde\bel\bla\bay\by m\bmi\bic\bcr\bro\bos\bse\bec\bco\bon\bnd\bds\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default is 20000, or
+ about 5 frames a second.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), k\bka\bal\ble\bei\bid\bde\bes\bsc\bco\bop\bpe\be(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Ron Tapia. Permission to use, copy,
+ modify, distribute, and sell this software and its docu-
+ mentation for any purpose is hereby granted without fee,
+ provided that the above copyright notice appear in all
+ copies and that both that copyright notice and this per-
+ mission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Ron Tapia <tapia@nmia.com>, 20-Mar-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 14-Dec-95 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ laser - draws vaguely laser-like moving lines
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ l\bla\bas\bse\ber\br [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bl_\ba_\bs_\be_\br program draws vaguely laser-like moving lines
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bl_\ba_\bs_\be_\br accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ Default 200.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ Default 10.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1995 by Pascal Pensa.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Pascal Pensa <pensa@aurora.unice.fr>, 1995.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ lightning - draws fractal lightning bolts
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ l\bli\big\bgh\bht\btn\bni\bin\bng\bg [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay
+ _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bl_\bi_\bg_\bh_\bt_\bn_\bi_\bn_\bg program draws fractal lightning bolts
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bl_\bi_\bg_\bh_\bt_\bn_\bi_\bn_\bg accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors are chosen randomly.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1996 by Keith Romberg.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Keith Romberg <kromberg@saxe.com>, 27-Jun-96.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ lisa - draws animated full-loop lisajous figures
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ l\bli\bis\bsa\ba [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-size _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bl_\bi_\bs_\ba program draws animated full-loop lisajous fig-
+ ures.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bl_\bi_\bs_\ba accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200. The colors are chosen randomly.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-s\bsi\biz\bze\be _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+
+
+
+X Version 11 27-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Caleb Cullen.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Caleb Cullen, 1997.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 27-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 27-May-97 2
+
+
--- /dev/null
+
+
+
+LMORPH(1) LMORPH(1)
+
+
+N\bNA\bAM\bME\bE
+ lmorph - morphing lines
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ l\blm\bmo\bor\brp\bph\bh [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-points _\bi_\bn_\bt] [-steps _\bi_\bn_\bt] [-delay _\bu_\bs_\be_\bc_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bl_\bm_\bo_\br_\bp_\bh program morphs between simple linedrawings
+ using bilinear interpolation.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bl_\bm_\bo_\br_\bp_\bh accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-p\bpo\boi\bin\bnt\bts\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ Number of points in each line drawing. Default is
+ 150 points.
+
+ -\b-s\bst\bte\bep\bps\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ Interpolation steps from one drawing to the next.
+ Default is 0, which means a random number between
+ 100 and 500.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 50000.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+
+
+ xscreensaver hack 1
+
+
+
+
+
+LMORPH(1) LMORPH(1)
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Sverre H. Huseby <sverrehu@ifi.uio.no> and Glenn T. Lines
+ <gtl@si.sintef.no>, built on top of the screen saver rou-
+ tines by Jamie Zawinski <jwz@netscape.com>.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+ xscreensaver hack 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ maze - an automated X11 demo repeatedly creating and solv-
+ ing a random maze
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ m\bma\baz\bze\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-install] [-visual
+ _\bv_\bi_\bs_\bu_\ba_\bl] [-grid-size _\bp_\bi_\bx_\be_\bl_\bs] [-live-color _\bc_\bo_\bl_\bo_\br]
+ [-dead-color _\bc_\bo_\bl_\bo_\br] [-solve-delay _\bu_\bs_\be_\bc_\bs] [-pre-delay
+ _\bu_\bs_\be_\bc_\bs] [-post-delay _\bu_\bs_\be_\bc_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bm_\ba_\bz_\be program creates a "random" maze and then solves
+ it with graphical feedback.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bm_\ba_\bz_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-g\bgr\bri\bid\bd-\b-s\bsi\biz\bze\be _\bp_\bi_\bx_\be_\bl_\bs
+ The size of each block of the maze, in pixels;
+ default is 0, meaning pick a random grid size.
+
+ -\b-l\bli\biv\bve\be-\b-c\bco\bol\blo\bor\br _\bc_\bo_\bl_\bo_\br
+ The color of the path.
+
+ -\b-d\bde\bea\bad\bd-\b-c\bco\bol\blo\bor\br _\bc_\bo_\bl_\bo_\br
+ The color of the failed path (it is also stippled
+ with a 50% pattern.)
+
+ -\b-s\bso\bol\blv\bve\be-\b-d\bde\bel\bla\bay\by _\bi_\bn_\bt_\be_\bg_\be_\br
+ Delay (in microseconds) between each step of the
+ solution path. Default 5000, or about 1/200th
+ second.
+
+ -\b-p\bpr\bre\be-\b-d\bde\bel\bla\bay\by _\bi_\bn_\bt_\be_\bg_\be_\br
+ Delay (in microseconds) between generating a maze
+ and starting to solve it. Default 2000000 (2 sec-
+ onds.)
+
+ -\b-p\bpo\bos\bst\bt-\b-d\bde\bel\bla\bay\by _\bi_\bn_\bt_\be_\bg_\be_\br
+ Delay (in microseconds) after solving a maze and
+
+
+
+X Version 11 7-mar-93 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ before generating a new one. Default 4000000 (4
+ seconds.)
+
+ Clicking the mouse in the maze window controls it.
+
+ L\bLe\bef\bft\btB\bBu\but\btt\bto\bon\bn Clears the window and restarts maze.
+
+ M\bMi\bid\bdd\bdl\ble\beB\bBu\but\btt\bto\bon\bn Pause or unpause the program.
+
+ R\bRi\big\bgh\bht\btB\bBu\but\btt\bto\bon\bn Exit.
+
+B\bBU\bUG\bGS\bS
+ Expose events force a restart of maze.
+
+ Mouse actions are based on "raw" values (Button1, Button2
+ and Button3) instead of using the pointer map.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1988 by Sun Microsystems, Inc. Mountain
+ View, CA.
+
+ All Rights Reserved
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation, and that the names of Sun or MIT not be
+ used in advertising or publicity pertaining to distribu-
+ tion of the software without specific prior written per-
+ mission. Sun and M.I.T. make no representations about the
+ suitability of this software for any purpose. It is pro-
+ vided "as is" without any express or implied warranty.
+
+ SUN DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE,
+ INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY AND
+ FITNESS FOR A PARTICULAR PURPOSE. IN NO EVENT SHALL SUN BE
+ LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES
+ OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA
+ OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE
+ OR OTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION
+ WITH THE USE OR PERFORMANCE OF THIS SOFTWARE.
+
+
+
+X Version 11 7-mar-93 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR(\b(s\bs)\b)
+ Jim Randell [ XScreenSaver version ] jmr@mddjmr.fc.hp.com
+ HPLabs, Bristol
+ Richard Hess [ X11 extensions ] {...}!uunet!cimshop!rhess
+ Consilium, Mountain View, CA
+ Dave Lemke [ X11 version ] lemke@sun.COM
+ Sun MicroSystems, Mountain View, CA
+ Martin Weiss [ SunView version ]
+ Sun MicroSystems, Mountain View, CA
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 7-mar-93 3
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ halo - draw circular interference patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ h\bha\bal\blo\bo [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-delay _\bs_\be_\bc_\bo_\bn_\bd_\bs] [-random _\bb_\bo_\bo_\bl_\be_\ba_\bn]
+ [-ncolors _\bi_\bn_\bt] [-offset _\bi_\bn_\bt]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bm_\bo_\bi_\br_\be program draws cool circular interference pat-
+ terns.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bm_\bo_\bi_\br_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long to wait before starting over. Default 5
+ seconds.
+
+ -\b-r\bra\ban\bnd\bdo\bom\bm _\bb_\bo_\bo_\bl_\be_\ba_\bn
+ Whether to ignore the foreground/background col-
+ ors, and pick them randomly instead.
+
+ -\b-o\bof\bff\bfs\bse\bet\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ The maximum random radius increment to use.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be allocated in the color
+ ramp (note that this value interacts with _\bo_\bf_\bf_\bs_\be_\bt.)
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+
+
+X Version 11 27-Apr-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 27-Apr-97, based on
+ code by Michael D. Bayne <mdb@go2net.com>.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 27-Apr-97 2
+
+
--- /dev/null
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+ 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ munch - munching squares screen hack
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ d\bde\bec\bco\bo [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-delay _\bs_\be_\bc_\bo_\bn_\bd_\bs] [-xor] [-noxor] [-shift]
+ [-noshift] [-logminwidth _\bm_\bi_\bn_\bi_\bm_\bu_\bm _\bw_\bi_\bd_\bt_\bh]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bm_\bu_\bn_\bc_\bh program preforms the munching squares hack until
+ killed. It picks square size, position, and gravity ran-
+ domly; configurable options are listed below.
+
+ The munching squares hack cosists of drawing Y = X XOR T
+ for a range of X and T over and over until all the possi-
+ ble combinations of X and T have come up. It was report-
+ edly discovered by Jackson Wright in 1962 and took 5
+ instructions of PDP-6 code.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bm_\bu_\bn_\bc_\bh accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long to wait before starting over. Default 5
+ seconds.
+
+ -\b-x\bxo\bor\br Use the XOR drawing function. (Default.)
+
+ -\b-n\bno\bo-\b-x\bxo\bor\br Don't use the XOR drawing function.
+
+ -\b-s\bsh\bhi\bif\bft\bt Start drawing the square at weird starting points.
+ (Default.)
+
+ -\b-n\bno\bo-\b-s\bsh\bhi\bif\bft\bt
+ Don't shift and start drawing the square at weird
+ starting points.
+
+
+
+
+X Version 11 17-Jun-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-l\blo\bog\bgm\bmi\bin\bnw\bwi\bid\bdt\bth\bh _\bm_\bi_\bn_\bi_\bm_\bu_\bm_\b-_\bw_\bi_\bd_\bt_\bh
+ The logarithm (base 2) of the minimum with of a
+ square (must be a power of 2, or some parts of the
+ square aren't.)
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1),
+ h\bht\btt\btp\bp:\b:/\b//\b/w\bww\bww\bw.\b.i\bin\bnw\bwa\bap\bp.\b.c\bco\bom\bm/\b/p\bpd\bdp\bp1\b10\b0/\b/h\bhb\bba\bak\bke\ber\br/\b/h\bha\bak\bkm\bme\bem\bm/\b/h\bha\bak\bkm\bme\bem\bm.\b.h\bht\btm\bml\bl,\b,
+ h\bht\btt\btp\bp:\b:/\b//\b/w\bww\bww\bw.\b.c\bco\bom\bme\bed\bdi\bia\ba.\b.c\bco\bom\bm/\b/H\bHo\bot\bt/\b/j\bja\bar\brg\bgo\bon\bn_\b_3\b3.\b.0\b0/\b/J\bJA\bAR\bRG\bGO\bON\bN_\b_M\bM/\b/M\bMU\bUN\bNC\bCH\bH-\b-
+ S\bSQ\bQR\bR.\b.H\bHT\bTM\bML\bL
+
+H\bHI\bIS\bST\bTO\bOR\bRY\bY
+ Quoted from HAKMEM, for historical interest. As that doc-
+ ument says, "Unless otherwise stated, all computer pro-
+ grams are in PDP-6/10 assembly language."
+
+ ITEM 146: MUNCHING SQUARES
+ Another simple display program. It is thought that
+ this was discovered by Jackson Wright on the RLE
+ PDP-1 circa 1962.
+
+ DATAI 2
+ ADDB 1,2
+ ROTC 2,-22
+ XOR 1,2
+ JRST .-4
+
+ 2=X, 3=Y. Try things like 1001002 in data
+ switches. This also does interesting things with
+ operations other than XOR, and rotations other
+ than -22. (Try IOR; AND; TSC; FADR; FDV(!); ROT
+ -14, -9, -20, ...)
+
+ ITEM 147 (Schroeppel):
+ Munching squares is just views of the graph Y = X
+ XOR T for consecutive values of T = time.
+
+ ITEM 148 (Cohen, Beeler):
+ A modification to munching squares which reveals
+ them in frozen states through opening and closing
+ curtains: insert FADR 2,1 before the XOR. Try data
+ switches =
+
+ 4000,,4 1000,,2002 2000,,4 0,,1002
+
+ (Notation: <left half>,,<right half>)
+
+
+
+X Version 11 17-Jun-97 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ Also try the FADR after the XOR, switches =
+ 1001,,1.
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Tim Showalter. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Tim Showalter <tjs@andrew.cmu.edu>, 17-Jun-97, based on
+ what's in the Jargon File and stealing stuff from existing
+ xscreensaver modules.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 17-Jun-97 3
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ noseguy - a little guy with a big nose wanders around
+ being witty
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ n\bno\bos\bse\beg\bgu\buy\by [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-text-foreground _\bc_\bo_\bl_\bo_\br] [-text-back-
+ ground _\bc_\bo_\bl_\bo_\br] [-font _\bf_\bo_\bn_\bt] [-window] [-root] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-mode _\bm_\bo_\bd_\be] [-program _\bp_\br_\bo_\bg_\br_\ba_\bm] [-file-
+ name le_\b] _\b[_\b-_\bt_\be_\bx_\bt _\bt_\be_\bx_\bt_\b]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ A little man with a big nose and a hat runs around spewing
+ out messages to the screen. This code (and its bitmaps)
+ were extracted from the _\bx_\bn_\bl_\bo_\bc_\bk program.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bn_\bo_\bs_\be_\bg_\bu_\by accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-f\bfo\bon\bnt\bt _\bf_\bo_\bn_\bt
+ The font used for the messages.
+
+ -\b-m\bmo\bod\bde\be [\b[ p\bpr\bro\bog\bgr\bra\bam\bm |\b| f\bfi\bil\ble\be |\b| s\bst\btr\bri\bin\bng\bg ]\b]
+ In _\bp_\br_\bo_\bg_\br_\ba_\bm mode, the messages are gotten by run-
+ ning a program. The program used is controlled by
+ the _\b-_\bp_\br_\bo_\bg_\br_\ba_\bm option, and the _\b._\bp_\br_\bo_\bg_\br_\ba_\bm resource.
+
+ In _\bf_\bi_\bl_\be_\bn_\ba_\bm_\be mode, the message used is the contents
+ of a file. The file used is controlled by the
+ _\b-_\bf_\bi_\bl_\be option, and the _\b._\bf_\bi_\bl_\be_\bn_\ba_\bm_\be resource.
+
+ In _\bs_\bt_\br_\bi_\bn_\bg mode, the message is whatever was speci-
+ fied on the command line as the _\b-_\bt_\be_\bx_\bt option, or
+ in the resource database as the _\b._\bt_\be_\bx_\bt resource.
+
+ -\b-p\bpr\bro\bog\bgr\bra\bam\bm _\bp_\br_\bo_\bg_\br_\ba_\bm
+ If _\bm_\bo_\bd_\be is _\bp_\br_\bo_\bg_\br_\ba_\bm (the default), then this pro-
+ gram will be run periodically, and its output will
+ be the text of the messages. The default program
+ is _\b"_\bf_\bo_\br_\bt_\bu_\bn_\be _\b-_\bs_\b", but _\by_\bo_\bw is also a good choice.
+
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-f\bfi\bil\ble\ben\bna\bam\bme\be _\bf_\bi_\bl_\be
+ If _\bm_\bo_\bd_\be is _\bf_\bi_\bl_\be, then the contents of this file
+ will be used for all messages.
+
+ -\b-t\bte\bex\bxt\bt _\bs_\bt_\br_\bi_\bn_\bg
+ If _\bm_\bo_\bd_\be is _\bs_\bt_\br_\bi_\bn_\bg, then this text will be used for
+ all messages.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxn\bnl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright 1985, 1990 by Dan Heller <argv@sun.com>.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Dan Heller <argv@sun.com>, 1985.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ pedal - pretty geometric picture program
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ p\bpe\bed\bda\bal\bl [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-delay _\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-maxlines _\bn_\bu_\bm_\bb_\be_\br] [-fadedelay _\bu_\bs_\be_\bc_\bo_\bn_\bd_\bs] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bp_\be_\bd_\ba_\bl program displays pretty geometric pictures.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bp_\be_\bd_\ba_\bl accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-f\bfo\bor\bre\beg\bgr\bro\bou\bun\bnd\bd _\bc_\bo_\bl_\bo_\br
+ The color for the foreground. Default is white.
+
+ -\b-b\bba\bac\bck\bkg\bgr\bro\bou\bun\bnd\bd _\bc_\bo_\bl_\bo_\br
+ The color for the background. Default is black.
+
+ -\b-d\bde\bel\bla\bay\by _\bs_\be_\bc_\bo_\bn_\bd_\bs
+ The number of seconds to pause between each pic-
+ ture.
+
+ -\b-m\bma\bax\bxl\bli\bin\bne\bes\bs _\bn_\bu_\bm_\bb_\be_\br
+ The maximum number of lines in the drawing. Good
+ values are between 20 and 2000. Maximum value is
+ 16K.
+
+ -\b-f\bfa\bad\bde\bed\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ The number of micro seconds to take when fading in
+ and out.
+
+ -\b-m\bmo\bon\bno\bo Don't do fading. Pretend we're on a monochrome
+ display.
+
+ To make your X server grunt under load, and to impress
+ your friends, try _\bp_\be_\bd_\ba_\bl _\b-_\bm_\bo_\bn_\bo _\b-_\bd_\be_\bl_\ba_\by _\b0 _\b-_\bm_\ba_\bx_\bl_\bi_\bn_\be_\bs _\b1_\b0_\b0_\b.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+
+
+
+
+X Version 11 24-Jun-94 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1994, by Carnegie Mellon University. Per-
+ mission to use, copy, modify, distribute, and sell this
+ software and its documentation for any purpose is hereby
+ granted without fee, provided fnord that the above copy-
+ right notice appear in all copies and that both that copy-
+ right notice and this permission notice appear in support-
+ ing documentation. No representations are made about the
+ suitability of fnord this software for any purpose. It is
+ provided "as is" without express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Dale Moore <Dale.Moore@cs.cmu.edu>, 24-Jun-1994.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 24-Jun-94 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ penrose - draws quasiperiodic tilings
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ p\bpe\ben\bnr\bro\bos\bse\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-size _\bi_\bn_\bt_\be_\bg_\be_\br] [-ammann] [-no-ammann]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bp_\be_\bn_\br_\bo_\bs_\be program draws quasiperiodic tilings.
+
+ See Onoda, Steinhardt, DiVincenzo and Socolar in Phys.
+ Rev. Lett. 60, #25, 1988 or Strandburg in Computers in
+ Physics, Sep/Oct 1991.
+
+ This implementation uses the simpler version of the growth
+ algorithm, i.e., if there are no forced vertices, a ran-
+ domly chosen tile is added to a randomly chosen vertex (no
+ preference for those 108 degree angles).
+
+ There are two essential differences to the algorithm pre-
+ sented in the literature: First, we do not allow the
+ tiling to enclose an untiled area. Whenever this is in
+ danger of happening, we just do not add the tile, hoping
+ for a better random choice the next time. Second, when
+ choosing a vertex randomly, we will take one that lies
+ withing the viewport if available. If this seems to cause
+ enclosures in the forced rule case, we will allow invisi-
+ ble vertices to be chosen.
+
+ Tiling is restarted whenever one of the following happens:
+ there are no incomplete vertices within the viewport or
+ the tiling has extended a window's length beyond the edge
+ of the window horizontally or vertically or forced rule
+ choice has failed 100 times due to areas about to become
+ enclosed.
+
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bp_\be_\bn_\br_\bo_\bs_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors are chosen randomly.
+
+ -\b-s\bsi\biz\bze\be _\bi_\bn_\bt_\be_\bg_\be_\br
+ How big the tiles should be. Default 40 pixels.
+
+
+ -\b-a\bam\bmm\bma\ban\bnn\bn _\bi_\bn_\bt_\be_\bg_\be_\br
+
+ -\b-n\bno\bo-\b-a\bam\bmm\bma\ban\bnn\bn _\bi_\bn_\bt_\be_\bg_\be_\br
+ Whether Ammann lines should be added.
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1996 by Timo Korvola.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Timo Korvola <tkorvola@dopey.hut.fi>, 1996.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ pyro - simulate fireworks
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ p\bpy\byr\bro\bo [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-frequency _\bi_\bn_\bt_\be_\bg_\be_\br]
+ [-scatter _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bp_\by_\br_\bo program simulates fireworks, in a way similar to
+ a Macintosh program of the same name.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bp_\by_\br_\bo accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many particles should be allowed on the screen
+ at once. Default 100.
+
+ -\b-f\bfr\bre\beq\bqu\bue\ben\bnc\bcy\by _\bi_\bn_\bt_\be_\bg_\be_\br
+ How often new missiles should launch. Default 30.
+
+ -\b-s\bsc\bca\bat\btt\bte\ber\br _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many particles should appear when a missile
+ explodes. Default 20. The actual number used is
+ between _\bN and _\bN_\b+_\b(_\bN_\b/_\b2_\b).
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ qix - bounce colored lines around a window
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ q\bqi\bix\bx [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-segments _\bi_\bn_\bt] [-spread _\bp_\bi_\bx_\be_\bl_\bs] [-size
+ _\bp_\bi_\bx_\be_\bl_\bs] [-count _\bi_\bn_\bt] [-color-shift _\bd_\be_\bg_\br_\be_\be_\bs] [-delay _\bu_\bs_\be_\bc_\bs]
+ [-random] [-linear] [-solid] [-hollow] [-xor] [-no-xor]
+ [-transparent] [-non-transparent] [-additive] [-subtrac-
+ tive] [-poly _\bi_\bn_\bt] [-gravity] [-no-gravity]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bq_\bi_\bx program bounces a series of line segments around
+ its window. This is truly the swiss army chainsaw of qix
+ programs. If you know of one with more display modes, I
+ want to know about it.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bq_\bi_\bx accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-s\bse\beg\bgm\bme\ben\bnt\bts\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many line segments should be drawn. Default
+ 50.
+
+ -\b-s\bsp\bpr\bre\bea\bad\bd _\bi_\bn_\bt_\be_\bg_\be_\br
+ How far apart the endpoints of one segment should
+ be from the next. Default 8.
+
+ -\b-s\bsi\biz\bze\be _\bi_\bn_\bt_\be_\bg_\be_\br
+ The maximum distance one endpoint of a segment is
+ allowed to be from the opposite end of that seg-
+ ment. Default 0, meaning unlimited.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many qixes to draw. Default 1.
+
+
+
+
+
+X Version 11 27-Apr-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-c\bco\bol\blo\bor\br-\b-s\bsh\bhi\bif\bft\bt _\bd_\be_\bg_\br_\be_\be_\bs
+ If on a color display, the color of the line seg-
+ ments will cycle through the spectrum. This spec-
+ ifies how far the hue of each segment should be
+ from the next, in degrees on the HSV wheel.
+ Default 3.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 25000, or about
+ 0.025 seconds.
+
+ -\b-r\bra\ban\bnd\bdo\bom\bm The _\bq_\bi_\bx will wander around the screen semi-ran-
+ domly. This is the default.
+
+ -\b-l\bli\bin\bne\bea\bar\br The opposite of _\b-_\br_\ba_\bn_\bd_\bo_\bm: the _\bq_\bi_\bx will travel in
+ straight lines until it reaches a wall, and then
+ it will bounce.
+
+ -\b-s\bso\bol\bli\bid\bd If this is specified, then the area between the
+ line segments will be filled in with the appropri-
+ ate color, instead of the _\bq_\bi_\bx simply being com-
+ posed of one-pixel-wide line segments. This
+ option looks really good in color.
+
+ -\b-h\bho\bol\bll\blo\bow\bw The opposite of _\b-_\bs_\bo_\bl_\bi_\bd; this is the default.
+
+ -\b-x\bxo\bor\br If this is specified, then qix segments will be
+ drawn and erased with xor, instead of being drawn
+ in some color and erased in the background color.
+ This implies _\b-_\bm_\bo_\bn_\bo, in that only two colors can be
+ used.
+
+ -\b-t\btr\bra\ban\bns\bsp\bpa\bar\bre\ben\bnt\bt
+ If this is specified, and _\b-_\bc_\bo_\bu_\bn_\bt is greater than
+ 1, then each qix will be drawn in one color, and
+ when they overlap, the colors will be mixed. This
+ only works on P\bPs\bse\beu\bud\bdo\boC\bCo\bol\blo\bor\br displays. This looks
+ best in conjuction with _\b-_\bs_\bo_\bl_\bi_\bd.
+
+ -\b-n\bno\bon\bn-\b-t\btr\bra\ban\bns\bsp\bpa\bar\bre\ben\bnt\bt
+ Turns off _\b-_\bt_\br_\ba_\bn_\bs_\bp_\ba_\br_\be_\bn_\bt.
+
+ -\b-a\bad\bdd\bdi\bit\bti\biv\bve\be
+ If _\b-_\bt_\br_\ba_\bn_\bs_\bp_\ba_\br_\be_\bn_\bt is specified, then this option
+ means that the colors will be mixed using an addi-
+ tive color model, as if the qixes were projected
+ light. This is the default.
+
+ -\b-s\bsu\bub\bbt\btr\bra\bac\bct\bti\biv\bve\be
+ If _\b-_\bt_\br_\ba_\bn_\bs_\bp_\ba_\br_\be_\bn_\bt is specified, then this option
+ means that the colors will be mixed using a sub-
+ tractive color model, as if the qixes were
+ translucent filters.
+
+
+
+X Version 11 27-Apr-97 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-p\bpo\bol\bly\by _\bi_\bn_\bt
+ How many vertices each qix-line should have: the
+ default is 2, meaning the traditional qix line
+ shape. Three will yield triangles, and so on.
+
+ -\b-g\bgr\bra\bav\bvi\bit\bty\by
+
+ -\b-n\bno\bo-\b-g\bgr\bra\bav\bvi\bit\bty\by
+ Whether there should be downward attraction. For
+ example, the options -\b-g\bgr\bra\bav\bvi\bit\bty\by -\b-l\bli\bin\bne\bea\bar\br will make
+ everything move in nice smooth parabolas. Gravity
+ is off by default.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+ Thanks to Ariel Scolnicov for the -poly and -gravity
+ options.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 27-Apr-97 3
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ rocks - animation of flying through an asteroid field
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ r\bro\boc\bck\bks\bs [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-install] [-visual
+ _\bv_\bi_\bs_\bu_\ba_\bl] [-count _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bu_\bs_\be_\bc_\bs] [-speed _\bi_\bn_\bt_\be_\bg_\be_\br]
+ [-norotate] [-nomove] [-3d]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\br_\bo_\bc_\bk_\bs program draws an animation of an asteroid field
+ moving past the observer (or vice versa). Sometimes the
+ observer picks up spin on Z axis.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\br_\bo_\bc_\bk_\bs accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ Maximum number of rocks to draw on the screen at
+ once. Default 100.
+
+ -\b-s\bsp\bpe\bee\bed\bd _\bi_\bn_\bt_\be_\bg_\be_\br
+ A measure of the speed with which the observer and
+ the rocks pass each other, from 1 to 100. Default
+ 100, meaning ``very fast.'' If you're on a slow
+ display connection (the animation looks jerky)
+ then try making this number smaller, and/or
+ decreasing the number of rocks.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ Number of microseconds to delay between each
+ frame. Default 50000, meaning about 1/20th sec-
+ ond. Compare and contrast with _\b-_\bs_\bp_\be_\be_\bd, above.
+
+ -\b-n\bno\bor\bro\bot\bta\bat\bte\be
+ Don't rotate the observer; just fly through the
+ field on the level.
+
+ -\b-n\bno\bom\bmo\bov\bve\be Don't turn the observer; just fly straight ahead
+ through the field.
+
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-3\b3d\bd Do red/blue 3d separations: if you look at the
+ screen with 3d glasses, the rocks will be _\bj_\bu_\bm_\bp_\bi_\bn_\bg
+ right _\bo_\bu_\bt at you. Oooooh, scaaary!
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+B\bBU\bUG\bGS\bS
+ There should be an option to display doppler shift (a
+ gravity rainbow.)
+
+ Speed of rotation should be settable.
+
+ Default speed of rotation should be relative to forward
+ velocity.
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Based on Lisp Machine code copyright 1988 John Nguyen
+ <johnn@hx.lcs.mit.edu>.
+
+ Ported to C and X by Jamie Zawinski <jwz@netscape.com>,
+ 13-aug-92.
+
+ Steering code by Jeremie Petit; 3D code by theil-
+ ing@coli.uni-sb.de.
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ rorschach - simulate ink-blot patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ r\bro\bor\brs\bsc\bch\bha\bac\bch\bh [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-iterations _\bi_\bn_\bt_\be_\bg_\be_\br] [-offset
+ _\bi_\bn_\bt_\be_\bg_\be_\br] [-xsymmetry] [-ysymmetry]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\br_\bo_\br_\bs_\bc_\bh_\ba_\bc_\bh program draws random patterns reminiscent of
+ the psychological test of same name.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\br_\bo_\br_\bs_\bc_\bh_\ba_\bc_\bh accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-i\bit\bte\ber\bra\bat\bti\bio\bon\bns\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many dots should be drawn each time. Default
+ 4000.
+
+ -\b-o\bof\bff\bfs\bse\bet\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How far apart the dots should be. Default 4 pix-
+ els.
+
+ -\b-x\bxs\bsy\bym\bmm\bme\bet\btr\bry\by
+ Whether the images should be horizontally symmet-
+ rical. Default true.
+
+ -\b-y\bys\bsy\bym\bmm\bme\bet\btr\bry\by
+ Whether the images should be vertically symmetri-
+ cal. Default false.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ RESOURCE_MANAGER property.
+
+B\bBU\bUG\bGS\bS
+ May call your sanity into question.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ sierpinski - draws Sierpinski triangle fractals
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bsi\bie\ber\brp\bpi\bin\bns\bsk\bki\bi [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay
+ _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs] [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bi_\be_\br_\bp_\bi_\bn_\bs_\bk_\bi program draws Sierpinski triangle fractals.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bi_\be_\br_\bp_\bi_\bn_\bs_\bk_\bi accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors are chosen randomly.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1996 by Desmond Daignault.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Desmond Daignault <tekdd@dtol.datatimes.com>, 05-Sep-96.
+ (Original xlock version was called tri.c.)
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97. (Renamed to
+ sierpinski.)
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ slidescreen - permute the screen image like an 8-puzzle
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bsl\bli\bid\bde\bes\bsc\bcr\bre\bee\ben\bn [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-background
+ _\bc_\bo_\bl_\bo_\br] [-grid-size _\bp_\bi_\bx_\be_\bl_\bs] [-ibw _\bp_\bi_\bx_\be_\bl_\bs] [-increment _\bp_\bi_\bx_\b-
+ _\be_\bl_\bs] [-delay _\bu_\bs_\be_\bc_\bs] [-delay2 _\bu_\bs_\be_\bc_\bs] [-window] [-root]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bl_\bi_\bd_\be_\bs_\bc_\br_\be_\be_\bn program takes an image of the screen,
+ divides it into a grid, deletes a random square of that
+ grid, and then randomly slides one of the neighbors of
+ this "hole" into the hole (and repeat.)
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bl_\bi_\bd_\be_\bs_\bc_\br_\be_\be_\bn accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-g\bgr\bri\bid\bd-\b-s\bsi\biz\bze\be _\bp_\bi_\bx_\be_\bl_\bs
+ The size of the grid cells. Default 70 pixels.
+
+ -\b-i\bib\bbw\bw _\bp_\bi_\bx_\be_\bl_\bs
+ The size of the "gutter" between grid cells.
+ Default 1 pixel.
+
+ -\b-i\bin\bnc\bcr\bre\bem\bme\ben\bnt\bt _\bp_\bi_\bx_\be_\bl_\bs
+ How many pixels by which a piece should be moved
+ when sliding to a new location. Default 10 pix-
+ els.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation of the motion of each seg-
+ ment. Default 50000, which is 0.05 seconds. This
+ is closely related to the _\b-_\bi_\bn_\bc_\br_\be_\bm_\be_\bn_\bt parameter.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ the end of the motion of one segment and the
+ beginning of the motion of another. Default
+ 1000000, which isone second.
+
+
+
+X Version 11 3-dec-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 3-dec-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 3-dec-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ flame - sucks your screen into a jet engine
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ f\bfl\bla\bam\bme\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-iterations _\bi_\bn_\bt_\be_\bg_\be_\br]
+ [-points _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs] [-delay2 _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\b-
+ _\bo_\bn_\bd_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bl_\bi_\bp program does lots of blits and chews up your
+ screen image.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bf_\bl_\ba_\bm_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 128. The colors used cycle through the
+ hue, making N stops around the color wheel.
+
+ -\b-i\bit\bte\ber\bra\bat\bti\bio\bon\bns\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many fractals to generate. Default 25.
+
+ -\b-p\bpo\boi\bin\bnt\bts\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many pixels to draw for each fractal. Default
+ 10000.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long we should wait between drawing each frac-
+ tal. Default 50000, or about 1/20th second.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How long to frobnicate. Default 50.
+
+
+
+
+
+
+X Version 11 13-aug-92 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many whooziwhatsis. Default 35.
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992 by Scott Draves.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Scott Graves <spot@cs.cmu.edu>.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 18-Oct-93.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-aug-92 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ sphere - draws shaded spheres
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bsp\bph\bhe\ber\bre\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bp_\bh_\be_\br_\be program draws shaded spheres.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bp_\bh_\be_\br_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors are chosen randomly.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1988 by Sun Microsystems, Inc.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+
+
+
+X Version 11 27-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Sun Microsystems, Inc, 1988.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 27-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 27-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ spiral - draws moving circular spiral patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bsp\bpi\bir\bra\bal\bl [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-count _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bp_\bi_\br_\ba_\bl program draws moving circular spiral patterns
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bp_\bi_\br_\ba_\bl accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors are chosen randomly.
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+ Default 40.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ Default 350.
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1994 by Darrick Brown.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Darrick Brown, 1994.
+
+ Improved by Peter Schmitzberger <schmitz@coma.sbg.ac.at>,
+ 24-Jul-95.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ starfish - radially-symmetric throbbing colormap-hacking
+ graphics demo
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bst\bta\bar\brf\bfi\bis\bsh\bh [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground
+ _\bc_\bo_\bl_\bo_\br] [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono]
+ [-install] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-delay _\bu_\bs_\be_\bc_\bs] [-delay2 _\bs_\be_\bc_\bs]
+ [-cycle-delay2 _\bu_\bs_\be_\bc_\bs] [-thickness _\bp_\bi_\bx_\be_\bl_\bs] [-rotation
+ _\bd_\be_\bg_\br_\be_\be_\bs] [-duration _\bs_\be_\bc_\bo_\bn_\bd_\bs] [-colors _\bi_\bn_\bt] [-cycle]
+ [-no-cycle] [-blob] [-no-blob]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bt_\ba_\br_\bf_\bi_\bs_\bh program draws radially symmetric objects,
+ which expand, contract, rotate, and turn inside out. It
+ uses these shapes to lay down a field of smooth colors,
+ and then rotates the colormap.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bt_\ba_\br_\bf_\bi_\bs_\bh accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How much of a delay should be introduced between
+ steps of the animation. Default 10000, or about
+ 1/100th second.
+
+ -\b-c\bcy\byc\bcl\ble\be-\b-d\bde\bel\bla\bay\by _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long to wait between shifing the colormap by
+ one step. Default 100000, or about 1/10th second.
+
+ -\b-t\bth\bhi\bic\bck\bkn\bne\bes\bss\bs _\bp_\bi_\bx_\be_\bl_\bs
+ How wide each color band should be. Default 0,
+ meaning random (the chosen value will be between 0
+ and 15.)
+
+ -\b-r\bro\bot\bta\bat\bti\bio\bon\bn _\bd_\be_\bg_\br_\be_\be_\bs
+ How quickly the objects should rotate at each
+ step. Default 0, meaning random (the chosen value
+
+
+
+X Version 11 14-Jun-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ will be between 0 and 12 degrees.)
+
+ -\b-c\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt
+ How many colors to use. Default 200. The more
+ colors, the smoother the transitions will be, and
+ the nicer the resultant images.
+
+ -\b-c\bcy\byc\bcl\ble\be
+
+ -\b-n\bno\bo-\b-c\bcy\byc\bcl\ble\be
+ Whether to do colormap cycling. Default true.
+
+ -\b-d\bdu\bur\bra\bat\bti\bio\bon\bn _\bs_\be_\bc_\bo_\bn_\bd_\bs
+ How long to run before choosing a new shape.
+ Default 30 seconds.
+
+ -\b-d\bde\bel\bla\bay\by2\b2 _\bs_\be_\bc_\bo_\bn_\bd_\bs
+ When _\bd_\bu_\br_\ba_\bt_\bi_\bo_\bn expires, how long to wait before
+ starting a new run. Default 5 seconds.
+
+ -\b-b\bbl\blo\bob\bb
+
+ -\b-n\bno\bo-\b-b\bbl\blo\bob\bb
+ If _\bb_\bl_\bo_\bb option is specified, then the raw shapes
+ will be shown, instead of a field of colors gener-
+ ated from them.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Jamie Zawinski. Permission to use,
+ copy, modify, distribute, and sell this software and its
+ documentation for any purpose is hereby granted without
+ fee, provided that the above copyright notice appear in
+ all copies and that both that copyright notice and this
+ permission notice appear in supporting documentation. No
+ representations are made about the suitability of this
+ software for any purpose. It is provided "as is" without
+ express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 14-Jun-97.
+
+
+
+
+
+
+X Version 11 14-Jun-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ strange - draws strange attractors
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bst\btr\bra\ban\bng\bge\be [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bt_\br_\ba_\bn_\bg_\be program draws strange attractors
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bt_\br_\ba_\bn_\bg_\be accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 64. The colors are chosen randomly.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1997 by Massimino Pascal.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+
+
+
+X Version 11 10-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ documentation.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Massimino Pascal <Pascal.Massimon@ens.fr>, 1997.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 10-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 10-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ swirl - draws swirly color-cycling patterns
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ s\bsw\bwi\bir\brl\bl [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-ncolors _\bi_\bn_\bt_\be_\bg_\be_\br] [-delay _\bm_\bi_\bc_\br_\bo_\bs_\be_\bc_\bo_\bn_\bd_\bs]
+ [-cycles _\bi_\bn_\bt_\be_\bg_\be_\br] [-count _\bi_\bn_\bt_\be_\bg_\be_\br]
+
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bs_\bw_\bi_\br_\bl program draws swirly color-cycling patterns.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bs_\bw_\bi_\br_\bl accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+ -\b-n\bnc\bco\bol\blo\bor\brs\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+ How many colors should be used (if possible).
+ Default 200.
+
+ -\b-c\bcy\byc\bcl\ble\bes\bs _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+ -\b-c\bco\bou\bun\bnt\bt _\bi_\bn_\bt_\be_\bg_\be_\br
+
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1), x\bxl\blo\boc\bck\bk(1)
+
+
+
+
+
+X Version 11 13-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1994 M. Dobie.
+
+ Permission to use, copy, modify, and distribute this soft-
+ ware and its documentation for any purpose and without fee
+ is hereby granted, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation.
+
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ M.Dobie <mrd@ecs.soton.ac.uk>, 1994.
+
+ Ability to run standalone or with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br added by
+ Jamie Zawinski <jwz@netscape.com>, 13-May-97.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 13-May-97 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ xroger - throbbing X logo, of a sort
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ x\bxr\bro\bog\bge\ber\br [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-foreground _\bc_\bo_\bl_\bo_\br]
+ [-background _\bc_\bo_\bl_\bo_\br] [-window] [-root] [-mono] [-install]
+ [-visual _\bv_\bi_\bs_\bu_\ba_\bl]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bx_\br_\bo_\bg_\be_\br program displays a replacement for the X logo
+ with a more accurate Look and Feel.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bx_\br_\bo_\bg_\be_\br accepts the following options:
+
+ -\b-w\bwi\bin\bnd\bdo\bow\bw Draw on a newly-created window. This is the
+ default.
+
+ -\b-r\bro\boo\bot\bt Draw on the root window.
+
+ -\b-m\bmo\bon\bno\bo If on a color display, pretend we're on a
+ monochrome display.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ Install a private colormap for the window.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which visual to use. Legal values are the
+ name of a visual class, or the id number (decimal
+ or hex) of a specific visual.
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+B\bBU\bUG\bGS\bS
+ It should also drip blood while making a horrible screech-
+ ing noise.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992, 1993 by Jamie Zawinski. Permission to
+ use, copy, modify, distribute, and sell this software and
+ its documentation for any purpose is hereby granted with-
+ out fee, provided fnord that the above copyright notice
+ appear in all copies and that both that copyright notice
+ and this permission notice appear in supporting documenta-
+ tion. No representations are made about the suitability
+
+
+
+X Version 11 22-mar-93 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ of fnord this software for any purpose. It is provided
+ "as is" without express or fnord implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 22-mar-93 2
+
+
--- /dev/null
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ xscreensaver-command - control a running xscreensaver pro-
+ cess
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd [-help] [-demo] [-activate] [-deacti-
+ vate] [-lock] [-cycle] [-next] [-prev] [-exit] [-restart]
+ [-version] [-time]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br_\b-_\bc_\bo_\bm_\bm_\ba_\bn_\bd program controls a running
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br process by sending it client-messages.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br_\b-_\bc_\bo_\bm_\bm_\ba_\bn_\bd accepts the following options:
+
+ -\b-h\bhe\bel\blp\bp Prints a brief summary of command-line options.
+
+ -\b-d\bde\bem\bmo\bo Cause the screensaver to enter its interactive
+ demo mode, in which one can experiment with the
+ various graphics hacks available. See x\bxs\bsc\bcr\bre\bee\ben\bn-\b-
+ s\bsa\bav\bve\ber\br(1) for details.
+
+ -\b-a\bac\bct\bti\biv\bva\bat\bte\be
+ Tell the screensaver to turn on immediately (that
+ is, pretend that the user been idle for long
+ enough.) It will turn off as soon as there is any
+ user activity, as usual.
+
+ It is useful to run this from a menu; you may wish
+ to run it as
+
+ sleep 5 ; xscreensaver-command -activate
+
+ to be sure that you have time to remove your hand
+ from the mouse before the screensaver comes on.
+
+ -\b-d\bde\bea\bac\bct\bti\biv\bva\bat\bte\be
+ Tell the screensaver to turn off, as if there had
+ been user activity. If locking is enabled, then
+ the screensaver will prompt for a password as
+ usual.
+
+ -\b-l\blo\boc\bck\bk Like _\b-_\ba_\bc_\bt_\bi_\bv_\ba_\bt_\be, but a password will be required
+ before the screensaver turns off, even if the
+ screensaver's _\bl_\bo_\bc_\bk resource is false. The display
+ will be locked immediately even if the screen-
+ saver's _\bl_\bo_\bc_\bk_\bT_\bi_\bm_\be_\bo_\bu_\bt resource is non-zero.
+
+ -\b-c\bcy\byc\bcl\ble\be Tell the screensaver to change which graphics hack
+ it is running, just as if the ``cycle'' timer had
+ expired. A new hack will be chosen randomly.
+
+ -\b-n\bne\bex\bxt\bt This is like either _\b-_\ba_\bc_\bt_\bi_\bv_\ba_\bt_\be or _\b-_\bc_\by_\bc_\bl_\be, depending
+
+
+
+X Version 11 31-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ on which is more appropriate, except that the
+ screenhack that will be run is the next one in the
+ list of programs, instead of a randomly-chosen
+ one. Repeatedly executing this will cycle through
+ each hack in turn (though using the _\b-_\bd_\be_\bm_\bo option
+ is probably an easier way to accomplish that.)
+
+ -\b-p\bpr\bre\bev\bv This is like _\b-_\bn_\be_\bx_\bt, but cycles in the other direc-
+ tion.
+
+ -\b-e\bex\bxi\bit\bt Causes the screensaver process to exit gracefully.
+ This is a safer and easier way to kill the screen-
+ saver than by using _\bk_\bi_\bl_\bl.
+
+ W\bWa\bar\brn\bni\bin\bng\bg:\b: never use _\bk_\bi_\bl_\bl _\b-_\b9 with _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br while
+ the screensaver is active. If you are using a
+ virtual root window manager, that can leave things
+ in an inconsistent state, and you may need to
+ restart your window manager to repair the damage.
+
+ -\b-r\bre\bes\bst\bta\bar\brt\bt
+ Causes the screensaver process to exit and then
+ restart with the same command line arguments.
+ This is a good way of causing the screensaver to
+ re-read the resource database.
+
+ If the screensaver is run from _\bx_\bd_\bm_\b(_\b1_\b) (that is, it
+ is already running before you log in) then you may
+ want to issue the ``restart'' command from one of
+ your startup scripts, so that the screensaver gets
+ your resource settings instead of the default
+ ones.
+
+ -\b-v\bve\ber\brs\bsi\bio\bon\bn
+ Print (on stdout) the version number of the
+ xscreensaver program that is running on $DISPLAY.
+ (To see the version number of _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br_\b-_\bc_\bo_\bm_\bm_\ba_\bn_\bd
+ itself, use the _\b-_\bh_\be_\bl_\bp option.)
+
+ -\b-t\bti\bim\bme\be This option prints on stdout the time at which the
+ screensaver last activated (blanked the screen) or
+ deactivated (restored the screen.) Note that the
+ activation-time is not the last time at which the
+ user was active, but is some time later (it is the
+ time at which either: xscreensaver decided that
+ the user has been idle long enough; or, the user
+ explicitly activated the screensaver or locker.)
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the host and display number of the screen
+ whose saver is to be manipulated.
+
+ P\bPA\bAT\bTH\bH to find the executable to restart (for the
+ _\b-_\br_\be_\bs_\bt_\ba_\br_\bt command). Note that this variable is
+
+
+
+X Version 11 31-May-97 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ consulted in the environment of the _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br
+ process, not the _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br_\b-_\bc_\bo_\bm_\bm_\ba_\bn_\bd process.
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br(1)
+
+B\bBU\bUG\bGS\bS
+ Some diagnostics are reported on the stderr of the
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br process, not this process, so the caller of
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br_\b-_\bc_\bo_\bm_\bm_\ba_\bn_\bd may not see the error messages.
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1992, 1993, 1997 by Jamie Zawinski. Permis-
+ sion to use, copy, modify, distribute, and sell this soft-
+ ware and its documentation for any purpose is hereby
+ granted without fee, provided that the above copyright
+ notice appear in all copies and that both that copyright
+ notice and this permission notice appear in supporting
+ documentation. No representations are made about the
+ suitability of this software for any purpose. It is pro-
+ vided "as is" without express or implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 31-May-97 3
+
+
--- /dev/null
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+ 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+N\bNA\bAM\bME\bE
+ xscreensaver - graphics hack and screen locker, launched
+ when the user is idle
+
+S\bSY\bYN\bNO\bOP\bPS\bSI\bIS\bS
+ x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br [-display _\bh_\bo_\bs_\bt_\b:_\bd_\bi_\bs_\bp_\bl_\ba_\by_\b._\bs_\bc_\br_\be_\be_\bn] [-timeout _\bi_\bn_\bt]
+ [-cycle _\bi_\bn_\bt] [-nice _\bi_\bn_\bt] [-lock] [-no-lock] [-lock-timeout
+ _\bi_\bn_\bt] [-demo] [-visual _\bv_\bi_\bs_\bu_\ba_\bl] [-install] [-no-install]
+ [-verbose] [-silent] [-xidle-extension] [-no-xidle-exten-
+ sion] [-sgi-extension] [-no-sgi-extension] [-mit-exten-
+ sion] [-no-mit-extension] [-xrm _\br_\be_\bs_\bo_\bu_\br_\bc_\be_\bs]
+
+D\bDE\bES\bSC\bCR\bRI\bIP\bPT\bTI\bIO\bON\bN
+ The _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br program waits until the keyboard and
+ mouse have been idle for a period, and then runs a graph-
+ ics demo chosen at random. It turns off as soon as there
+ is any mouse or keyboard activity.
+
+ This program can lock your terminal in order to prevent
+ others from using it, though its default mode of operation
+ is merely to display pretty pictures on your screen when
+ it is not in use.
+
+ The benefit that this program has over the combination of
+ the x\bxl\blo\boc\bck\bk(1) and x\bxa\bau\but\bto\bol\blo\boc\bck\bk(1) programs is the ease with
+ which new graphics hacks can be installed. You don't need
+ to recompile (or even re-run) this program to add a new
+ display mode.
+
+O\bOP\bPT\bTI\bIO\bON\bNS\bS
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br accepts the following command line options:
+
+ -\b-t\bti\bim\bme\beo\bou\but\bt _\bm_\bi_\bn_\bu_\bt_\be_\bs
+ The screensaver will activate after the keyboard
+ and mouse have been idle for this many minutes.
+ Default 10.
+
+ -\b-c\bcy\byc\bcl\ble\be _\bm_\bi_\bn_\bu_\bt_\be_\bs
+ After the screensaver has been running for this
+ many minutes, the currently running graphics hack
+ sub-process will be killed (with S\bSI\bIG\bGT\bTE\bER\bRM\bM), and a
+ new one started. If this is 0, then the graphics
+ hack will not be changed: only one demo will run
+ until the screensaver is deactivated by user
+ activity. Default 10.
+
+ -\b-n\bni\bic\bce\be _\bi_\bn_\bt_\be_\bg_\be_\br
+ The sub-processes created by _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br will be
+ ``niced'' to this level, so that they are given
+ lower priority than other processes on the system,
+ and don't increase the load unnecessarily. The
+ default is 20.
+
+ (Higher numbers mean lower priority; see n\bni\bic\bce\be(1)
+
+
+
+X Version 11 31-May-97 1
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ for details.)
+
+ -\b-l\blo\boc\bck\bk Enable locking: before the screensaver will turn
+ off, it requires you to type the password of the
+ person who launched the screensaver, or the root
+ password. (Note: this doesn't work if the screen-
+ saver is launched by x\bxd\bdm\bm(1) because it can't know
+ the user-id of the logged-in user.)
+
+ -\b-n\bno\bo-\b-l\blo\boc\bck\bk
+ Disable locking. This is the default.
+
+ -\b-l\blo\boc\bck\bk-\b-t\bti\bim\bme\beo\bou\but\bt _\bm_\bi_\bn_\bu_\bt_\be_\bs
+ This is how long after the screensaver activates
+ that locking is enabled. For example, if this is
+ 5, and _\b-_\bt_\bi_\bm_\be_\bo_\bu_\bt is 10, then after 10 minutes, the
+ screen would blank. If there was user activity at
+ 12 minutes, no password would be required. But,
+ if there was user activity at 15 minutes or later
+ (_\b-_\bl_\bo_\bc_\bk_\b-_\bt_\bi_\bm_\be_\bo_\bu_\bt minutes after activation) then a
+ password would be required. The default is 0,
+ meaning that if locking is enabled, then a pass-
+ word will be required as soon as the screensaver
+ activates.
+
+ -\b-d\bde\bem\bmo\bo Enter the interactive demo mode immediately after
+ startup. Normally demo mode is invoked via the
+ x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd(1) program, but this is a
+ shortcut for new users. See below for a descrip-
+ tion of how demo-mode works.
+
+ -\b-v\bvi\bis\bsu\bua\bal\bl _\bv_\bi_\bs_\bu_\ba_\bl
+ Specify which X visual to use by default. Legal
+ values are:
+
+ d\bde\bef\bfa\bau\bul\blt\bt Use the screen's default visual (the
+ visual of the root window.) This is the
+ default.
+
+ b\bbe\bes\bst\bt Use the visual which supports the most
+ colors. Note, however, that the visual
+ with the most colors might be a TrueColor
+ visual, which does not support colormap
+ animation.
+
+ m\bmo\bon\bno\bo Use a monochrome visual, if there is one.
+
+ g\bgr\bra\bay\by Use a grayscale or staticgray visual, if
+ there is one and it has more than one
+ plane (that is, it's not monochrome.)
+
+ c\bco\bol\blo\bor\br Use the best of the color visuals, if
+ there are any.
+
+
+
+
+X Version 11 31-May-97 2
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ _\bc_\bl_\ba_\bs_\bs where _\bc_\bl_\ba_\bs_\bs is one
+
+ of S\bSt\bta\bat\bti\bic\bcG\bGr\bra\bay\by, S\bSt\bta\bat\bti\bic\bcC\bCo\bol\blo\bor\br, T\bTr\bru\bue\beC\bCo\bol\blo\bor\br,
+ G\bGr\bra\bay\byS\bSc\bca\bal\ble\be, P\bPs\bse\beu\bud\bdo\boC\bCo\bol\blo\bor\br, or D\bDi\bir\bre\bec\bct\btC\bCo\bol\blo\bor\br.
+ Selects the deepest visual of the given
+ class.
+
+ _\bn_\bu_\bm_\bb_\be_\br where _\bn_\bu_\bm_\bb_\be_\br (decimal or hex) is inter-
+ preted as a visual id number, as reported
+ by the x\bxd\bdp\bpy\byi\bin\bnf\bfo\bo(1) program; in this way
+ you can have finer control over exactly
+ which visual gets used, for example, to
+ select a shallower one than would other-
+ wise have been chosen.
+
+ Note that this option specifies only the _\bd_\be_\bf_\ba_\bu_\bl_\bt
+ visual that will be used: the visual used may be
+ overridden on a program-by-program basis. See the
+ description of the p\bpr\bro\bog\bgr\bra\bam\bms\bs resource, below.
+
+ -\b-i\bin\bns\bst\bta\bal\bll\bl
+ When using a non-default visual, install a private
+ colormap while the screensaver is active, so that
+ the graphics hacks can get as many colors as pos-
+ sible. This is the default. (This only applies
+ when the screen's default visual is being used,
+ since non-default visuals get their own colormaps
+ automatically.)
+
+ -\b-n\bno\bo-\b-i\bin\bns\bst\bta\bal\bll\bl
+ Use the default colormap.
+
+ -\b-v\bve\ber\brb\bbo\bos\bse\be
+ Print diagnostics.
+
+ -\b-s\bsi\bil\ble\ben\bnt\bt
+
+ -\b-x\bxi\bid\bdl\ble\be-\b-e\bex\bxt\bte\ben\bns\bsi\bio\bon\bn
+ Use the X\bXI\bID\bDL\bLE\bE server extension to decide whether
+ the user is idle. This is the default if _\bx_\bs_\bc_\br_\be_\be_\bn_\b-
+ _\bs_\ba_\bv_\be_\br has been compiled with support for this
+ extension. On X11R4 or X11R5 systems, the XIdle
+ method is faster and more reliable than what will
+ be done otherwise, so use it if you can.
+
+ -\b-n\bno\bo-\b-x\bxi\bid\bdl\ble\be-\b-e\bex\bxt\bte\ben\bns\bsi\bio\bon\bn
+ Don't use the X\bXI\bID\bDL\bLE\bE server extension.
+
+ -\b-s\bsg\bgi\bi-\b-e\bex\bxt\bte\ben\bns\bsi\bio\bon\bn
+ Use the SGI S\bSC\bCR\bRE\bEE\bEN\bN_\b_S\bSA\bAV\bVE\bER\bR server extension to
+ decide whether the user is idle. This is the
+ default if _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br has been compiled with
+ support for this extension (which is the default
+ on SGI systems.). If it is available, the
+
+
+
+X Version 11 31-May-97 3
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ S\bSC\bCR\bRE\bEE\bEN\bN_\b_S\bSA\bAV\bVE\bER\bR method is faster and more reliable
+ than what will be done otherwise, so use it if you
+ can.
+
+ -\b-n\bno\bo-\b-s\bsg\bgi\bi-\b-e\bex\bxt\bte\ben\bns\bsi\bio\bon\bn
+ Don't use the SGI S\bSC\bCR\bRE\bEE\bEN\bN_\b_S\bSA\bAV\bVE\bER\bR server extension.
+
+ -\b-m\bmi\bit\bt-\b-e\bex\bxt\bte\ben\bns\bsi\bio\bon\bn
+ Use the M\bMI\bIT\bT-\b-S\bSC\bCR\bRE\bEE\bEN\bN-\b-S\bSA\bAV\bVE\bER\bR server extension to
+ decide whether the user is idle. This is the
+ default if _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br has been compiled with
+ support for this extension. However, this exten-
+ sion is flaky, so it's use is not really recom-
+ mended. (It also makes the _\bf_\ba_\bd_\be option not work
+ properly.)
+
+ -\b-n\bno\bo-\b-m\bmi\bit\bt-\b-e\bex\bxt\bte\ben\bns\bsi\bio\bon\bn
+ Don't use the M\bMI\bIT\bT-\b-S\bSC\bCR\bRE\bEE\bEN\bN-\b-S\bSA\bAV\bVE\bER\bR server extension.
+
+X\bX R\bRE\bES\bSO\bOU\bUR\bRC\bCE\bES\bS
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br understands the following resources:
+
+
+ t\bti\bim\bme\beo\bou\but\bt (class T\bTi\bim\bme\be)
+ Same as the _\b-_\bt_\bi_\bm_\be_\bo_\bu_\bt command-line option. Default
+ 10 minutes.
+
+ c\bcy\byc\bcl\ble\be (class T\bTi\bim\bme\be)
+ Same as the _\b-_\bc_\by_\bc_\bl_\be command-line option. Default
+ 10 minutes.
+
+ n\bni\bic\bce\be (class N\bNi\bic\bce\be)
+ Same as the _\b-_\bn_\bi_\bc_\be command-line option. Default
+ 10.
+
+ l\blo\boc\bck\bk (class B\bBo\boo\bol\ble\bea\ban\bn)
+ Same as the _\b-_\bl_\bo_\bc_\bk command-line option.
+
+ l\blo\boc\bck\bkT\bTi\bim\bme\beo\bou\but\bt (class T\bTi\bim\bme\be)
+ Same as the _\b-_\bl_\bo_\bc_\bk_\b-_\bt_\bi_\bm_\be_\bo_\bu_\bt command-line option.
+
+ p\bpa\bas\bss\bsw\bwd\bdT\bTi\bim\bme\beo\bou\but\bt (class T\bTi\bim\bme\be)
+ If the screen is locked, then this is how many
+ seconds the password dialog box should be left on
+ the screen before giving up (default 30.) This
+ should not be too large: the X server is grabbed
+ for the duration that the password dialog box is
+ up (for security purposes) and leaving the server
+ grabbed for too long can cause problems.
+
+ v\bve\ber\brb\bbo\bos\bse\be (class B\bBo\boo\bol\ble\bea\ban\bn)
+ Same as the _\b-_\bv_\be_\br_\bb_\bo_\bs_\be command-line option.
+
+
+
+
+
+X Version 11 31-May-97 4
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ x\bxi\bid\bdl\ble\be (class B\bBo\boo\bol\ble\bea\ban\bn)
+ Same as the _\b-_\bx_\bi_\bd_\bl_\be command-line option.
+
+ f\bfa\bad\bde\be (class B\bBo\boo\bol\ble\bea\ban\bn)
+ If this is true, then when the screensaver acti-
+ vates, the current contents of the screen will
+ fade to black instead of simply winking out. This
+ only works on displays with writable colormaps,
+ that is, if the screen's default visual is a Pseu-
+ doColor visual. Default true. A fade will also
+ be done when switching graphics hacks (when the
+ _\bc_\by_\bc_\bl_\be timer expires.)
+
+ u\bun\bnf\bfa\bad\bde\be (class B\bBo\boo\bol\ble\bea\ban\bn)
+ If this is true, then when the screensaver deacti-
+ vates, the original contents of the screen will
+ fade in from black instead of appearing immedi-
+ ately. This only works on displays with writable
+ colormaps, and if _\bf_\ba_\bd_\be is true as well. Default
+ false.
+
+ f\bfa\bad\bde\beS\bSe\bec\bco\bon\bnd\bds\bs (class T\bTi\bim\bme\be)
+ If _\bf_\ba_\bd_\be is true, this is how long the fade will be
+ in seconds (default 3.)
+
+ f\bfa\bad\bde\beT\bTi\bic\bck\bks\bs (class I\bIn\bnt\bte\beg\bge\ber\br)
+ If _\bf_\ba_\bd_\be is true, this is how many times a second
+ the colormap will be changed to effect a fade.
+ Higher numbers yield smoother fades, but may make
+ the fades take longer than the specified _\bf_\ba_\bd_\be_\bS_\be_\bc_\b-
+ _\bo_\bn_\bd_\bs if your server isn't fast enough to keep up.
+ Default 20.
+
+ v\bvi\bis\bsu\bua\bal\blI\bID\bD (class V\bVi\bis\bsu\bua\bal\blI\bID\bD)
+ Same as the _\b-_\bv_\bi_\bs_\bu_\ba_\bl command-line option. Default
+ d\bde\bef\bfa\bau\bul\blt\bt.
+
+ i\bin\bns\bst\bta\bal\bll\blC\bCo\bol\blo\bor\brm\bma\bap\bp (class B\bBo\boo\bol\ble\bea\ban\bn)
+ Same as the _\b-_\bi_\bn_\bs_\bt_\ba_\bl_\bl command-line option. Default
+ true.
+
+ c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bde\ber\brr\br (class B\bBo\boo\bol\ble\bea\ban\bn)
+ Whether _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br should redirect its standard-
+ error stream to the window itself. Since its
+ nature is to take over the screen, you would not
+ normally see error messages generated by the
+ screensaver or the programs it runs; this resource
+ will cause the output of all relevant programs to
+ be drawn on the screensaver window itself instead
+ of written to the controlling terminal of the
+ screensaver driver process. Default true.
+
+ c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bdo\bou\but\bt (class B\bBo\boo\bol\ble\bea\ban\bn)
+ Like c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bde\ber\brr\br but for the standard-output
+
+
+
+X Version 11 31-May-97 5
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ stream. Default true.
+
+ f\bfo\bon\bnt\bt (class F\bFo\bon\bnt\bt)
+ The font used for the stdout/stderr text, if c\bca\bap\bp-\b-
+ t\btu\bur\bre\beS\bSt\btd\bdo\bou\but\bt or c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bde\ber\brr\br are true. Default
+ *\b*-\b-m\bme\bed\bdi\biu\bum\bm-\b-r\br-\b-*\b*-\b-1\b14\b40\b0-\b-*\b*-\b-m\bm-\b-*\b* (a 14 point fixed-width
+ font.)
+
+ t\bte\bex\bxt\btF\bFo\bor\bre\beg\bgr\bro\bou\bun\bnd\bd (class F\bFo\bor\bre\beg\bgr\bro\bou\bun\bnd\bd)
+ The foreground color used for the stdout/stderr
+ text, if c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bdo\bou\but\bt or c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bde\ber\brr\br are true.
+ Default: Yellow.
+
+ t\bte\bex\bxt\btB\bBa\bac\bck\bkg\bgr\bro\bou\bun\bnd\bd (class B\bBa\bac\bck\bkg\bgr\bro\bou\bun\bnd\bd)
+ The background color used for the stdout/stderr
+ text, if c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bdo\bou\but\bt or c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bde\ber\brr\br are true.
+ Default: Black.
+
+ p\bpr\bro\bog\bgr\bra\bam\bms\bs (class P\bPr\bro\bog\bgr\bra\bam\bms\bs)
+ The graphics hacks which _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br runs when
+ the user is idle. The value of this resource is a
+ string, one _\bs_\bh-syntax command per line. Each line
+ must contain exactly one command -- no semicolons,
+ no ampersands.
+
+ When the screensaver starts up, one of these is
+ selected at random, and run. After the _\bc_\by_\bc_\bl_\be
+ period expires, it is killed, and another is
+ selected and run.
+
+ If the value of this resource is empty, then no
+ programs will be run; the screen will simply be
+ made black.
+
+ If the display has multiple screens, then a dif-
+ ferent program will be run for each screen.
+
+ Note that you must escape the newlines; here is an
+ example of how you might set this in your _\b._\bX_\bd_\be_\b-
+ _\bf_\ba_\bu_\bl_\bt_\bs file:
+
+ xscreensaver.programs: \
+ qix -root \n\
+ ico -r -faces -sleep 1 -obj ico \n\
+ xdaliclock -builtin2 -root \n\
+ xv -root -rmode 5 image.gif -quit \n
+
+ To use a program as a screensaver, two things are
+ required: that that program draw on the root win-
+ dow (or be able to be configured to draw on the
+ root window); and that that program understand
+ ``virtual root'' windows, as used by virtual win-
+ dow managers such as _\bt_\bv_\bt_\bw_\bm. (Generally, this is
+ accomplished by just including the _\b"_\bv_\br_\bo_\bo_\bt_\b._\bh_\b"
+
+
+
+X Version 11 31-May-97 6
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ header file in the program's source.)
+
+ If there are some programs that you want to run
+ only when using a color display, and others that
+ you want to run only when using a monochrome dis-
+ play, you can specify that like this:
+
+ mono: mono-program -root \n\
+ color: color-program -root \n\
+
+ More generally, you can specify the kind of visual
+ that should be used for the window on which the
+ program will be drawing. For example, if one pro-
+ gram works best if it has a colormap, but another
+ works best if it has a 24-bit visual, both can be
+ accomidated:
+
+ PseudoColor: cmap-program -root \n\
+ TrueColor: 24bit-program -root \n\
+
+ (This sort of thing used to be accomplished with
+ the _\bc_\bo_\bl_\bo_\br_\bP_\br_\bo_\bg_\br_\ba_\bm_\bs and _\bm_\bo_\bn_\bo_\bP_\br_\bo_\bg_\br_\ba_\bm_\bs resources, but
+ those resources have now been removed; a warning
+ will be issued if they are used.)
+
+ If you specify a particular visual for a program,
+ and that visual does not exist on the screen, then
+ that program will not be chosen to run. This
+ means that on displays with multiple screens of
+ different depths, you can arrange for appropriate
+ hacks to be run on each. For example, if one
+ screen is color and the other is monochrome, hacks
+ that look good in mono can be run on one, and
+ hacks that only look good in color will show up on
+ the other.
+
+
+ Normally you won't need to change the following resources:
+
+ b\bbo\bou\bur\brn\bne\beS\bSh\bhe\bel\bll\bl (class B\bBo\bou\bur\brn\bne\beS\bSh\bhe\bel\bll\bl)
+ The pathname of the shell that _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br uses
+ to start subprocesses. This must be whatever your
+ local variant of /\b/b\bbi\bin\bn/\b/s\bsh\bh is -- in particular, it
+ must not be c\bcs\bsh\bh.
+
+ w\bwi\bin\bnd\bdo\bow\bwC\bCr\bre\bea\bat\bti\bio\bon\bnT\bTi\bim\bme\beo\bou\but\bt (class T\bTi\bim\bme\be)
+ When server extensions are not in use, this con-
+ trols the delay between when windows are created
+ and when _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br selects events on them.
+ Default 30 seconds.
+
+ p\bpo\boi\bin\bnt\bte\ber\brP\bPo\bol\bll\blT\bTi\bim\bme\be (class T\bTi\bim\bme\be)
+ When server extensions are not in use, this con-
+ trols how frequently _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br checks to see if
+
+
+
+X Version 11 31-May-97 7
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ the mouse position or buttons have changed.
+ Default 5 seconds.
+
+ i\bin\bni\bit\bti\bia\bal\blD\bDe\bel\bla\bay\by (class T\bTi\bim\bme\be)
+ When server extensions are not in use, _\bx_\bs_\bc_\br_\be_\be_\bn_\b-
+ _\bs_\ba_\bv_\be_\br will wait this many seconds before selecting
+ events on existing windows, under the assumption
+ that _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br is started during your login
+ procedure, and the window state may be in flux.
+ Default 30 seconds.
+
+ o\bov\bve\ber\brl\bla\bay\byS\bSt\btd\bde\ber\brr\br (class B\bBo\boo\bol\ble\bea\ban\bn)
+ If c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bde\ber\brr\br or c\bca\bap\bpt\btu\bur\bre\beS\bSt\btd\bdo\bou\but\bt are True, and
+ your server supports ``overlay'' visuals, then the
+ text will be written into one of the higher layers
+ instead of into the same layer as the running
+ screenhack. Set this to False to disable that
+ (though you shouldn't need to.)
+
+H\bHO\bOW\bW I\bIT\bT W\bWO\bOR\bRK\bKS\bS
+ When it is time to activate the screensaver, a full-screen
+ black window is created on each screen of the display.
+ The window or windows is given the appropriate properties
+ so that, to any subsequently-created programs, it will
+ appear to be a ``virtual root'' window. Because of this,
+ any program which draws on the root window (and which
+ understands virtual roots) can be used as a screensaver.
+
+ When the user becomes active again, the screensaver win-
+ dows are unmapped and the running subprocesses are killed
+ by sending them S\bSI\bIG\bGT\bTE\bER\bRM\bM. This is also how the subpro-
+ cesses are killed when the screensaver decides that it's
+ time to run a different demo: the old one is killed and a
+ new one is launched.
+
+ Before launching a subprocess, _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br stores an
+ appropriate value for $\b$D\bDI\bIS\bSP\bPL\bLA\bAY\bY in the environment that the
+ child will recieve. (This is so that if you start
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br with a _\b-_\bd_\bi_\bs_\bp_\bl_\ba_\by argument, the programs which
+ _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br launches will draw on the same display; and
+ so that the child will end up drawing on the appropriate
+ screen of a multi-headed display.)
+
+ When the screensaver turns off, or is killed, care is
+ taken to restore the ``real'' virtual root window if there
+ is one. Because of this, it is important that you not
+ kill the screensaver process with _\bk_\bi_\bl_\bl _\b-_\b9 if you are run-
+ ning a virtual-root window manager. If you kill it with
+ -9, you may need to restart your window manager to repair
+ the damage. This isn't an issue if you aren't running a
+ virtual-root window manager.
+
+ For all the gory details, see the commentary at the top of
+ xscreensaver.c.
+
+
+
+X Version 11 31-May-97 8
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ You can control a running screensaver process by using the
+ x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd(1) program (which see.)
+
+U\bUS\bSI\bIN\bNG\bG X\bXD\bDM\bM(\b(1\b1)\b)
+ You can run _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br from your xdm session, so that
+ the screensaver will run even when nobody is logged in on
+ the console. Simply add "\b"x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br &\b&"\b" to your
+ _\b/_\bu_\bs_\br_\b/_\bl_\bi_\bb_\b/_\bX_\b1_\b1_\b/_\bx_\bd_\bm_\b/_\bX_\bs_\be_\bt_\bu_\bp file. Because _\bx_\bd_\bm grabs the key-
+ board, keypresses will not make the screensaver deacti-
+ vate, but any mouse activity will.
+
+ (If your system does not seem to be executing the _\bX_\bs_\be_\bt_\bu_\bp
+ file, you may need to configure it to do so -- the tradi-
+ tional way to do this is to make that file the value of
+ the _\bD_\bi_\bs_\bp_\bl_\ba_\by_\bM_\ba_\bn_\ba_\bg_\be_\br_\b*_\bs_\be_\bt_\bu_\bp resource in the _\bx_\bd_\bm_\b-_\bc_\bo_\bn_\bf_\bi_\bg file.
+ See the man page for x\bxd\bdm\bm(1) for more details.)
+
+ Users may want to add "\b"x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd -\b-r\bre\bes\bst\bta\bar\brt\bt"\b" to
+ their startup scripts, so that the screensaver will be
+ reinitialized with their private resource settings when
+ they log in.
+
+ It is safe to run this program as root (as _\bx_\bd_\bm is likely
+ to do.) If run as root, _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br changes its effec-
+ tive user and group ids to something safe (like _\b"_\bn_\bo_\bb_\bo_\bd_\by_\b")
+ before connecting to the X server or launching user-speci-
+ fied programs.
+
+ Locking doesn't work if the screensaver is launched by
+ _\bx_\bd_\bm. To get around this, you can run the screensaver from
+ _\bx_\bd_\bm without locking, and kill and restart it from your
+ personal X startup script to enable locking; for example:
+
+ xscreensaver-command -exit ; xscreensaver
+
+
+D\bDE\bEM\bMO\bO M\bMO\bOD\bDE\bE
+ If _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br receives the D\bDE\bEM\bMO\bO ClientMessage, which is
+ done by running the x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd program with the
+ -\b-d\bde\bem\bmo\bo option, the screensaver will black the screen and
+ pop up a dialog box from which you can examine and experi-
+ ment with the client programs.
+
+ The dialog box contains a scrolling list, a text field,
+ and a number of buttons.
+
+ Double-clicking on one of the programs in the list will
+ run it. Clicking the mouse again will bring the dialog
+ box back.
+
+ Single-clicking in the list will place the indicated pro-
+ gram and its args in the text field to be edited. Edit
+ the arguments and hit return to run the program with the
+ parameters you have specified. (Note that these are one-
+
+
+
+X Version 11 31-May-97 9
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ time changes and won't be remembered; to make the changes
+ permanent, you need to edit your X resource file.)
+
+ The buttons are:
+
+ R\bRu\bun\bn N\bNe\bex\bxt\bt
+ Clicking this button will run the next program in
+ the list after the currently-selected one, and
+ will scroll around to the top when it reaches the
+ bottom.
+
+ R\bRu\bun\bn P\bPr\bre\bev\bvi\bio\bou\bus\bs
+ Opposite of Run Next; at the top, it scrolls
+ around to the bottom.
+
+ E\bEd\bdi\bit\bt P\bPa\bar\bra\bam\bme\bet\bte\ber\brs\bs
+ This pops up a second dialog box, in which you
+ have the option to interactively change most of
+ the screensaver's operational parameters, such as
+ its timeouts, and whether it should lock the
+ screen. Changing these parameters here will
+ affect only the running _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br process; to
+ make the changes permanent, you need to edit your
+ X resource file.
+
+ E\bEx\bxi\bit\bt D\bDe\bem\bmo\bo M\bMo\bod\bde\be
+ Returns to normal screensaver operation.
+
+ R\bRe\bei\bin\bni\bit\bti\bia\bal\bli\biz\bze\be
+ This causes the X resource database to be re-read,
+ to pick up any changes you might have made. This
+ works by causing the screensaver process to exit
+ and then restart itself with the same command-line
+ arguments. This is just like the _\b-_\br_\be_\bs_\bt_\ba_\br_\bt argu-
+ ment to x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd(1) except that when
+ executed from this button, the screensaver will
+ automatically return to demo mode after restart-
+ ing.
+
+B\bBU\bUG\bGS\bS
+ (This is not a bug, but) note that as of release 1.32, the
+ c\bco\bol\blo\bor\brP\bPr\bro\bog\bgr\bra\bam\bms\bs and m\bmo\bon\bno\boP\bPr\bro\bog\bgr\bra\bam\bms\bs resources are no longer
+ used: they have been supplanted by the extended syntax of
+ the p\bpr\bro\bog\bgr\bra\bam\bms\bs resource (see above.)
+
+ Extensions
+ If you are not making use of one of the server
+ extensions (X\bXI\bID\bDL\bLE\bE, S\bSC\bCR\bRE\bEE\bEN\bN_\b_S\bSA\bAV\bVE\bER\bR, or M\bMI\bIT\bT-\b-S\bSC\bCR\bRE\bEE\bEN\bN-\b-
+ S\bSA\bAV\bVE\bER\bR), then it is possible, in rare situations,
+ for _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br to interfere with event propaga-
+ tion and make another X program malfunction. For
+ this to occur, that other application would need
+ to _\bn_\bo_\bt select K\bKe\bey\byP\bPr\bre\bes\bss\bs events on its non-leaf win-
+ dows within the first 30 seconds of their
+
+
+
+X Version 11 31-May-97 10
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ existence, but then select for them later. In
+ this case, that client _\bm_\bi_\bg_\bh_\bt fail to receive those
+ events. This isn't very likely, since programs
+ generally select a constant set of events immedi-
+ ately after creating their windows and then don't
+ change them, but this is the reason that it's a
+ good idea to install and use one of the server
+ extensions instead, to work around this shortcom-
+ ing in the X protocol.
+
+ Machine Load
+ Although this program ``nices'' the subprocesses
+ that it starts, graphics-intensive subprograms can
+ still overload the machine by causing the X server
+ process itself (which is not ``niced'') to suck a
+ lot of cycles. Care should be taken to slow down
+ programs intended for use as screensavers by
+ inserting strategic calls to s\bsl\ble\bee\bep\bp(3) or u\bus\bsl\ble\bee\bep\bp(3)
+ (or making liberal use of any _\b-_\bd_\be_\bl_\ba_\by options which
+ the programs may provide.)
+
+ Also, an active screensaver will cause your X
+ server to be pretty much permanently swapped in;
+ but the same is true of any program that draws
+ periodically, like x\bxc\bcl\blo\boc\bck\bk(1) or x\bxl\blo\boa\bad\bd(1).
+
+ Latency and Responsiveness
+ If the subprocess is drawing too quickly and the
+ connection to the X server is a slow one (such as
+ an X terminal running over a phone line) then the
+ screensaver might not turn off right away when the
+ user becomes active again (the i\bic\bco\bo(1) demo has
+ this problem if being run in full-speed mode).
+ This can be alleviated by inserting strategic
+ calls to X\bXS\bSy\byn\bnc\bc(3) in code intended for use as a
+ screensaver. This prevents too much graphics
+ activity from being buffered up.
+
+ Locking and XDM
+ Locking doesn't work if the screensaver is
+ launched by _\bx_\bd_\bm. The reason for this is that when
+ it is launched by _\bx_\bd_\bm, the screensaver process is
+ owned by some standard user id (such as _\br_\bo_\bo_\bt or
+ _\bd_\ba_\be_\bm_\bo_\bn) instead of the user who is logged in on
+ the console: because the screensaver was started
+ _\bb_\be_\bf_\bo_\br_\be anyone was logged in. In order for the
+ screensaver to prompt for the password of the per-
+ son who had logged in from _\bx_\bd_\bm, it would need to
+ know who that user was, and there is no reliable
+ and safe way to figure that out. (And even if
+ there was, there would be some other security
+ issues here as well.)
+
+ So if you want to use it as a locker, you must
+
+
+
+X Version 11 31-May-97 11
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ start it with your user id. If it has already
+ been started by _\bx_\bd_\bm, you can kill it with x\bxs\bsc\bcr\bre\bee\ben\bn-\b-
+ s\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd -\b-e\bex\bxi\bit\bt, and then start it again as
+ you.
+
+ Passwords
+ If you get an error message like ``couldn't get
+ password of _\bu_\bs_\be_\br'' then this probably means that
+ you're on a system in which the g\bge\bet\btp\bpw\bwe\ben\bnt\bt(3)
+ library routine can only be effectively used by
+ root. If this is the case, then _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br must
+ be installed as setuid to root. Care has been
+ taken to make this a safe thing to do.
+
+ It also may mean that your system uses shadow
+ passwords instead of the standard _\bg_\be_\bt_\bp_\bw_\be_\bn_\bt inter-
+ face; in that case, you may need to change some
+ options in _\bc_\bo_\bn_\bf_\bi_\bg_\b._\bh and recompile.
+
+ TWM and Colormaps
+ The i\bin\bns\bst\bta\bal\bll\blC\bCo\bol\blo\bor\brm\bma\bap\bp option doesn't work very well
+ with the t\btw\bwm\bm(1) window manager and its descen-
+ dants.
+
+ There is a race condition between the screensaver
+ and this window manager, which can result in the
+ screensaver's colormap not getting installed prop-
+ erly, meaning the graphics hacks will appear in
+ essentially random colors. (If the screen goes
+ white instead of black, this is probably why.)
+
+ The m\bmw\bwm\bm(1) and o\bol\blw\bwm\bm(1) window managers don't seem
+ to have this problem. The race condition exists
+ because X apparently does not provide a way for an
+ OverrideRedirect window to have its own colormap,
+ short of grabbing the server (which is neither a
+ good idea, nor really possible with the current
+ design.) What happens is that, as soon as the
+ screensaver installs its colormap, t\btw\bwm\bm responds to
+ the C\bCo\bol\blo\bor\brm\bma\bap\bpN\bNo\bot\bti\bif\bfy\by event that is generated by re-
+ instaling the default colormap. Apparently, t\btw\bwm\bm
+ doesn't _\ba_\bl_\bw_\ba_\by_\bs do this; it seems to do it regu-
+ larly if the screensaver is activated from a menu
+ item, but seems to not do it if the screensaver
+ comes on of its own volition, or is activated from
+ another console. Any thoughts on this problem are
+ welcome...
+
+ XView Clients
+ Apparently there are some problems with XView pro-
+ grams getting confused and thinking that the
+ screensaver window is the real root window even
+ when the screensaver is not active: ClientMessages
+ intended for the window manager are sent to the
+
+
+
+X Version 11 31-May-97 12
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ screensaver window instead. This could be solved
+ by making xscreensaver forward all unrecognised
+ ClientMessages to the real root window, but there
+ may be other problems as well. If anyone has any
+ insight on the cause of this problem, please let
+ me know.
+
+ MIT Extension and Fading
+ When using the M\bMI\bIT\bT-\b-S\bSC\bCR\bRE\bEE\bEN\bN-\b-S\bSA\bAV\bVE\bER\bR extension in con-
+ junction with the f\bfa\bad\bde\be option, you may notice an
+ unattractive flicker just before the fade begins.
+ This is because the server maps a black window
+ just before it tells the _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br process to
+ activate. The _\bx_\bs_\bc_\br_\be_\be_\bn_\bs_\ba_\bv_\be_\br process immediately
+ unmaps that window, but this results in a flicker.
+ I haven't figured a way to get around this; it
+ seems to be a fundamental property of the (mis-)
+ design of this server extension.
+
+ LessTif (Motif Clone)
+ Rumor has it that demo mode is buggy if XScreen-
+ Saver was compiled with the GNU LessTif reimple-
+ mentation of Motif. Since it works fine with OSF
+ Motif on a variety of systems, I assume these
+ problems are due to bugs in LessTif. Again, any
+ insight would be appreciated.
+
+ Red Hot Lava
+ There need to be a lot more graphics hacks. In
+ particular, there should be a simulation of a
+ Lavalite (tm).
+
+E\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ D\bDI\bIS\bSP\bPL\bLA\bAY\bY to get the default host and display number, and to
+ inform the sub-programs of the screen on which to
+ draw.
+
+ X\bXE\bEN\bNV\bVI\bIR\bRO\bON\bNM\bME\bEN\bNT\bT
+ to get the name of a resource file that overrides
+ the global resources stored in the RESOURCE_MAN-
+ AGER property.
+
+U\bUP\bPG\bGR\bRA\bAD\bDE\bES\bS
+ The latest version can always be found at http://peo-
+ ple.netscape.com/jwz/xscreensaver/
+
+S\bSE\bEE\bE A\bAL\bLS\bSO\bO
+ X\bX(1), x\bxs\bsc\bcr\bre\bee\ben\bns\bsa\bav\bve\ber\br-\b-c\bco\bom\bmm\bma\ban\bnd\bd(1), x\bxl\blo\boc\bck\bk(1), x\bxn\bnl\blo\boc\bck\bk(1), x\bxa\bau\bu-\b-
+ t\bto\bol\blo\boc\bck\bk(1), x\bxd\bdm\bm(1), a\bat\btt\btr\bra\bac\bct\bti\bio\bon\bn(1), g\bgr\bre\bey\byn\bne\bet\bti\bic\bc(1), h\bhe\bel\bli\bix\bx(1),
+ h\bho\bop\bpa\bal\blo\bon\bng\bg(1), n\bno\bos\bse\beg\bgu\buy\by(1), p\bpy\byr\bro\bo(1), x\bxr\bro\bog\bge\ber\br(1), q\bqi\bix\bx(1),
+ r\bro\boc\bck\bks\bs(1), r\bro\bor\brs\bsc\bch\bha\bac\bch\bh(1), b\bbl\bli\bit\bts\bsp\bpi\bin\bn(1), i\bim\bms\bsm\bma\bap\bp(1),
+ s\bsl\bli\bid\bde\bes\bsc\bcr\bre\bee\ben\bn(1), d\bde\bec\bca\bay\bys\bsc\bcr\bre\bee\ben\bn(1), m\bma\baz\bze\be(1), h\bhy\byp\bpe\ber\brc\bcu\bub\bbe\be(1),
+ h\bha\bal\blo\bo(1), f\bfl\bla\bam\bme\be(1), p\bpe\bed\bda\bal\bl(1), l\blm\bmo\bor\brp\bph\bh(1), d\bde\bec\bco\bo(1), m\bmo\boi\bir\bre\be(1),
+ k\bka\bal\ble\bei\bid\bde\bes\bsc\bco\bop\bpe\be(1), b\bbu\bub\bbb\bbl\ble\bes\bs(1), l\bli\big\bgh\bht\btn\bni\bin\bng\bg(1), s\bst\btr\bra\ban\bng\bge\be(1),
+
+
+
+X Version 11 31-May-97 13
+
+
+
+
+
+XScreenSaver(1) XScreenSaver(1)
+
+
+ f\bfr\bra\bac\bct\bt(1), s\bsp\bpi\bir\bra\bal\bl(1), l\bla\bas\bse\ber\br(1), g\bgr\bra\bav\bv(1), d\bdr\bri\bif\bft\bt(1), i\bif\bfs\bs(1),
+ j\bju\bul\bli\bia\ba(1), p\bpe\ben\bnr\bro\bos\bse\be(1), s\bsi\bie\ber\brp\bpi\bin\bns\bsk\bki\bi(1), h\bho\bop\bpa\bal\blo\bon\bng\bg(1),
+ b\bbr\bra\bai\bid\bd(1), b\bbo\bou\bub\bbo\bou\bul\ble\be(1), g\bga\bal\bla\bax\bxy\by(1), f\bfl\bla\bag\bg(1), f\bfo\bor\bre\bes\bst\bt(1),
+ s\bsp\bph\bhe\ber\bre\be(1), l\bli\bis\bsa\ba(1), x\bxd\bda\bal\bli\bic\bcl\blo\boc\bck\bk(1), x\bxb\bbo\bou\bun\bnc\bce\beb\bbi\bit\bts\bs(1), i\bic\bco\bo(1),
+ x\bxs\bsw\bwa\bar\brm\bm(1), x\bxw\bwa\bav\bve\be(1), x\bxv\bv(1), x\bxt\bta\bac\bcy\by(1), b\bbo\bon\bng\bgo\bo(1), x\bxf\bfi\bis\bsh\bh-\b-
+ t\bta\ban\bnk\bk(1)
+
+C\bCO\bOP\bPY\bYR\bRI\bIG\bGH\bHT\bT
+ Copyright (C) 1991, 1992, 1993, 1994, 1995, 1996, 1997 by
+ Jamie Zawinski. Permission to use, copy, modify, dis-
+ tribute, and sell this software and its documentation for
+ any purpose is hereby granted without fee, provided that
+ the above copyright notice appear in all copies and that
+ both that copyright notice and this permission notice
+ appear in supporting documentation. No representations
+ are made about the suitability of this software for any
+ purpose. It is provided "as is" without express or
+ implied warranty.
+
+A\bAU\bUT\bTH\bHO\bOR\bR
+ Jamie Zawinski <jwz@netscape.com>. Written in late 1991;
+ first posted to comp.sources.x on 13-Aug-1992.
+
+ Please let me know if you find any bugs or make any
+ improvements.
+
+ Thanks to David Wojtowicz for implementing _\bl_\bo_\bc_\bk_\bT_\bi_\bm_\be_\bo_\bu_\bt.
+
+ Thanks to Martin Kraemer for adding support for shadow
+ passwords and locking-disabled diagnostics.
+
+ Thanks to the many people who have contributed graphics
+ demos to the package.
+
+ Thanks to Patrick Moreau for the VMS port.
+
+ And huge thanks to Jon A. Christopher for implementing the
+ Athena dialog support, so that locking and demo-mode work
+ even if you don't have Motif.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+X Version 11 31-May-97 14
+
+
--- /dev/null
+.de EX \"Begin example
+.ne 5
+.if n .sp 1
+.if t .sp .5
+.nf
+.in +.5i
+..
+.de EE
+.fi
+.in -.5i
+.if n .sp 1
+.if t .sp .5
+..
+.TH XScreenSaver 1 "14-Jun-97" "X Version 11"
+.SH NAME
+attraction - interactions of opposing forces
+.SH SYNOPSIS
+.B attraction
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-points \fIint\fP] [\-threshold \fIint\fP] [\-mode balls | lines | polygons | splines | filled-splines | tails ] [\-size \fIint\fP] [\-segments \fIint\fP] [\-delay \fIusecs\fP] [\-color-shift \fIint\fP] [\-radius \fIint\fP] [\-vx \fIint\fP] [\-vy \fIint\fP] [\-glow] [\-noglow] [\-orbit] [\-viscosity \fIfloat\fP] [\-mouse] [\-no-mouse] [\-mouse-size]
+.SH DESCRIPTION
+The \fIattraction\fP program has several visually different modes of
+operation, all of which are based on the interactions of a set of control
+points which attract each other up to a certain distance, and then begin
+to repel each other. The attraction/repulsion is proportional to the
+distance between any two particles.
+.SH OPTIONS
+.I attraction
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-points integer
+How many control points should be used, or 0 to select the number randomly.
+Default 0. Between 3 and 15 works best.
+.TP 8
+.B \-threshold integer
+The distance (in pixels) from each particle at which the attractive force
+becomes repulsive. Default 100.
+.TP 8
+.B \-mode "balls | lines | polygons | tails | splines | filled-splines"
+In \fIballs\fP mode (the default) the control points are drawn as filled
+circles. The larger the circle, the more massive the particle.
+
+In \fIlines\fP mode, the control points are connected by straight lines;
+the effect is something like \fIqix\fP.
+
+In \fIpolygons\fP mode, the control points are connected by straight
+lines, and filled in. This is most interesting in color.
+
+In \fIsplines\fP mode, a closed spline is interpolated from the control
+points.
+
+In \fIfilled-splines\fP mode, the splines are filled in instead of being
+outlines. This is most interesting in color.
+
+In \fItails\fP mode, the path which each particle follows is indicated
+by a worm-like trail, whose length is controlled by the \fIsegments\fP
+parameter.
+.TP 8
+.B \-size integer
+The size of the balls in pixels, or 0, meaning to select the sizes
+randomly (the default.) If this is specified, then all balls will be
+the same size. This option has an effect in all modes, since the ``size''
+of the balls controls their mass.
+.TP 8
+.B \-segments integer
+If in \fIlines\fP or \fIpolygons\fP mode, how many sets of line segments
+or polygons should be drawn. Default 100. This has no effect in \fIballs\fP
+mode. If \fIsegments\fP is 0, then no segments will ever be erased (this
+is only useful in color.)
+.TP 8
+.B \-delay microseconds
+How much of a delay should be introduced between steps of the animation.
+Default 10000, or about 0.01 seconds.
+.TP 8
+.B \-color-shift int
+If on a color display, the color of the line segments or polygons will
+cycle through the color map. This specifies how many lines will be drawn
+before a new color is chosen. (When a small number of colors are available,
+increasing this value will yield smoother transitions.) Default 3.
+This has no effect in \fIballs\fP mode.
+.TP 8
+.B \-radius
+The size in pixels of the circle on which the points are initially positioned.
+The default is slightly smaller than the size of the window.
+.TP 8
+.B \-glow
+This is consulted only in \fIballs\fP mode. If this is specified, then
+the saturation of the colors of the points will vary according to their
+current acceleration. This has the effect that the balls flare brighter
+when they are reacting to each other most strongly.
+
+In \fIglow\fP mode, all of the balls will be drawn the same (random)
+color, modulo the saturation shifts. In non-glow mode, the balls will
+each be drawn in a random color that doesn't change.
+.TP 8
+.B \-noglow
+Don't do ``glowing.'' This is the default.
+.TP 8
+.B \-vx pixels
+.TP 8
+.B \-vy pixels
+Initial velocity of the balls. This has no effect in \fB\-orbit\fP mode.
+.TP 8
+.B \-orbit
+Make the initial force on each ball be tangential to the circle on which
+they are initially placed, with the right velocity to hold them in orbit
+about each other. After a while, roundoff errors will cause the orbit
+to decay.
+.TP 8
+.B \-vmult float
+In orbit mode, the initial velocity of the balls is multiplied by this;
+a number less than 1 will make the balls pull closer together, and a larger
+number will make them move apart. The default is 0.9, meaning a slight
+inward pull.
+.TP 8
+.B \-viscosity float
+This sets the viscosity of the hypothetical fluid through which the control
+points move; the default is 1, meaning no resistance. Values higher than 1
+aren't interesting; lower values cause less motion.
+
+One interesting thing to try is
+.EX
+attraction -viscosity 0.8 -points 75 \\
+ -mouse -geometry =500x500
+.EE
+Give it a few seconds to settle down into a stable clump, and then move
+the mouse through it to make "waves".
+.TP 8
+.B \-mouse
+This will cause the mouse to be considered a control point; it will not be
+drawn, but it will influence the other points, so you can wave the mouse
+and influence the images being created.
+.TP 8
+.B \-no-mouse
+Turns off \fB\-mouse\fP.
+.TP 8
+.B \-mouse-size integer
+In \fB\-mouse\fP mode, this sets the mass of the mouse (analagously to the
+\fB\-size\fP parameter.)
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992, 1993, 1997 by Jamie Zawinski. Permission to use, copy,
+modify, distribute, and sell this software and its documentation for any
+purpose is hereby granted without fee, provided that the above copyright
+notice appear in all copies and that both that copyright notice and this
+permission notice appear in supporting documentation. No representations are
+made about the suitability of this software for any purpose. It is provided
+"as is" without express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+Viscosity and mouse support by Philip Edward Cutone, III.
--- /dev/null
+.TH XScreenSaver 1 "16-May-97" "X Version 11"
+.SH NAME
+blitspin - rotate a bitmap in an interesting way
+.SH SYNOPSIS
+.B blitspin
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-bitmap \fIfilename\fP] [\-delay \fIusecs\fP] [\-delay2 \fIusecs\fP]
+.SH DESCRIPTION
+The \fIblitspin\fP program repeatedly rotates a bitmap by 90 degrees by
+using logical operations: the bitmap is divided into quadrants, and the
+quadrants are shifted clockwise. Then the same thing is done again with
+progressively smaller quadrants, except that all sub-quadrants of a
+given size are rotated in parallel. So this takes \fBO(16*log2(N))\fP
+blits of size NxN, with the limitation that the image must be square,
+and the size must be a power of 2.
+.SH OPTIONS
+.I blitspin
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-bitmap \fIfilename\fP
+The file name of a bitmap to rotate. It need not be square: it
+will be padded with the background color. If unspecified or the
+string \fI(default)\fP, a builtin bitmap is used.
+
+If support for the \fIXPM\fP library was enabled at compile-time,
+the specified file may be in \fIXPM\fP format as well as \fIXBM\fP, and
+thus may be a color image.
+
+The \fB*bitmapFilePath\fP resource will be searched if the bitmap
+name is not a fully-qualified pathname.
+.TP 8
+.B \-grab\-screen
+If this option is specified, then the image which is spun will be grabbed
+from the portion of the screen underlying the blitspin window.
+.PP
+.TP 8
+.B \-delay microseconds
+How long to delay between steps of the rotation process, in microseconds.
+Default is 500000, one-half second.
+.PP
+.TP 8
+.B \-delay2 microseconds
+How long to delay between each 90-degree rotation, in microseconds.
+Default is 500000, one-half second.
+.B DISPLAY
+to get the default host and display number.
+.SH ENVIRONMENT
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992, 1993, 1997 by Jamie Zawinski.
+Permission to use, copy, modify, distribute, and sell this software and its
+documentation for any purpose is hereby granted without fee, provided that
+the above copyright notice appear in all copies and that both that copyright
+notice and this permission notice appear in supporting documentation. No
+representations are made about the suitability of this software for any
+purpose. It is provided "as is" without express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 17-aug-92.
+
+Based on SmallTalk code which appeared in the August 1981 issue of Byte
+magazine.
--- /dev/null
+.TH XScreenSaver 1 "15-May-97" "X Version 11"
+.SH NAME
+bouboule - draws spinning 3D blobs
+.SH SYNOPSIS
+.B bouboule
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP] [\-3d]
+
+.SH DESCRIPTION
+The \fIbouboule\fP program draws spinning 3D blobs.
+.SH OPTIONS
+.I bouboule
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.TP 8
+.B \-3d
+Do red/blue 3d separations (for 3d glasses.)
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1996 by Jeremie Petit.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+
+.SH AUTHOR
+Jeremie Petit <jpetit@essi.fr>, 1996.
+
+3D support by Henrik Theiling <theiling@coli-uni-sb.de>, 04-Sep-96.
+
+VMS support by Jouk Jansen <joukj@alpha.chem.uva.nl>, 01-Feb-96.
+
+TrueColor support by David Bagley <bagleyd@bigfoot.com>, 01-Feb-96.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 15-May-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+braid - draws random color-cycling braids around a circle
+.SH SYNOPSIS
+.B braid
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIbraid\fP program draws random color-cycling braids around a circle.
+.SH OPTIONS
+.I braid
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1995 by John Neil.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+John Neil <neil@math.idbsu.edu>, 29-Aug-95.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.de EX \"Begin example
+.ne 5
+.if n .sp 1
+.if t .sp .5
+.nf
+.in +.5i
+..
+.de EE
+.fi
+.in -.5i
+.if n .sp 1
+.if t .sp .5
+..
+.TH XScreenSaver 1 "14-Dec-95" "X Version 11"
+.SH NAME
+bubbles - frying pan / soft drink simulation
+.SH SYNOPSIS
+.B bubbles
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-simple] [\-broken] [\-3D] [\-file filename] [\-directory directoryname]
+.SH DESCRIPTION
+\fIBubbles\fP sprays lots of little random bubbles all over the window which
+then grow until they reach their maximum size and go pop. The inspiration
+for this was watching little globules of oil on the bottom of a frying pan
+and it also looks a little like bubbles in fizzy soft drink. The default
+mode uses fancy ray-traced bubbles but there is also a mode which just draws
+circles in case the default mode is too taxing on your hardware.
+.SH OPTIONS
+Depending on how your
+.I bubbles
+was compiled, it accepts the following options:
+.TP 8
+.B \-foreground
+Colour of circles if \fI\-simple\fP mode is selected.
+.TP 8
+.B \-background
+Colour of window background.
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay microseconds
+How much of a delay should be introduced between steps of the animation.
+Default 1, or about 1 microsecond. Actually, this is the delay between each
+group of 15 new bubbles since such a delay between each step results in a
+very slow animation rate.
+.TP 8
+.B \-nodelay
+Same as \fI\-delay 0\fP.
+.TP 8
+.B \-simple
+Don't use the default fancy pixmap bubbles. Just draw circles instead.
+This may give more bearable performance if your hardware wasn't made for
+this sort of thing.
+.TP 8
+.B \-broken
+Don't hide bubbles when they pop. This was a bug during development
+but the results were actually quite attractive. (This option is only
+available if you have the XPM library available and the imake generated
+Makefile has defined HAVE_XPM).
+.TP 8
+.B \-3D
+Normally, the simulation is done completely in two dimensions. When a
+bubble swallows up another bubble, the areas of each are added to get
+the area of the resulting bubble. This option changes the algorithm
+to instead add volume (imagining each to be a sphere in 3D space). The
+whole thing looks more realistic but I find it attracts attention to
+the flickering of each bubble as they are move and are redrawn. Your
+mileage may vary.
+.TP 8
+.B \-file filename
+Use the pixmap definitions in the given file, instead of the default (if
+one is compiled in). This is ignored if \fI\-simple\fP is specified. If
+the file is compressed (either with compress or gzip), it is decompressed
+before use. (This option only works if you have XPM compiled into your
+binary and you have compiled with BUBBLES_IO set in bubbles.h. This is
+\fBnot\fP the default).
+.TP 8
+.B \-directory directoryname
+Similar to \fI-file\fP except the file is taken randomly from the
+contents of the specified directory. (Again, this option is only available
+if you have XPM and BUBBLES_IO was set when compiling. See above).
+.TP 8
+.B \-quiet
+Don't print messages explaining why one or several command line options
+were ignored. This is disabled by default.
+.SH NOTES
+If you find the pace of things too slow, remember that there is a delay
+even though you specify no \fI\-delay\fP option. Try using \fI\-nodelay\fP
+although beware of the effects of irritation of other users if you're on a
+shared system as you bleed their CPU time away.
+
+Some tools to assist in creation of new bubbles are included in the source
+distribution. These can either be loaded with the \fI\-file\fP or
+\fI\-directory\fP options (if available) or they can be used in place
+of the distributed default bubble (bubble_default.c).
+You might like to copy these scripts to a permanent location and
+use them. Read bubbles.README.
+
+Rendered bubbles are not supported on monochrome displays. I'm not
+convinced that small bubbles, even dithered properly are going to look
+like anything more than a jumble of random dots.
+.SH BUGS
+There is a delay before something appears on the screen when using
+rendered bubbles. The XPM library seems to take a \fBlong\fP time to make
+pixmaps out of raw data. This can be irritating on slower systems.
+
+The movement of the bubbles looks jerky if an incomplete set of bubbles
+is used.
+
+The hide/display algorithm could do with some work to avoid flickering
+when \fI\-nodelay\fP is set.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH DISTRIBUTION POLICY
+This work is Copyright \(co 1995, 1996 by James Macnicol. Distribution is
+allowed under the terms of the GNU General Public License. Look at the
+sources for the legalese.
+.SH AUTHOR
+James Macnicol <J.Macnicol@student.anu.edu.au>.
--- /dev/null
+.TH XScreenSaver 1 "05-aug-93" "X Version 11"
+.SH NAME
+decayscreen - make a screen meltdown.
+.SH SYNOPSIS
+.B decayscreen
+[\-display \fIhost:display.screen\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIusecs\fP]
+.SH DESCRIPTION
+The \fIdecayscreen\fP program creates a melting effect by randomly
+shifting rectangles around the screen.
+.SH OPTIONS
+.I decayscreen
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fImicroseconds\fP
+Slow it down.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH "SEE ALSO"
+X(1),
+xscreensaver(1)
+.SH COPYRIGHT
+Copyright 1992 by Vivek Khera. Permission to use, copy, modify, distribute,
+and sell this software and its documentation for any purpose is hereby granted
+without fee, provided that the above copyright notice appear in all copies and
+that both that copyright notice and this permission notice appear in
+supporting documentation. No representations are made about the suitability
+of this software for any purpose. It is provided "as is" without express or
+implied warranty.
+.SH AUTHOR
+Vivek Khera <khera@cs.duke.edu>, 05-Aug-93; based on code by David Wald, 1988.
--- /dev/null
+.TH XScreenSaver 1 "27-Apr-97" "X Version 11"
+.SH NAME
+deco - draw tacky 70s basement wall panelling
+.SH SYNOPSIS
+.B deco
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIseconds\fP] [\-max\-depth \fIint\fP] [\-min\-width \fIint\fP] [\-min\-height \fIint\fP] [\-cycle] [\-no\-cycle] [\-cycle\-delay]
+.SH DESCRIPTION
+The \fIdeco\fP program subdivides and colors rectangles randomly.
+It looks kind of like Brady-Bunch-era rec-room wall paneling.
+(Raven says: "this screensaver is ugly enough to peel paint.")
+.SH OPTIONS
+.I deco
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fIseconds\fP
+How long to wait before starting over. Default 5 seconds.
+.TP 8
+.B \-max\-depth \fIinteger\fP
+How deep to subdivide. Default 12.
+Default 8.
+.TP 8
+.B \-min-width \fIinteger\fP
+.B \-min-height \fIinteger\fP
+The size of the smallest rectangle to draw. Default 20x20.
+.TP 8
+.B \-cycle
+.TP 8
+.B \-no\-cycle
+Whether to do color cycling. Default False.
+.TP 8
+.B \-cycle\-delay \fIusecs\fP
+If color cycling, how often to change the colors. Default 1000000,
+or 1 second.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 26-Apr-97, based on code by
+Michael D. Bayne <mdb@go2net.com>.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+drift - draws drifting recursive fractal cosmic flames
+.SH SYNOPSIS
+.B drift
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-count \fIinteger\fP] [\-grow] [\-no\-grow] [\-liss] [\-no\-liss]
+
+.SH DESCRIPTION
+The \fIdrift\fP program draws drifting recursive fractal cosmic flames
+.SH OPTIONS
+.I drift
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-count \fIinteger\fP
+
+.TP 8
+.B \-grow
+.TP 8
+.B \-no\-grow
+Whether fractals should grow; otherwise, they are animated.
+
+.TP 8
+.B \-liss
+.TP 8
+.B \-no\-liss
+Whether we should use lissojous figures to get points.
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR flame (1),
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1991, 1995 by Scott Draves.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Scott Draves <spot@cs.cmu.edu>, 06-Jun-91, 01-Jun-95.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "24-May-97" "X Version 11"
+.SH NAME
+flag - draws a waving flag, containing text or an image
+.SH SYNOPSIS
+.B flag
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-size \fIinteger\fP] [\-text \fIstring\fP] [\-font \fIfont\fP] [\-bitmap \fIxbm-file\fP]
+
+.SH DESCRIPTION
+The \fIflag\fP program draws a waving flag that contains text or a bitmap.
+.SH OPTIONS
+.I flag
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.TP 8
+.B \-size \fIinteger\fP
+How large the pixels in the flag should be, from 1 to 8.
+If this is a negative number, the pixel size is chosen randomly
+from the range 1 to -size. Default -7.
+.TP 8
+.B \-text \fItext\fP
+The text to display in the flag. Multiple lines of text are allowed;
+the lines will be displayed centered atop one another. Default: none.
+If the text is the magic string \fI"(default)"\fP, then the text used
+will be the local machine name; a newline; and the local OS version.
+.TP 8
+.B \-bitmap \fIxbm-file\fP
+The bitmap to display in the flag; this must be an XBM file (color XPMs
+are not allowed.) Default: none. If the bitmap is the magic
+string \fI"(default)"\fP, then the bitmap used will be a charming
+little picture of J. R. "Bob" Dobbs.
+
+If neither \fI\-text\fP nor \fI\-bitmap\fP are specified, then either
+the builtin text or the builtin bitmap will be chosen randomly.
+.TP 8
+.B \-font \fIfont\fP
+The font in which to draw the text; the default is
+"-*-helvetica-bold-r-*-240-*".
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1996 Charles Vidal.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+
+.SH AUTHOR
+Charles Vidal <vidalc@univ-mlv.fr>, 1996.
+
+Ability to run standalone or with \fIxscreensaver\fP, and the \-text
+and \-bitmap options, added by Jamie Zawinski <jwz@netscape.com>, 24-May-97.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+flame - draw weird cosmic fractals
+.SH SYNOPSIS
+.B flame
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-colors \fIinteger\fP] [\-iterations \fIinteger\fP] [\-points \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-delay2 \fImicroseconds\fP]
+.SH DESCRIPTION
+The \fIflame\fP program generates colorful fractal displays.
+.SH OPTIONS
+.I flame
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-colors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+.TP 8
+.B \-iterations \fIinteger\fP
+How many fractals to generate. Default 25.
+.TP 8
+.B \-points \fIinteger\fP
+How many pixels to draw for each fractal. Default 10000.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How long we should wait between drawing each fractal. Default 50000,
+or about 1/20th second.
+.TP 8
+.B \-delay2 \fImicroseconds\fP
+How long we should wait before clearing the screen when each run ends.
+Default 2000000, or two seconds.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1991 by Patrick J. Naughton
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Scott Graves <spot@cs.cmu.edu>, 06-Jun-91.n
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 18-Oct-93.
--- /dev/null
+.TH XScreenSaver 1 "27-May-97" "X Version 11"
+.SH NAME
+forest - draws a fractal forest
+.SH SYNOPSIS
+.B forest
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIforest\fP program draws a fractal forest.
+.SH OPTIONS
+.I forest
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 100.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1995 by Pascal Pensa.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Pascal Pensa <pensa@aurora.unice.fr>, 1995.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 27-May-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+fract - draws pseudo-fractal geometric patterns
+.SH SYNOPSIS
+.B fract
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP]
+
+.SH DESCRIPTION
+The \fIfract\fP program is yet another geometric pattern generator, this
+one's claim to fame being a pseudo-fractal looking vine like pattern that
+creates nifty whorls and loops.
+.SH OPTIONS
+.I fract
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors are chosen randomly.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Tracy Camp.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Tracy Camp <campt@hurrah.com>, 1997.
+
+Tweaked by David Hansen <dhansen@metapath.com>, 21-Mar-97.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+galaxy - draws spinning galaxies
+.SH SYNOPSIS
+.B galaxy
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP] [\-size \fIinteger\fP] [\-trail] [\-no\-trail]
+
+.SH DESCRIPTION
+The \fIgalaxy\fP program draws spinning galaxies.
+.SH OPTIONS
+.I galaxy
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.TP 8
+.B \-size \fIinteger\fP
+
+.TP 8
+.B \-trail
+.TP 8
+.B \-no\-trail
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1994 by Hubert Feyrer.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Original Amiga version by Uli Siegmund <uli@wombat.okapi.sub.org>
+ for EGS in Cluster.
+
+Ported from Cluster/EGS to C/Intuition by Harald Backert.
+
+Ported to X11 and xlockmore by
+Hubert Feyrer <hubert.feyrer@rz.uni-regensburg.de>, 30-Sep-94.
+
+Modified by David Bagley <bagleyd@bigfoot.com>, 23-Oct-94.
+
+Modified by Dave Mitchell <davem@magnet.com>, 7-Apr-97.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "11-Jun-97" "X Version 11"
+.SH NAME
+goop - squishy transparent oil and bubble screenhack
+.SH SYNOPSIS
+.B goop
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-transparent] [\-non\-transparent] [\-additive] [\-subtractive] [\-xor] [\-no\-xor]
+.SH DESCRIPTION
+The \fIgoop\fP program draws a simulation of bubbles in layers of
+overlapping multicolored translucent fluid.
+.SH OPTIONS
+.I goop
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-count \fIinteger\fP
+How many bubbles to draw per layer. Default: random.
+.TP 8
+.B \-layers \fIinteger\fP
+How many layers to draw. Default: random, based on screen depth.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation.
+Default 100000, or about 1/10th second.
+.TP 8
+.B \-transparent
+If \fI\-layers\fP is greater than 1, then each layer will be drawn in one
+color, and when they overlap, the colors will be mixed. This only works
+on \fBPseudoColor\fP displays. This is the default.
+.TP 8
+.B \-non\-transparent
+Turns off \fI\-transparent\fP.
+.TP 8
+.B \-additive
+If \fI\-transparent\fP is specified, then this option means that the colors
+will be mixed using an additive color model, as if the blobs were projected
+light. This is the default.
+.TP 8
+.B \-subtractive
+If \fI\-transparent\fP is specified, then this option means that the
+colors will be mixed using a subtractive color model, as if the blobs were
+translucent filters.
+.TP 8
+.B \-xor
+Draw with xor instead of the other color tricks.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 11-Jun-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+grav - draws a simple orbital simulation
+.SH SYNOPSIS
+.B grav
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-count \fIinteger\fP] [\-decay] [\-no\-decay] [\-trail] [\-no\-trail]
+
+.SH DESCRIPTION
+The \fIgrav\fP program draws a simple orbital simulation
+.SH OPTIONS
+.I grav
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors are chosen randomly.
+.TP 8
+.B \-count \fIinteger\fP
+Default 12.
+.TP 8
+.B \-decay
+.TP 8
+.B \-no-\decay
+Whether orbits should decay.
+
+.TP 8
+.B \-trail
+.TP 8
+.B \-no\-trail
+Whether the objects should leave trails behind them (makes it look vaguely
+like a cloud-chamber.
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1993 by Greg Bowering.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Greg Bowering <greg@smug.student.adelaide.edu.au>, 1993.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+greynetic - draw random stippled/color rectangles
+.SH SYNOPSIS
+.B greynetic
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIusecs\fP]
+.SH DESCRIPTION
+The \fIgreynetic\fP program draws random rectangles.
+.SH OPTIONS
+.I greynetic
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fImicroseconds\fP
+Slow it down.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+.TH XScreenSaver 1 "12-Jun-97" "X Version 11"
+.SH NAME
+halo - draw circular patterns
+.SH SYNOPSIS
+.B halo
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-count \fIint\fP] [\-delay \fIusecs\fP] [\-mode seuss | ramp | random ] [\-animate] [\-colors \fIinteger\fP] [\-cycle] [\-no\-cycle] [\-cycle\-delay \fIusecs\fP]
+.SH DESCRIPTION
+The \fIhalo\fP program draws cool patterns based on circles.
+.SH OPTIONS
+.I halo
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-count \fIinteger\fP
+How many circles to draw. Default 0, meaning random.
+.TP 8
+.B \-mode "seuss | ramp | random"
+In \fIseuss\fP mode, alternating striped curves will be drawn.
+
+In \fIramp\fP mode, a color ramp will be drawn.
+
+\fIrandom\fP means pick the mode randomly.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation.
+Default 100000, or about 0.1 second.
+.TP 8
+.B \-colors \fIinteger\fP
+How many colors to use. Default 100.
+.TP 8
+.B \-animate
+If specified, then the centerpoints of the circles will bounce around.
+Otherwise, the circles will be drawn once, erased, and a new set of
+circles will be drawn.
+.TP 8
+.B \-cycle
+.TP 8
+.B \-no\-cycle
+Whether to do colormap cycling. Default is to cycle.
+.TP 8
+.B \-cycle\-delay
+Number of microseconds between shifts of the colormap; default 100000,
+or 1/10th second.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1993 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 6-jul-93.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+helix - draw helical string-art patterns
+.SH SYNOPSIS
+.B helix
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP]
+.SH DESCRIPTION
+The \fIhelix\fP program draws interesting patterns composed of line segments
+in random colors.
+.SH OPTIONS
+.I helix
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+hopalong - draw real plane fractals
+.SH SYNOPSIS
+.B hopalong
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP] [\-jong] [\-no\-jong] [\-jong] [\-no\-sine]
+
+.SH DESCRIPTION
+The \fIhopalong\fP program generates real plane fractals as described in
+the September 1986 issue of Scientific American.
+.SH OPTIONS
+.I hopalong
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-cycles \fIinteger\fP
+How long to run each batch. Default 2500 pixels.
+.TP 8
+.B \-count \fIinteger\fP
+How many pixels should be drawn before a color change. Default 1000.
+.TP 8
+.B \-jong \fIinteger\fP
+.TP 8
+.B \-no\-jong \fIinteger\fP
+Whether to use the Jong format (default is to choose randomly.)
+
+.TP 8
+.B \-sine \fIinteger\fP
+.TP 8
+.B \-no\-sine \fIinteger\fP
+Whether to use the Sine format (default is to choose randomly.)
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1988-91 by Patrick J. Naughton.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Patrick J. Naughton <naughton@eng.sun.com>, 23-mar-88.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92, and again on 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "6-dec-92" "X Version 11"
+.SH NAME
+hypercube - 2d projection of a 4d object
+.SH SYNOPSIS
+.B hypercube
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-color[0-7] \fIcolor\fP] [\-xy \fIfloat\fP] [\-xz \fIfloat\fP] [\-yz \fIfloat\fP] [\-xw \fIfloat\fP] [\-yw \fIfloat\fP] [\-zw \fIfloat\fP] [\-observer-z \fIint\fP] [\-delay \fIusecs\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP]
+.SH DESCRIPTION
+The \fIhypercube\fP program displays a wireframe projection of a hypercube
+which is rotating at user-specified rates around any or all of its four axes.
+.SH OPTIONS
+.I hypercube
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation.
+Default 100000, or about 1/10th second.
+.TP 8
+.B \-observer-z \fIint\fP
+How far away the observer is from the center of the cube (the cube is one
+unit per side.) Default 5.
+.TP 8
+.B \-color0 \fIcolor\fP
+.TP 8
+.B \-color1 \fIcolor\fP
+.TP 8
+.B \-color2 \fIcolor\fP
+.TP 8
+.B \-color3 \fIcolor\fP
+.TP 8
+.B \-color4 \fIcolor\fP
+.TP 8
+.B \-color5 \fIcolor\fP
+.TP 8
+.B \-color6 \fIcolor\fP
+.TP 8
+.B \-color7 \fIcolor\fP
+The colors used to draw the line segments bordering the eight faces of
+the cube. Some of the faces have only two of their border-lines drawn in
+the specified color, and some have all four.
+.TP 8
+.B \-xw \fIfloat\fP
+.TP 8
+.B \-xy \fIfloat\fP
+.TP 8
+.B \-xz \fIfloat\fP
+.TP 8
+.B \-yw \fIfloat\fP
+.TP 8
+.B \-yz \fIfloat\fP
+.TP 8
+.B \-zw \fIfloat\fP
+The amount that the cube should be rotated around the specified axis at
+each frame of the animation, expressed in radians. These should be small
+floating-point values (less than 0.05 works best.) Default: xy=0.01,
+xz=0.005, yw=0.01.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 6-dec-92.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+ifs - draws spinning, colliding iterated-function-system images
+.SH SYNOPSIS
+.B ifs
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP]
+
+.SH DESCRIPTION
+The \fIifs\fP program draws spinning, colliding iterated-function-system images.
+.SH OPTIONS
+.I ifs
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Massimino Pascal.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Massimino Pascal <Pascal.Massimon@ens.fr>, 1997.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "17-May-97" "X Version 11"
+.SH NAME
+imsmap - generate fractal maps
+.SH SYNOPSIS
+.B imsmap
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIint\fP] [\-delay \fIseconds\fP] [\-iterations \fIint\fP] [\-mode h|s|v|random] [\-cycle] [\-no\-cycle]
+.SH DESCRIPTION
+The \fIimsmap\fP program generates map or cloud-like patterns. It looks
+quite different in monochrome and color.
+.SH OPTIONS
+.I imsmap
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors to use. Default 50.
+.TP 8
+.B \-delay \fIinteger\fP
+How long to delay between images. Default 10 seconds.
+.TP 8
+.B \-iterations \fIinteger\fP
+A measure of the resolution of the resultant image, from 0 to 7. Default 7.
+.TP 8
+.B \-mode [ hue | saturation | value | random ]
+The axis upon which colors should be interpolated between the foreground
+and background color. Default random.
+.TP 8
+.B \-cycle
+.TP 8
+.B \-no\-cycle
+Whether to do colormap cycling. Default is to cycle.
+.TP 8
+.B \-cycle\-delay
+Number of microseconds between shifts of the colormap; default 100000,
+or 1/10th second.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH AUTHOR
+Juergen Nickelsen <nickel@cs.tu-berlin.de>, 23-aug-92.
+
+Hacked on by Jamie Zawinski <jwz@netscape.com>, 24-aug-92, 17-May-97.
--- /dev/null
+.TH XScreenSaver 1 "28-May-97" "X Version 11"
+.SH NAME
+julia - draws spinning, animating julia-set fractals
+.SH SYNOPSIS
+.B julia
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP] [\-mouse] [\-nomouse]
+
+.SH DESCRIPTION
+The \fIjulia\fP program draws spinning, animating julia-set fractals.
+
+It uses ifs {w0 = sqrt(x-c), w1 = -sqrt(x-c)} with random iteration
+to plot the julia set, and sinusoidially varied parameters for the set,
+and plots parameters with a circle.
+
+One thing to note is that count is the \fIdepth\fP of the search tree,
+so the number of points computed is (2^count)-1. I use 8 or 9 on a
+dx266 and it looks okay. The sinusoidal variation of the parameter
+might not be as interesting as it could, but it still gives an idea
+of the effect of the parameter.
+
+.SH OPTIONS
+.I julia
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.TP 8
+.B \-mouse
+.TP 8
+.B \-nomouse
+If \fI\-mouse\fP is specified, the control point of the Julia set will
+be derived from the position of the mouse in the window. When the mouse
+is not in the window, the control point is chosen the normal way.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1995 by Sean McCullough.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Sean McCullough <bankshot@mailhost.nmt.edu>, 1995.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.de EX \"Begin example
+.ne 5
+.if n .sp 1
+.if t .sp .5
+.nf
+.in +.5i
+..
+.de EE
+.fi
+.in -.5i
+.if n .sp 1
+.if t .sp .5
+..
+.TH Kaleidescpe 1 "14-Dec-95" "X Version 11"
+.SH NAME
+Kaleidescope - rotating line segments
+.SH SYNOPSIS
+.B kaleidescope
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-color_mode \fImono | nice | greedy\fP] [-nsegments \fIint\fP] [\-ntrails \fIint\fP] [\-local_rotation \fIint\fP] [\-global_rotation \fIint\fP] [\-delay \fIusecs\fP] [\-redmin \fIint\fP] [\-greenmin \fIint\fP] [\-bluemin \fIint\fP] [\-redrange \fIint\fP] [\-greenrange \fIint\fP] [\-bluerange \fIint\fP]
+.SH DESCRIPTION
+The \fIkaleidescope\fP program draws line segments in a symmetric pattern
+that evolves over time.
+.SH OPTIONS
+.I kaleidescope
+accepts the following options:
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-color_mode "mono | nice | greedy"
+Specify how kaleidescope uses colors. Mono uses
+just the default foreground and background colors. Nice uses one
+color for each segment (specified by nsegments). Greedy uses (ntrails * nsegments) + 1 colors.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-nsegments integer
+The number of segments to draw. Default is 7.
+.TP 8
+.B \-ntrails integer
+The number of trails to draw. Default is 100.
+.TP 8
+.B \-local_rotation integer
+The rate at which segments rotate around their center. Default is -59.
+.TP 8
+.B \-global_rotation integer
+The rate at which segments rotate around the center of the window.
+Default is 1.
+.TP 8
+.B \-redmin, \-greenmin, \-bluemin, \-redrange, \-greenrange, \-bluerange
+All take an integer argument. When colors are randomly chosen, they
+are chosen from the interval min to min plus range. The minimums default
+to 30000. The ranges default to 20000.
+.TP 8
+.B \-delay microseconds
+How much of a delay should be introduced between steps of the animation.
+Default is 20000, or about 5 frames a second.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR kaleidescope (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Ron Tapia. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Ron Tapia <tapia@nmia.com>, 20-Mar-97.
+
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+laser - draws vaguely laser-like moving lines
+.SH SYNOPSIS
+.B laser
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIlaser\fP program draws vaguely laser-like moving lines
+.SH OPTIONS
+.I laser
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors used cycle through the hue, making N stops around the color wheel.
+.TP 8
+.B \-cycles \fIinteger\fP
+Default 200.
+.TP 8
+.B \-count \fIinteger\fP
+Default 10.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1995 by Pascal Pensa.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Pascal Pensa <pensa@aurora.unice.fr>, 1995.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+lightning - draws fractal lightning bolts
+.SH SYNOPSIS
+.B lightning
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP]
+
+.SH DESCRIPTION
+The \fIlightning\fP program draws fractal lightning bolts
+.SH OPTIONS
+.I lightning
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors are chosen randomly.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1996 by Keith Romberg.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Keith Romberg <kromberg@saxe.com>, 27-Jun-96.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "27-May-97" "X Version 11"
+.SH NAME
+lisa - draws animated full-loop lisajous figures
+.SH SYNOPSIS
+.B lisa
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP] [\-size \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIlisa\fP program draws animated full-loop lisajous figures.
+.SH OPTIONS
+.I lisa
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+The colors are chosen randomly.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.TP 8
+.B \-size \fIinteger\fP
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Caleb Cullen.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Caleb Cullen, 1997.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 27-May-97.
--- /dev/null
+.TH LMORPH 1 "xscreensaver hack"
+.SH NAME
+lmorph \- morphing lines
+.SH SYNOPSIS
+.B lmorph
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-points \fIint\fP] [\-steps \fIint\fP] [\-delay \fIusecs\fP]
+.SH DESCRIPTION
+The \fIlmorph\fP program morphs between simple linedrawings using bilinear
+interpolation.
+.SH OPTIONS
+.I lmorph
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-points \fIinteger\fP
+Number of points in each line drawing. Default is 150 points.
+.TP 8
+.B \-steps \fIinteger\fP
+Interpolation steps from one drawing to the next. Default is 0, which
+means a random number between 100 and 500.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation.
+Default 50000.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH AUTHOR
+Sverre H. Huseby <sverrehu@ifi.uio.no> and Glenn T. Lines <gtl@si.sintef.no>,
+built on top of the screen saver routines by Jamie Zawinski <jwz@netscape.com>.
--- /dev/null
+.TH XScreenSaver 1 "7-mar-93" "X Version 11"
+.SH NAME
+maze \- an automated X11 demo repeatedly creating and solving a random maze
+.SH SYNOPSIS
+.B maze
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-grid\-size \fIpixels\fP] [\-live\-color \fIcolor\fP] [\-dead\-color \fIcolor\fP] [\-solve\-delay \fIusecs\fP] [\-pre\-delay \fIusecs\fP] [\-post\-delay \fIusecs\fP]
+.SH DESCRIPTION
+The \fImaze\fP program creates a "random" maze and then solves it with
+graphical feedback.
+.SH OPTIONS
+.I maze
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-grid\-size \fIpixels\fP
+The size of each block of the maze, in pixels; default is 0, meaning
+pick a random grid size.
+.TP 8
+.B \-live\-color \fIcolor\fP
+The color of the path.
+.TP 8
+.B \-dead\-color \fIcolor\fP
+The color of the failed path (it is also stippled with a 50% pattern.)
+.TP 8
+.B \-solve\-delay \fIinteger\fP
+Delay (in microseconds) between each step of the solution path.
+Default 5000, or about 1/200th second.
+.TP 8
+.B \-pre\-delay \fIinteger\fP
+Delay (in microseconds) between generating a maze and starting to solve it.
+Default 2000000 (2 seconds.)
+.TP 8
+.B \-post\-delay \fIinteger\fP
+Delay (in microseconds) after solving a maze and before generating a new one.
+Default 4000000 (4 seconds.)
+.PP
+Clicking the mouse in the maze window controls it.
+.TP 16
+.B "LeftButton
+Clears the window and restarts maze.
+.TP 16
+.B MiddleButton
+Pause or unpause the program.
+.TP 16
+.B RightButton
+Exit.
+.SH BUGS
+Expose events force a restart of maze.
+
+Mouse actions are based on "raw" values (Button1, Button2 and Button3)
+instead of using the pointer map.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+.PP
+Copyright \(co 1988 by Sun Microsystems, Inc. Mountain View, CA.
+.PP
+All Rights Reserved
+.PP
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted, provided that
+the above copyright notice appear in all copies and that both that copyright
+notice and this permission notice appear in supporting documentation, and that
+the names of Sun or MIT not be used in advertising or publicity pertaining to
+distribution of the software without specific prior written permission. Sun
+and M.I.T. make no representations about the suitability of this software for
+any purpose. It is provided "as is" without any express or implied warranty.
+.PP
+SUN DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE, INCLUDING ALL
+IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. IN
+NO EVENT SHALL SUN BE LIABLE FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL
+DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS,
+WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING
+OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE.
+.SH AUTHOR(s)
+.nf
+Jim Randell [ XScreenSaver version ] jmr@mddjmr.fc.hp.com
+ HPLabs, Bristol
+Richard Hess [ X11 extensions ] {...}!uunet!cimshop!rhess
+ Consilium, Mountain View, CA
+Dave Lemke [ X11 version ] lemke@sun.COM
+ Sun MicroSystems, Mountain View, CA
+Martin Weiss [ SunView version ]
+ Sun MicroSystems, Mountain View, CA
+.fi
--- /dev/null
+.TH XScreenSaver 1 "27-Apr-97" "X Version 11"
+.SH NAME
+halo - draw circular interference patterns
+.SH SYNOPSIS
+.B halo
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIseconds\fP] [\-random \fIboolean\fP] [\-ncolors \fIint\fP] [\-offset \fIint\fP]
+.SH DESCRIPTION
+The \fImoire\fP program draws cool circular interference patterns.
+.SH OPTIONS
+.I moire
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fIseconds\fP
+How long to wait before starting over. Default 5 seconds.
+.TP 8
+.B \-random \fIboolean\fP
+Whether to ignore the foreground/background colors, and pick them randomly
+instead.
+.TP 8
+.B \-offset \fIinteger\fP
+The maximum random radius increment to use.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be allocated in the color ramp (note that this
+value interacts with \fIoffset\fP.)
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 27-Apr-97, based on code by
+Michael D. Bayne <mdb@go2net.com>.
--- /dev/null
+..de EX \"Begin example
+.ne 5
+.if n .sp 1
+.if t .sp .5
+.nf
+.in +.5i
+..
+.de EE
+.fi
+.in -.5i
+.if n .sp 1
+.if t .sp .5
+..
+.TH XScreenSaver 1 "17-Jun-97" "X Version 11"
+.SH NAME
+munch - munching squares screen hack
+.SH SYNOPSIS
+.B deco
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP]
+[\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install]
+[\-visual \fIvisual\fP] [\-delay \fIseconds\fP] [\-xor] [\-noxor] [\-shift]
+[\-noshift] [\-logminwidth \fIminimum width\fP]
+.SH DESCRIPTION
+The
+.I munch
+program preforms the munching squares hack until killed. It picks square
+size, position, and gravity randomly; configurable options are listed
+below.
+.PP
+The munching squares hack cosists of drawing Y = X XOR T for a range of X
+and T over and over until all the possible combinations of X and T have
+come up. It was reportedly discovered by Jackson Wright in 1962 and took 5
+instructions of PDP-6 code.
+.SH OPTIONS
+.I munch
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fIseconds\fP
+How long to wait before starting over. Default 5 seconds.
+.TP 8
+.B \-xor
+Use the XOR drawing function. (Default.)
+.TP 8
+.B \-no\-xor
+Don't use the XOR drawing function.
+.TP 8
+.B \-shift
+Start drawing the square at weird starting points. (Default.)
+.TP 8
+.B \-no\-shift
+Don't shift and start drawing the square at weird starting points.
+.TP 8
+.B \-logminwidth \fIminimum\-width\fP
+The logarithm (base 2) of the minimum with of a square (must be a power of
+2, or some parts of the square aren't.)
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR http://www.inwap.com/pdp10/hbaker/hakmem/hakmem.html,
+.BR http://www.comedia.com/Hot/jargon_3.0/JARGON_M/MUNCHSQR.HTML
+.SH HISTORY
+Quoted from HAKMEM, for historical interest. As that document says, "Unless
+otherwise stated, all computer programs are in PDP-6/10 assembly language."
+.TP 8
+ITEM 146: MUNCHING SQUARES
+Another simple display program. It is thought that this was discovered by
+Jackson Wright on the RLE PDP-1 circa 1962.
+
+.EX
+ DATAI 2
+ ADDB 1,2
+ ROTC 2,-22
+ XOR 1,2
+ JRST .-4
+.EE
+.RS 8
+2=X, 3=Y. Try things like 1001002 in data switches. This also does
+interesting things with operations other than XOR, and rotations other
+than -22. (Try IOR; AND; TSC; FADR; FDV(!); ROT -14, -9, -20, ...)
+.RE
+.TP 8
+ITEM 147 (Schroeppel):
+Munching squares is just views of the graph Y = X XOR T for consecutive
+values of T = time.
+.TP 8
+ITEM 148 (Cohen, Beeler):
+A modification to munching squares which reveals them in frozen states
+through opening and closing curtains: insert FADR 2,1 before the XOR. Try
+data switches =
+
+.EX
+ 4000,,4 1000,,2002 2000,,4 0,,1002
+.EE
+.RS 8
+(Notation: <left half>,,<right half>)
+
+Also try the FADR after the XOR, switches = 1001,,1.
+.SH COPYRIGHT
+Copyright \(co 1997 by Tim Showalter. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Tim Showalter <tjs@andrew.cmu.edu>, 17-Jun-97, based on what's in the
+Jargon File and stealing stuff from existing xscreensaver modules.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+noseguy - a little guy with a big nose wanders around being witty
+.SH SYNOPSIS
+.B noseguy
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-text-foreground \fIcolor\fP] [\-text-background \fIcolor\fP] [\-font \fIfont\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-mode \fImode\fP] [\-program \fIprogram\fP] [\-filename \file\fP] [\-text \fItext\fP]
+.SH DESCRIPTION
+A little man with a big nose and a hat runs around spewing out messages to
+the screen. This code (and its bitmaps) were extracted from the \fIxnlock\fP
+program.
+.SH OPTIONS
+.I noseguy
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-font \fIfont\fP
+The font used for the messages.
+.TP 8
+.B \-mode [ program | file | string ]
+In \fIprogram\fP mode, the messages are gotten by running a program.
+The program used is controlled by the \fI\-program\fP option, and
+the \fI.program\fP resource.
+
+In \fIfilename\fP mode, the message used is the contents of a file.
+The file used is controlled by the \fI\-file\fP option, and
+the \fI.filename\fP resource.
+
+In \fIstring\fP mode, the message is whatever was specified on the
+command line as the \fI\-text\fP option, or in the resource database
+as the \fI.text\fP resource.
+.TP 8
+.B \-program \fIprogram\fP
+If \fImode\fP is \fIprogram\fP (the default), then this program will be
+run periodically, and its output will be the text of the messages. The
+default program is \fI"fortune -s"\fP, but \fIyow\fP is also a good choice.
+.TP 8
+.B \-filename \fIfile\fP
+If \fImode\fP is \fIfile\fP, then the contents of this file will be used
+for all messages.
+.TP 8
+.B \-text \fIstring\fP
+If \fImode\fP is \fIstring\fP, then this text will be used for all messages.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xnlock (1)
+.SH COPYRIGHT
+Copyright 1985, 1990 by Dan Heller <argv@sun.com>.
+.SH AUTHOR
+Dan Heller <argv@sun.com>, 1985.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+.TH XScreenSaver 1 "24-Jun-94" "X Version 11"
+.SH NAME
+pedal - pretty geometric picture program
+.SH SYNOPSIS
+.B pedal
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-delay \fIseconds\fP] [-maxlines \fInumber\fP] [-fadedelay \fIuseconds\fP] [-mono] [\-install] [\-visual \fIvisual\fP]
+.SH DESCRIPTION
+The \fIpedal\fP program displays pretty geometric pictures.
+.SH OPTIONS
+.I pedal
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-foreground \fIcolor\fP
+The color for the foreground. Default is white.
+.TP 8
+.B \-background \fIcolor\fP
+The color for the background. Default is black.
+.TP 8
+.B \-delay \fIseconds\fP
+The number of seconds to pause between each picture.
+.TP 8
+.B \-maxlines \fInumber\fP
+The maximum number of lines in the drawing. Good values are
+between 20 and 2000. Maximum value is 16K.
+.TP 8
+.B \-fadedelay \fImicroseconds\fP
+The number of micro seconds to take when fading in and out.
+.TP 8
+.B \-mono
+Don't do fading. Pretend we're on a monochrome display.
+.PP
+To make your X server grunt under load, and to impress your
+friends, try \fIpedal -mono -delay 0 -maxlines 100\fp.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1994, by Carnegie Mellon University. Permission to use,
+copy, modify, distribute, and sell this software and its documentation
+for any purpose is hereby granted without fee, provided fnord that the
+above copyright notice appear in all copies and that both that copyright
+notice and this permission notice appear in supporting documentation.
+No representations are made about the suitability of fnord this software
+for any purpose. It is provided "as is" without express or implied
+warranty.
+.SH AUTHOR
+Dale Moore <Dale.Moore@cs.cmu.edu>, 24-Jun-1994.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+penrose - draws quasiperiodic tilings
+.SH SYNOPSIS
+.B penrose
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-size \fIinteger\fP] [\-ammann] [\-no\-ammann]
+
+.SH DESCRIPTION
+The \fIpenrose\fP program draws quasiperiodic tilings.
+
+See Onoda, Steinhardt, DiVincenzo and Socolar in
+Phys. Rev. Lett. 60, #25, 1988 or
+Strandburg in Computers in Physics, Sep/Oct 1991.
+
+This implementation uses the simpler version of the growth
+algorithm, i.e., if there are no forced vertices, a randomly chosen
+tile is added to a randomly chosen vertex (no preference for those
+108 degree angles).
+
+There are two essential differences to the algorithm presented in
+the literature: First, we do not allow the tiling to enclose an
+untiled area. Whenever this is in danger of happening, we just
+do not add the tile, hoping for a better random choice the next
+time. Second, when choosing a vertex randomly, we will take
+one that lies withing the viewport if available. If this seems to
+cause enclosures in the forced rule case, we will allow invisible
+vertices to be chosen.
+
+Tiling is restarted whenever one of the following happens: there
+are no incomplete vertices within the viewport or the tiling has
+extended a window's length beyond the edge of the window
+horizontally or vertically or forced rule choice has failed 100
+times due to areas about to become enclosed.
+
+.SH OPTIONS
+.I penrose
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors are chosen randomly.
+.TP 8
+.B \-size \fIinteger\fP
+How big the tiles should be. Default 40 pixels.
+
+.TP 8
+.B \-ammann \fIinteger\fP
+.TP 8
+.B \-no\-ammann \fIinteger\fP
+Whether Ammann lines should be added.
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1996 by Timo Korvola.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Timo Korvola <tkorvola@dopey.hut.fi>, 1996.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+pyro - simulate fireworks
+.SH SYNOPSIS
+.B pyro
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-count \fIinteger\fP] [\-frequency \fIinteger\fP] [\-scatter \fIinteger\fP]
+.SH DESCRIPTION
+The \fIpyro\fP program simulates fireworks, in a way similar to a Macintosh
+program of the same name.
+.SH OPTIONS
+.I pyro
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-count \fIinteger\fP
+How many particles should be allowed on the screen at once. Default 100.
+.TP 8
+.B \-frequency \fIinteger\fP
+How often new missiles should launch. Default 30.
+.TP 8
+.B \-scatter \fIinteger\fP
+How many particles should appear when a missile explodes. Default 20.
+The actual number used is between \fIN\fP and \fIN+(N/2)\fP.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+.TH XScreenSaver 1 "27-Apr-97" "X Version 11"
+.SH NAME
+qix - bounce colored lines around a window
+.SH SYNOPSIS
+.B qix
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-segments \fIint\fP] [\-spread \fIpixels\fP] [\-size \fIpixels\fP] [\-count \fIint\fP] [\-color-shift \fIdegrees\fP] [\-delay \fIusecs\fP] [\-random] [\-linear] [\-solid] [\-hollow] [\-xor] [\-no\-xor] [\-transparent] [\-non\-transparent] [\-additive] [\-subtractive] [\-poly \fIint\fP] [\-gravity] [\-no\-gravity]
+.SH DESCRIPTION
+The \fIqix\fP program bounces a series of line segments around its window.
+This is truly the swiss army chainsaw of qix programs. If you know of one
+with more display modes, I want to know about it.
+.SH OPTIONS
+.I qix
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-segments \fIinteger\fP
+How many line segments should be drawn. Default 50.
+.TP 8
+.B \-spread \fIinteger\fP
+How far apart the endpoints of one segment should be from the next.
+Default 8.
+.TP 8
+.B \-size \fIinteger\fP
+The maximum distance one endpoint of a segment is allowed to be from
+the opposite end of that segment. Default 0, meaning unlimited.
+.TP 8
+.B \-count \fIinteger\fP
+How many qixes to draw. Default 1.
+.TP 8
+.B \-color\-shift \fIdegrees\fP
+If on a color display, the color of the line segments will cycle through
+the spectrum. This specifies how far the hue of each segment should be
+from the next, in degrees on the HSV wheel. Default 3.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation.
+Default 25000, or about 0.025 seconds.
+.TP 8
+.B \-random
+The \fIqix\fP will wander around the screen semi-randomly. This is the
+default.
+.TP 8
+.B \-linear
+The opposite of \fI\-random\fP: the \fIqix\fP will travel in straight lines
+until it reaches a wall, and then it will bounce.
+.TP 8
+.B \-solid
+If this is specified, then the area between the line segments will be filled
+in with the appropriate color, instead of the \fIqix\fP simply being composed
+of one-pixel-wide line segments. This option looks really good in color.
+.TP 8
+.B \-hollow
+The opposite of \fI\-solid\fP; this is the default.
+.TP 8
+.B \-xor
+If this is specified, then qix segments will be drawn and erased with xor,
+instead of being drawn in some color and erased in the background color.
+This implies \fI\-mono\fP, in that only two colors can be used.
+.TP 8
+.B \-transparent
+If this is specified, and \fI\-count\fP is greater than 1, then each qix
+will be drawn in one color, and when they overlap, the colors will be mixed.
+This only works on \fBPseudoColor\fP displays. This looks best in
+conjuction with \fI\-solid\fP.
+.TP 8
+.B \-non\-transparent
+Turns off \fI\-transparent\fP.
+.TP 8
+.B \-additive
+If \fI\-transparent\fP is specified, then this option means that the colors
+will be mixed using an additive color model, as if the qixes were projected
+light. This is the default.
+.TP 8
+.B \-subtractive
+If \fI\-transparent\fP is specified, then this option means that the
+colors will be mixed using a subtractive color model, as if the qixes were
+translucent filters.
+.TP 8
+.B \-poly \fIint\fP
+How many vertices each qix-line should have: the default is 2, meaning the
+traditional qix line shape. Three will yield triangles, and so on.
+.TP 8
+.B \-gravity
+.TP 8
+.B \-no\-gravity
+Whether there should be downward attraction. For example, the
+options
+.B \-gravity \-linear
+will make everything move in nice smooth parabolas.
+Gravity is off by default.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+Thanks to Ariel Scolnicov for the \-poly and \-gravity options.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+rocks - animation of flying through an asteroid field
+.SH SYNOPSIS
+.B rocks
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP] [\-count \fIinteger\fP] [\-delay \fIusecs\fP] [\-speed \fIinteger\fP] [\-norotate] [\-nomove] [\-3d]
+.SH DESCRIPTION
+The \fIrocks\fP program draws an animation of an asteroid field moving past
+the observer (or vice versa). Sometimes the observer picks up spin on Z axis.
+.SH OPTIONS
+.I rocks
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-count \fIinteger\fP
+Maximum number of rocks to draw on the screen at once. Default 100.
+.TP 8
+.B \-speed \fIinteger\fP
+A measure of the speed with which the observer and the rocks pass each other,
+from 1 to 100. Default 100, meaning ``very fast.'' If you're on a slow
+display connection (the animation looks jerky) then try making this number
+smaller, and/or decreasing the number of rocks.
+.TP 8
+.B \-delay \fImicroseconds\fP
+Number of microseconds to delay between each frame. Default 50000, meaning
+about 1/20th second. Compare and contrast with \fI\-speed\fP, above.
+.TP 8
+.B \-norotate
+Don't rotate the observer; just fly through the field on the level.
+.TP 8
+.B \-nomove
+Don't turn the observer; just fly straight ahead through the field.
+.TP 8
+.B \-3d
+Do red/blue 3d separations: if you look at the screen with 3d glasses,
+the rocks will be \fIjumping\fP right \fIout\fP at you. Oooooh, scaaary!
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH BUGS
+There should be an option to display doppler shift (a gravity rainbow.)
+
+Speed of rotation should be settable.
+
+Default speed of rotation should be relative to forward velocity.
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Based on Lisp Machine code copyright 1988 John Nguyen <johnn@hx.lcs.mit.edu>.
+
+Ported to C and X by Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
+
+Steering code by Jeremie Petit; 3D code by theiling@coli.uni-sb.de.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+rorschach - simulate ink-blot patterns
+.SH SYNOPSIS
+.B rorschach
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-iterations \fIinteger\fP] [\-offset \fIinteger\fP] [\-xsymmetry] [\-ysymmetry]
+.SH DESCRIPTION
+The \fIrorschach\fP program draws random patterns reminiscent of the
+psychological test of same name.
+.SH OPTIONS
+.I rorschach
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-iterations \fIinteger\fP
+How many dots should be drawn each time. Default 4000.
+.TP 8
+.B \-offset \fIinteger\fP
+How far apart the dots should be. Default 4 pixels.
+.TP 8
+.B \-xsymmetry
+Whether the images should be horizontally symmetrical. Default true.
+.TP 8
+.B \-ysymmetry
+Whether the images should be vertically symmetrical. Default false.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH BUGS
+May call your sanity into question.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+sierpinski - draws Sierpinski triangle fractals
+.SH SYNOPSIS
+.B sierpinski
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIsierpinski\fP program draws Sierpinski triangle fractals.
+.SH OPTIONS
+.I sierpinski
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors are chosen randomly.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1996 by Desmond Daignault.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Desmond Daignault <tekdd@dtol.datatimes.com>, 05-Sep-96. (Original
+xlock version was called tri.c.)
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97. (Renamed to sierpinski.)
--- /dev/null
+.TH XScreenSaver 1 "3-dec-92" "X Version 11"
+.SH NAME
+slidescreen - permute the screen image like an 8-puzzle
+.SH SYNOPSIS
+.B slidescreen
+[\-display \fIhost:display.screen\fP] [\-background \fIcolor\fP] [\-grid-size \fIpixels\fP] [\-ibw \fIpixels\fP] [\-increment \fIpixels\fP] [\-delay \fIusecs\fP] [\-delay2 \fIusecs\fP] [\-window] [\-root] [\-install] [\-visual \fIvisual\fP]
+.SH DESCRIPTION
+The \fIslidescreen\fP program takes an image of the screen, divides it into
+a grid, deletes a random square of that grid, and then randomly slides
+one of the neighbors of this "hole" into the hole (and repeat.)
+.SH OPTIONS
+.I slidescreen
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-grid-size \fIpixels\fP
+The size of the grid cells. Default 70 pixels.
+.TP 8
+.B \-ibw \fIpixels\fP
+The size of the "gutter" between grid cells. Default 1 pixel.
+.TP 8
+.B \-increment \fIpixels\fP
+How many pixels by which a piece should be moved when sliding to a new
+location. Default 10 pixels.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation of
+the motion of each segment. Default 50000, which is 0.05 seconds. This
+is closely related to the \fI\-increment\fP parameter.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between the end of the motion of
+one segment and the beginning of the motion of another. Default 1000000,
+which isone second.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 3-dec-92.
--- /dev/null
+.TH XScreenSaver 1 "13-aug-92" "X Version 11"
+.SH NAME
+flame - sucks your screen into a jet engine
+.SH SYNOPSIS
+.B flame
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-iterations \fIinteger\fP] [\-points \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-delay2 \fImicroseconds\fP]
+.SH DESCRIPTION
+The \fIslip\fP program does lots of blits and chews up your screen image.
+.SH OPTIONS
+.I flame
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 128.
+The colors used cycle through the hue, making N stops around
+the color wheel.
+.TP 8
+.B \-iterations \fIinteger\fP
+How many fractals to generate. Default 25.
+.TP 8
+.B \-points \fIinteger\fP
+How many pixels to draw for each fractal. Default 10000.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How long we should wait between drawing each fractal. Default 50000,
+or about 1/20th second.
+.TP 8
+.B \-cycles \fIinteger\fP
+How long to frobnicate. Default 50.
+
+.TP 8
+.B \-count \fIinteger\fP
+How many whooziwhatsis. Default 35.
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1992 by Scott Draves.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Scott Graves <spot@cs.cmu.edu>.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 18-Oct-93.
--- /dev/null
+.TH XScreenSaver 1 "27-May-97" "X Version 11"
+.SH NAME
+sphere - draws shaded spheres
+.SH SYNOPSIS
+.B sphere
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP]
+
+.SH DESCRIPTION
+The \fIsphere\fP program draws shaded spheres.
+.SH OPTIONS
+.I sphere
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors are chosen randomly.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1988 by Sun Microsystems, Inc.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Sun Microsystems, Inc, 1988.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 27-May-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+spiral - draws moving circular spiral patterns
+.SH SYNOPSIS
+.B spiral
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-count \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIspiral\fP program draws moving circular spiral patterns
+.SH OPTIONS
+.I spiral
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors are chosen randomly.
+.TP 8
+.B \-count \fIinteger\fP
+Default 40.
+.TP 8
+.B \-cycles \fIinteger\fP
+Default 350.
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1994 by Darrick Brown.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Darrick Brown, 1994.
+
+Improved by Peter Schmitzberger <schmitz@coma.sbg.ac.at>, 24-Jul-95.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "14-Jun-97" "X Version 11"
+.SH NAME
+starfish - radially-symmetric throbbing colormap-hacking graphics demo
+.SH SYNOPSIS
+.B starfish
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-delay \fIusecs\fP] [\-delay2 \fIsecs\fP] [\-cycle\-delay2 \fIusecs\fP] [\-thickness \fIpixels\fP] [\-rotation \fIdegrees\fP] [\-duration \fIseconds\fP] [\-colors \fIint\fP] [\-cycle] [\-no\-cycle] [\-blob] [\-no\-blob]
+.SH DESCRIPTION
+The \fIstarfish\fP program draws radially symmetric objects, which expand,
+contract, rotate, and turn inside out. It uses these shapes to lay down a
+field of smooth colors, and then rotates the colormap.
+.SH OPTIONS
+.I starfish
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-delay \fImicroseconds\fP
+How much of a delay should be introduced between steps of the animation.
+Default 10000, or about 1/100th second.
+.TP 8
+.B \-cycle\-delay \fImicroseconds\fP
+How long to wait between shifing the colormap by one step.
+Default 100000, or about 1/10th second.
+.TP 8
+.B \-thickness \fIpixels\fP
+How wide each color band should be. Default 0, meaning random (the chosen
+value will be between 0 and 15.)
+.TP 8
+.B \-rotation \fIdegrees\fP
+How quickly the objects should rotate at each step. Default 0, meaning
+random (the chosen value will be between 0 and 12 degrees.)
+.TP 8
+.B \-colors \fIint\fP
+How many colors to use. Default 200. The more colors, the smoother the
+transitions will be, and the nicer the resultant images.
+.TP 8
+.B \-cycle
+.TP 8
+.B \-no\-cycle
+Whether to do colormap cycling. Default true.
+.TP 8
+.B \-duration \fIseconds\fP
+How long to run before choosing a new shape. Default 30 seconds.
+.TP 8
+.B \-delay2 \fIseconds\fP
+When \fIduration\fP expires, how long to wait before starting a new run.
+Default 5 seconds.
+.TP 8
+.B \-blob
+.TP 8
+.B \-no\-blob
+If \fIblob\fP option is specified, then the raw shapes will be shown,
+instead of a field of colors generated from them.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided that the above copyright notice appear
+in all copies and that both that copyright notice and this permission notice
+appear in supporting documentation. No representations are made about the
+suitability of this software for any purpose. It is provided "as is" without
+express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 14-Jun-97.
--- /dev/null
+.TH XScreenSaver 1 "10-May-97" "X Version 11"
+.SH NAME
+strange - draws strange attractors
+.SH SYNOPSIS
+.B strange
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP]
+
+.SH DESCRIPTION
+The \fIstrange\fP program draws strange attractors
+.SH OPTIONS
+.I strange
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 64.
+The colors are chosen randomly.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1997 by Massimino Pascal.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+.SH AUTHOR
+Massimino Pascal <Pascal.Massimon@ens.fr>, 1997.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 10-May-97.
--- /dev/null
+.TH XScreenSaver 1 "13-May-97" "X Version 11"
+.SH NAME
+swirl - draws swirly color-cycling patterns
+.SH SYNOPSIS
+.B swirl
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP] [\-ncolors \fIinteger\fP] [\-delay \fImicroseconds\fP] [\-cycles \fIinteger\fP] [\-count \fIinteger\fP]
+
+.SH DESCRIPTION
+The \fIswirl\fP program draws swirly color-cycling patterns.
+.SH OPTIONS
+.I swirl
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.TP 8
+.B \-ncolors \fIinteger\fP
+How many colors should be used (if possible). Default 200.
+.TP 8
+.B \-cycles \fIinteger\fP
+
+.TP 8
+.B \-count \fIinteger\fP
+
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1),
+.BR xlock (1)
+.SH COPYRIGHT
+Copyright \(co 1994 M. Dobie.
+
+Permission to use, copy, modify, and distribute this software and its
+documentation for any purpose and without fee is hereby granted,
+provided that the above copyright notice appear in all copies and that
+both that copyright notice and this permission notice appear in
+supporting documentation.
+
+.SH AUTHOR
+M.Dobie <mrd@ecs.soton.ac.uk>, 1994.
+
+Ability to run standalone or with \fIxscreensaver\fP added by
+Jamie Zawinski <jwz@netscape.com>, 13-May-97.
--- /dev/null
+.TH XScreenSaver 1 "22-mar-93" "X Version 11"
+.SH NAME
+xroger - throbbing X logo, of a sort
+.SH SYNOPSIS
+.B xroger
+[\-display \fIhost:display.screen\fP] [\-foreground \fIcolor\fP] [\-background \fIcolor\fP] [\-window] [\-root] [\-mono] [\-install] [\-visual \fIvisual\fP]
+.SH DESCRIPTION
+The \fIxroger\fP program displays a replacement for the X logo with a more
+accurate Look and Feel.
+.SH OPTIONS
+.I xroger
+accepts the following options:
+.TP 8
+.B \-window
+Draw on a newly-created window. This is the default.
+.TP 8
+.B \-root
+Draw on the root window.
+.TP 8
+.B \-mono
+If on a color display, pretend we're on a monochrome display.
+.TP 8
+.B \-install
+Install a private colormap for the window.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which visual to use. Legal values are the name of a visual class,
+or the id number (decimal or hex) of a specific visual.
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH BUGS
+It should also drip blood while making a horrible screeching noise.
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver (1)
+.SH COPYRIGHT
+Copyright \(co 1992, 1993 by Jamie Zawinski. Permission to use, copy, modify,
+distribute, and sell this software and its documentation for any purpose is
+hereby granted without fee, provided fnord that the above copyright notice
+appear in all copies and that both that copyright notice and this permission
+notice appear in supporting documentation. No representations are made about
+the suitability of fnord this software for any purpose. It is provided "as
+is" without express or fnord implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+.de EX \"Begin example
+.ne 5
+.if n .sp 1
+.if t .sp .5
+.nf
+.in +.5i
+..
+.de EE
+.fi
+.in -.5i
+.if n .sp 1
+.if t .sp .5
+..
+.TH XScreenSaver 1 "31-May-97" "X Version 11"
+.SH NAME
+xscreensaver-command - control a running xscreensaver process
+.SH SYNOPSIS
+.B xscreensaver-command
+[\-help] [\-demo] [\-activate] [\-deactivate] [\-lock] [\-cycle] [\-next] [\-prev] [\-exit] [\-restart] [\-version] [\-time]
+.SH DESCRIPTION
+The \fIxscreensaver\-command\fP program controls a running \fIxscreensaver\fP
+process by sending it client-messages.
+.SH OPTIONS
+.I xscreensaver-command
+accepts the following options:
+.TP 8
+.B \-help
+Prints a brief summary of command-line options.
+.TP 8
+.B \-demo
+Cause the screensaver to enter its interactive demo mode, in which one
+can experiment with the various graphics hacks available. See
+.BR xscreensaver (1)
+for details.
+.TP 8
+.B \-activate
+Tell the screensaver to turn on immediately (that is, pretend that the
+user been idle for long enough.) It will turn off as soon as there is
+any user activity, as usual.
+
+It is useful to run this from a menu; you may wish to run it as
+.EX
+sleep 5 ; xscreensaver-command -activate
+.EE
+to be sure that you have time to remove your hand from the mouse before
+the screensaver comes on.
+.TP 8
+.B \-deactivate
+Tell the screensaver to turn off, as if there had been user activity.
+If locking is enabled, then the screensaver will prompt for a password
+as usual.
+.TP 8
+.B \-lock
+Like \fI\-activate\fP, but a password will be required before the screensaver
+turns off, even if the screensaver's \fIlock\fP resource is false. The
+display will be locked immediately even if the screensaver's \fIlockTimeout\fP
+resource is non-zero.
+.TP 8
+.B \-cycle
+Tell the screensaver to change which graphics hack it is running, just
+as if the ``cycle'' timer had expired. A new hack will be chosen randomly.
+.TP 8
+.B \-next
+This is like either \fI\-activate\fP or \fI\-cycle\fP, depending on which is
+more appropriate, except that the screenhack that will be run is the next
+one in the list of programs, instead of a randomly-chosen one. Repeatedly
+executing this will cycle through each hack in turn (though using
+the \fI\-demo\fP option is probably an easier way to accomplish that.)
+.TP 8
+.B \-prev
+This is like \fI\-next\fP, but cycles in the other direction.
+.TP 8
+.B \-exit
+Causes the screensaver process to exit gracefully. This is a safer and
+easier way to kill the screensaver than by using \fIkill\fP.
+
+.B Warning:
+never use \fIkill -9\fP with \fIxscreensaver\fP while the screensaver is
+active. If you are using a virtual root window manager, that can leave
+things in an inconsistent state, and you may need to restart your window
+manager to repair the damage.
+.TP 8
+.B \-restart
+Causes the screensaver process to exit and then restart with the same command
+line arguments. This is a good way of causing the screensaver to re-read the
+resource database.
+
+If the screensaver is run from \fIxdm(1)\fP (that is, it is already running
+before you log in) then you may want to issue the ``restart'' command from
+one of your startup scripts, so that the screensaver gets your resource
+settings instead of the default ones.
+.TP 8
+.B \-version
+Print (on stdout) the version number of the xscreensaver program that is
+running on $DISPLAY. (To see the version number of \fIxscreensaver-command\fP
+itself, use the \fI\-help\fP option.)
+.TP 8
+.B \-time
+This option prints on stdout the time at which the screensaver last activated
+(blanked the screen) or deactivated (restored the screen.) Note that the
+activation-time is not the last time at which the user was active, but is
+some time later (it is the time at which either: xscreensaver decided that
+the user has been idle long enough; or, the user explicitly activated the
+screensaver or locker.)
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the host and display number of the screen whose saver is
+to be manipulated.
+.TP 8
+.B PATH
+to find the executable to restart (for the \fI\-restart\fP command).
+Note that this variable is consulted in the environment of
+the \fIxscreensaver\fP process, not the \fIxscreensaver-command\fP process.
+.SH "SEE ALSO"
+.BR X (1),
+.BR xscreensaver (1)
+.SH BUGS
+Some diagnostics are reported on the stderr of the \fIxscreensaver\fP
+process, not this process, so the caller of \fIxscreensaver-command\fP
+may not see the error messages.
+.SH COPYRIGHT
+Copyright \(co 1992, 1993, 1997 by Jamie Zawinski.
+Permission to use, copy, modify, distribute, and sell this software and its
+documentation for any purpose is hereby granted without fee, provided that
+the above copyright notice appear in all copies and that both that copyright
+notice and this permission notice appear in supporting documentation. No
+representations are made about the suitability of this software for any
+purpose. It is provided "as is" without express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>, 13-aug-92.
--- /dev/null
+..de EX \"Begin example
+.ne 5
+.if n .sp 1
+.if t .sp .5
+.nf
+.in +.5i
+..
+.de EE
+.fi
+.in -.5i
+.if n .sp 1
+.if t .sp .5
+..
+.TH XScreenSaver 1 "31-May-97" "X Version 11"
+.SH NAME
+xscreensaver - graphics hack and screen locker, launched when the user is idle
+.SH SYNOPSIS
+.B xscreensaver
+[\-display \fIhost:display.screen\fP] [\-timeout \fIint\fP] [\-cycle \fIint\fP] [\-nice \fIint\fP] [\-lock] [\-no\-lock] [\-lock\-timeout \fIint\fP] [\-demo] [\-visual \fIvisual\fP] [\-install] [\-no\-install] [\-verbose] [\-silent] [\-xidle\-extension] [\-no\-xidle\-extension] [\-sgi\-extension] [\-no\-sgi\-extension] [\-mit\-extension] [\-no\-mit\-extension] [\-xrm \fIresources\fP]
+.SH DESCRIPTION
+The \fIxscreensaver\fP program waits until the keyboard and mouse have been
+idle for a period, and then runs a graphics demo chosen at random. It
+turns off as soon as there is any mouse or keyboard activity.
+
+This program can lock your terminal in order to prevent others from using it,
+though its default mode of operation is merely to display pretty pictures on
+your screen when it is not in use.
+
+The benefit that this program has over the combination of the
+.BR xlock (1)
+and
+.BR xautolock (1)
+programs is the ease with which new graphics hacks can be installed. You
+don't need to recompile (or even re-run) this program to add a new display
+mode.
+.SH OPTIONS
+.I xscreensaver
+accepts the following command line options:
+.TP 8
+.B \-timeout \fIminutes\fP
+The screensaver will activate after the keyboard and mouse have been idle
+for this many minutes. Default 10.
+.TP 8
+.B \-cycle \fIminutes\fP
+After the screensaver has been running for this many minutes, the currently
+running graphics hack sub-process will be killed (with \fBSIGTERM\fP), and a
+new one started. If this is 0, then the graphics hack will not be changed:
+only one demo will run until the screensaver is deactivated by user activity.
+Default 10.
+.TP 8
+.B \-nice \fIinteger\fP
+The sub-processes created by \fIxscreensaver\fP will be ``niced'' to this
+level, so that they are given lower priority than other processes on the
+system, and don't increase the load unnecessarily. The default is 20.
+
+(Higher numbers mean lower priority; see
+.BR nice (1)
+for details.)
+.TP 8
+.B \-lock
+Enable locking: before the screensaver will turn off, it requires you to
+type the password of the person who launched the screensaver, or the root
+password. (Note: this doesn't work if the screensaver is launched
+by
+.BR xdm (1)
+because it can't know the user-id of the logged-in user.)
+.TP 8
+.B \-no\-lock
+Disable locking. This is the default.
+.TP 8
+.B \-lock\-timeout \fIminutes\fP
+This is how long after the screensaver activates that locking is enabled.
+For example, if this is 5, and \fI\-timeout\fP is 10, then after 10 minutes,
+the screen would blank. If there was user activity at 12 minutes, no password
+would be required. But, if there was user activity at 15 minutes or later
+(\fI\-lock\-timeout\fP minutes after activation) then a password would be
+required. The default is 0, meaning that if locking is enabled, then
+a password will be required as soon as the screensaver activates.
+.TP 8
+.B \-demo
+Enter the interactive demo mode immediately after startup. Normally
+demo mode is invoked via the
+.BR xscreensaver\-command (1)
+program, but this is a shortcut for new users. See below for a description
+of how demo-mode works.
+.TP 8
+.B \-visual \fIvisual\fP
+Specify which X visual to use by default. Legal values are:
+.RS 8
+.TP 8
+.B default
+Use the screen's default visual (the visual of the root window.)
+This is the default.
+.TP 8
+.B best
+Use the visual which supports the most colors. Note, however, that the
+visual with the most colors might be a TrueColor visual, which does not
+support colormap animation.
+.TP 8
+.B mono
+Use a monochrome visual, if there is one.
+.TP 8
+.B gray
+Use a grayscale or staticgray visual, if there is one and it has more than
+one plane (that is, it's not monochrome.)
+.TP 8
+.B color
+Use the best of the color visuals, if there are any.
+.TP 8
+.I class
+where \fIclass\fP is one
+
+of \fBStaticGray\fP, \fBStaticColor\fP, \fBTrueColor\fP, \fBGrayScale\fP, \fBPseudoColor\fP,
+or \fBDirectColor\fP. Selects the deepest visual of
+the given class.
+.TP 8
+.I number
+where \fInumber\fP (decimal or hex) is interpreted as a visual id number,
+as reported by the
+.BR xdpyinfo (1)
+program; in this way you can have finer control over exactly which visual
+gets used, for example, to select a shallower one than would otherwise
+have been chosen.
+.RE
+.RS 8
+.PP
+Note that this option specifies only the \fIdefault\fP visual that will
+be used: the visual used may be overridden on a program-by-program basis.
+See the description of the \fBprograms\fP resource, below.
+.RE
+.TP 8
+.B \-install
+When using a non-default visual, install a private colormap while the
+screensaver is active, so that the graphics hacks can get as many colors as
+possible. This is the default. (This only applies when the screen's
+default visual is being used, since non-default visuals get their own
+colormaps automatically.)
+.TP 8
+.B \-no\-install
+Use the default colormap.
+.TP 8
+.B \-verbose
+Print diagnostics.
+.TP 8
+.B \-silent
+
+.TP 8
+.B \-xidle\-extension
+Use the \fBXIDLE\fP server extension to decide whether the user is idle.
+This is the default if \fIxscreensaver\fP has been compiled with support
+for this extension. On X11R4 or X11R5 systems, the XIdle method is faster
+and more reliable than what will be done otherwise, so use it if you can.
+.TP 8
+.B \-no\-xidle\-extension
+Don't use the \fBXIDLE\fP server extension.
+.TP 8
+.B \-sgi\-extension
+Use the SGI \fBSCREEN_SAVER\fP server extension to decide whether the user
+is idle. This is the default if \fIxscreensaver\fP has been compiled with
+support for this extension (which is the default on SGI systems.). If it
+is available, the \fBSCREEN_SAVER\fP method is faster and more reliable than
+what will be done otherwise, so use it if you can.
+.TP 8
+.B \-no\-sgi\-extension
+Don't use the SGI \fBSCREEN_SAVER\fP server extension.
+.TP 8
+.B \-mit\-extension
+Use the \fBMIT\-SCREEN\-SAVER\fP server extension to decide whether the user
+is idle. This is the default if \fIxscreensaver\fP has been compiled with
+support for this extension. However, this extension is flaky, so it's use
+is not really recommended. (It also makes the \fIfade\fP option not work
+properly.)
+.TP 8
+.B \-no\-mit\-extension
+Don't use the \fBMIT\-SCREEN\-SAVER\fP server extension.
+.SH X RESOURCES
+\fIxscreensaver\fP understands the following resources:
+.PP
+.TP 8
+.B timeout \fR(class \fBTime\fP)
+Same as the \fI\-timeout\fP command-line option. Default 10 minutes.
+.TP 8
+.B cycle \fR(class \fBTime\fP)
+Same as the \fI\-cycle\fP command-line option. Default 10 minutes.
+.TP 8
+.B nice \fR(class \fBNice\fP)
+Same as the \fI\-nice\fP command-line option. Default 10.
+.TP 8
+.B lock \fR(class \fBBoolean\fP)
+Same as the \fI\-lock\fP command-line option.
+.TP 8
+.B lockTimeout \fR(class \fBTime\fP)
+Same as the \fI\-lock\-timeout\fP command-line option.
+.TP 8
+.B passwdTimeout \fR(class \fBTime\fP)
+If the screen is locked, then this is how many seconds the password dialog box
+should be left on the screen before giving up (default 30.) This should not
+be too large: the X server is grabbed for the duration that the password
+dialog box is up (for security purposes) and leaving the server grabbed for
+too long can cause problems.
+.TP 8
+.B verbose \fR(class \fBBoolean\fP)
+Same as the \fI\-verbose\fP command-line option.
+.TP 8
+.B xidle \fR(class \fBBoolean\fP)
+Same as the \fI\-xidle\fP command-line option.
+.TP 8
+.B fade \fR(class \fBBoolean\fP)
+If this is true, then when the screensaver activates, the current contents
+of the screen will fade to black instead of simply winking out. This only
+works on displays with writable colormaps, that is, if the screen's default
+visual is a PseudoColor visual. Default true. A fade will also be done when
+switching graphics hacks (when the \fIcycle\fP timer expires.)
+.TP 8
+.B unfade \fR(class \fBBoolean\fP)
+If this is true, then when the screensaver deactivates, the original contents
+of the screen will fade in from black instead of appearing immediately. This
+only works on displays with writable colormaps, and if \fIfade\fP is true
+as well. Default false.
+.TP 8
+.B fadeSeconds \fR(class \fBTime\fP)
+If \fIfade\fP is true, this is how long the fade will be in
+seconds (default 3.)
+.TP 8
+.B fadeTicks \fR(class \fBInteger\fP)
+If \fIfade\fP is true, this is how many times a second the colormap will
+be changed to effect a fade. Higher numbers yield smoother fades, but
+may make the fades take longer than the specified \fIfadeSeconds\fP if
+your server isn't fast enough to keep up. Default 20.
+.TP 8
+.B visualID \fR(class \fBVisualID\fP)
+Same as the \fI\-visual\fP command-line option. Default \fBdefault\fP.
+.TP 8
+.B installColormap \fR(class \fBBoolean\fP)
+Same as the \fI\-install\fP command-line option. Default true.
+.TP 8
+.B captureStderr \fR(class \fBBoolean\fP)
+Whether \fIxscreensaver\fP should redirect its standard-error stream to the
+window itself. Since its nature is to take over the screen, you would not
+normally see error messages generated by the screensaver or the programs it
+runs; this resource will cause the output of all relevant programs to be
+drawn on the screensaver window itself instead of written to the controlling
+terminal of the screensaver driver process. Default true.
+.TP 8
+.B captureStdout \fR(class \fBBoolean\fP)
+Like \fBcaptureStderr\fP but for the standard-output stream. Default true.
+.TP 8
+.B font \fR(class \fBFont\fP)
+The font used for the stdout/stderr text, if \fBcaptureStdout\fP or
+\fBcaptureStderr\fP are true. Default \fB*\-medium\-r\-*\-140\-*\-m\-*\fP
+(a 14 point fixed-width font.)
+.TP 8
+.B textForeground \fR(class \fBForeground\fP)
+The foreground color used for the stdout/stderr text, if \fBcaptureStdout\fP
+or \fBcaptureStderr\fP are true. Default: Yellow.
+.TP 8
+.B textBackground \fR(class \fBBackground\fP)
+The background color used for the stdout/stderr text, if \fBcaptureStdout\fP
+or \fBcaptureStderr\fP are true. Default: Black.
+.TP 8
+.B programs \fR(class \fBPrograms\fP)
+The graphics hacks which \fIxscreensaver\fP runs when the user is idle.
+The value of this resource is a string, one \fIsh\fP-syntax command per line.
+Each line must contain exactly one command -- no semicolons, no ampersands.
+
+When the screensaver starts up, one of these is selected at random, and
+run. After the \fIcycle\fP period expires, it is killed, and another
+is selected and run.
+
+If the value of this resource is empty, then no programs will be run; the
+screen will simply be made black.
+
+If the display has multiple screens, then a different program will be run
+for each screen.
+
+Note that you must escape the newlines; here is an example of how you
+might set this in your \fI.Xdefaults\fP file:
+
+.EX
+xscreensaver.programs: \\
+ qix -root \\n\\
+ ico -r -faces -sleep 1 -obj ico \\n\\
+ xdaliclock -builtin2 -root \\n\\
+ xv -root -rmode 5 image.gif -quit \\n
+.EE
+.RS 8
+To use a program as a screensaver, two things are required: that that
+program draw on the root window (or be able to be configured to draw on
+the root window); and that that program understand ``virtual root''
+windows, as used by virtual window managers such as \fItvtwm\fP. (Generally,
+this is accomplished by just including the \fI"vroot.h"\fP header file in
+the program's source.)
+
+If there are some programs that you want to run only when using a color
+display, and others that you want to run only when using a monochrome
+display, you can specify that like this:
+
+.EX
+ mono: mono-program -root \\n\\
+ color: color-program -root \\n\\
+.EE
+.RE
+.RS 8
+More generally, you can specify the kind of visual that should be used for
+the window on which the program will be drawing. For example, if one
+program works best if it has a colormap, but another works best if it has
+a 24-bit visual, both can be accomidated:
+
+.EX
+ PseudoColor: cmap-program -root \\n\\
+ TrueColor: 24bit-program -root \\n\\
+.EE
+.RE
+.RS 8
+(This sort of thing used to be accomplished with the \fIcolorPrograms\fP
+and \fImonoPrograms\fP resources, but those resources have now been removed;
+a warning will be issued if they are used.)
+
+If you specify a particular visual for a program, and that visual does not
+exist on the screen, then that program will not be chosen to run. This
+means that on displays with multiple screens of different depths, you can
+arrange for appropriate hacks to be run on each. For example, if one screen
+is color and the other is monochrome, hacks that look good in mono can be
+run on one, and hacks that only look good in color will show up on the other.
+.RE
+.PP
+.PP
+Normally you won't need to change the following resources:
+.TP 8
+.B bourneShell \fR(class \fBBourneShell\fP)
+The pathname of the shell that \fIxscreensaver\fP uses to start subprocesses.
+This must be whatever your local variant of \fB/bin/sh\fP is -- in particular,
+it must not be \fBcsh\fP.
+.TP 8
+.B windowCreationTimeout \fR(class \fBTime\fP)
+When server extensions are not in use, this controls the delay between when
+windows are created and when \fIxscreensaver\fP selects events on them.
+Default 30 seconds.
+.TP 8
+.B pointerPollTime \fR(class \fBTime\fP)
+When server extensions are not in use, this controls how
+frequently \fIxscreensaver\fP checks to see if the mouse position or buttons
+have changed. Default 5 seconds.
+.TP 8
+.B initialDelay \fR(class \fBTime\fP)
+When server extensions are not in use, \fIxscreensaver\fP will wait this many
+seconds before selecting events on existing windows, under the assumption that
+\fIxscreensaver\fP is started during your login procedure, and the window
+state may be in flux. Default 30 seconds.
+.TP 8
+.B overlayStderr \fR(class \fBBoolean\fP)
+If \fBcaptureStderr\fP or \fBcaptureStdout\fP are True, and your server
+supports ``overlay'' visuals, then the text will be written into one of
+the higher layers instead of into the same layer as the running screenhack.
+Set this to False to disable that (though you shouldn't need to.)
+.SH "HOW IT WORKS"
+When it is time to activate the screensaver, a full-screen black window is
+created on each screen of the display. The window or windows is given the
+appropriate properties so that, to any subsequently-created programs, it
+will appear to be a ``virtual root'' window. Because of this, any program
+which draws on the root window (and which understands virtual roots) can be
+used as a screensaver.
+
+When the user becomes active again, the screensaver windows are unmapped and
+the running subprocesses are killed by sending them \fBSIGTERM\fP. This is
+also how the subprocesses are killed when the screensaver decides that it's
+time to run a different demo: the old one is killed and a new one is launched.
+
+Before launching a subprocess, \fIxscreensaver\fP stores an appropriate value
+for \fB$DISPLAY\fP in the environment that the child will recieve. (This is
+so that if you start \fIxscreensaver\fP with a \fI-display\fP argument, the
+programs which \fIxscreensaver\fP launches will draw on the same display;
+and so that the child will end up drawing on the appropriate screen of a
+multi-headed display.)
+
+When the screensaver turns off, or is killed, care is taken to restore
+the ``real'' virtual root window if there is one. Because of this, it is
+important that you not kill the screensaver process with \fIkill -9\fP if
+you are running a virtual-root window manager. If you kill it with \-9,
+you may need to restart your window manager to repair the damage. This
+isn't an issue if you aren't running a virtual-root window manager.
+
+For all the gory details, see the commentary at the top of xscreensaver.c.
+
+You can control a running screensaver process by using the
+.BR xscreensaver\-command (1)
+program (which see.)
+.SH USING XDM(1)
+You can run \fIxscreensaver\fP from your xdm session, so that the
+screensaver will run even when nobody is logged in on the console.
+Simply add \fB"xscreensaver &"\fP to your \fI/usr/lib/X11/xdm/Xsetup\fP
+file. Because \fIxdm\fP grabs the keyboard, keypresses will not make
+the screensaver deactivate, but any mouse activity will.
+
+(If your system does not seem to be executing the \fIXsetup\fP file, you
+may need to configure it to do so -- the traditional way to do this is
+to make that file the value of the \fIDisplayManager*setup\fP resource
+in the \fIxdm-config\fP file. See the man page for
+.BR xdm (1)
+for more details.)
+
+Users may want to add \fB"xscreensaver-command -restart"\fP to their
+startup scripts, so that the screensaver will be reinitialized with
+their private resource settings when they log in.
+
+It is safe to run this program as root (as \fIxdm\fP is likely to do.) If
+run as root, \fIxscreensaver\fP changes its effective user and group ids to
+something safe (like \fI"nobody"\fP) before connecting to the X server
+or launching user-specified programs.
+
+Locking doesn't work if the screensaver is launched by \fIxdm\fP. To get
+around this, you can run the screensaver from \fIxdm\fP without locking,
+and kill and restart it from your personal X startup script to enable
+locking; for example:
+
+.EX
+ xscreensaver-command -exit ; xscreensaver
+.EE
+.SH DEMO MODE
+If \fIxscreensaver\fP receives the \fBDEMO\fP ClientMessage, which is done
+by running the \fBxscreensaver\-command\fP program with the \fB\-demo\fP
+option, the screensaver will black the screen and pop up a dialog box from
+which you can examine and experiment with the client programs.
+
+The dialog box contains a scrolling list, a text field, and a number of
+buttons.
+
+Double-clicking on one of the programs in the list will run it. Clicking
+the mouse again will bring the dialog box back.
+
+Single-clicking in the list will place the indicated program and its args
+in the text field to be edited. Edit the arguments and hit return to run
+the program with the parameters you have specified. (Note that these are
+one-time changes and won't be remembered; to make the changes permanent,
+you need to edit your X resource file.)
+
+The buttons are:
+.TP 8
+.B Run Next
+Clicking this button will run the next program in the list after the
+currently-selected one, and will scroll around to the top when it reaches
+the bottom.
+.TP 8
+.B Run Previous
+Opposite of Run Next; at the top, it scrolls around to the bottom.
+.TP 8
+.B Edit Parameters
+This pops up a second dialog box, in which you have the option to
+interactively change most of the screensaver's operational parameters,
+such as its timeouts, and whether it should lock the screen. Changing
+these parameters here will affect only the running \fIxscreensaver\fP
+process; to make the changes permanent, you need to edit your X resource
+file.
+.TP 8
+.B Exit Demo Mode
+Returns to normal screensaver operation.
+.TP 8
+.B Reinitialize
+This causes the X resource database to be re-read, to pick up any changes
+you might have made. This works by causing the screensaver process to exit
+and then restart itself with the same command-line arguments. This is just
+like the \fI\-restart\fP argument to
+.BR xscreensaver\-command (1)
+except that when executed from this button, the screensaver will
+automatically return to demo mode after restarting.
+.SH BUGS
+(This is not a bug, but) note that as of release 1.32, the \fBcolorPrograms\fP
+and \fBmonoPrograms\fP resources are no longer used: they have been
+supplanted by the extended syntax of the \fBprograms\fP resource (see above.)
+.TP 8
+Extensions
+If you are not making use of one of the server extensions (\fBXIDLE\fP,
+\fBSCREEN_SAVER\fP, or \fBMIT-SCREEN-SAVER\fP), then it is possible, in rare
+situations, for \fIxscreensaver\fP to interfere with event propagation and make
+another X program malfunction. For this to occur, that other application
+would need to \fInot\fP select \fBKeyPress\fP events on its non-leaf windows
+within the first 30 seconds of their existence, but then select for them later.
+In this case, that client \fImight\fP fail to receive those events.
+This isn't very likely, since programs generally select a constant set
+of events immediately after creating their windows and then don't change
+them, but this is the reason that it's a good idea to install and use one
+of the server extensions instead, to work around this shortcoming in the
+X protocol.
+.TP 8
+Machine Load
+Although this program ``nices'' the subprocesses that it starts,
+graphics-intensive subprograms can still overload the machine by causing
+the X server process itself (which is not ``niced'') to suck a lot of
+cycles. Care should be taken to slow down programs intended for use as
+screensavers by inserting strategic calls to
+.BR sleep (3)
+or
+.BR usleep (3)
+(or making liberal use of any \fI\-delay\fP options which the programs
+may provide.)
+
+Also, an active screensaver will cause your X server to be pretty much
+permanently swapped in; but the same is true of any program that draws
+periodically, like
+.BR xclock (1)
+or
+.BR xload (1).
+.TP 8
+Latency and Responsiveness
+If the subprocess is drawing too quickly and the connection to the X
+server is a slow one (such as an X terminal running over a phone line) then
+the screensaver might not turn off right away when the user becomes active
+again (the
+.BR ico (1)
+demo has this problem if being run in full-speed mode). This can be
+alleviated by inserting strategic calls to
+.BR XSync (3)
+in code intended for use as a screensaver. This prevents too much graphics
+activity from being buffered up.
+.TP 8
+Locking and XDM
+Locking doesn't work if the screensaver is launched by \fIxdm\fP.
+The reason for this is that when it is launched by \fIxdm\fP, the
+screensaver process is owned by some standard user id (such as \fIroot\fP
+or \fIdaemon\fP) instead of the user who is logged in on the console:
+because the screensaver was started \fIbefore\fP anyone was logged in.
+In order for the screensaver to prompt for the password of the person
+who had logged in from \fIxdm\fP, it would need to know who that user was,
+and there is no reliable and safe way to figure that out. (And even if
+there was, there would be some other security issues here as well.)
+
+So if you want to use it as a locker, you must start it with your user id.
+If it has already been started by \fIxdm\fP, you can kill it with
+\fBxscreensaver-command -exit\fP, and then start it again as you.
+.TP 8
+Passwords
+If you get an error message like ``couldn't get password of \fIuser\fP''
+then this probably means that you're on a system in which the
+.BR getpwent (3)
+library routine can only be effectively used by root. If this is the case,
+then \fIxscreensaver\fP must be installed as setuid to root. Care has
+been taken to make this a safe thing to do.
+
+It also may mean that your system uses shadow passwords instead of the
+standard \fIgetpwent\fP interface; in that case, you may need to change
+some options in \fIconfig.h\fP and recompile.
+.TP 8
+TWM and Colormaps
+The \fBinstallColormap\fP option doesn't work very well with the
+.BR twm (1)
+window manager and its descendants.
+
+There is a race condition between the screensaver and this window manager,
+which can result in the screensaver's colormap not getting installed
+properly, meaning the graphics hacks will appear in essentially random
+colors. (If the screen goes white instead of black, this is probably why.)
+
+The
+.BR mwm (1)
+and
+.BR olwm (1)
+window managers don't seem to have this problem. The race condition exists
+because X apparently does not provide a way for an OverrideRedirect window to
+have its own colormap, short of grabbing the server (which is neither a good
+idea, nor really possible with the current design.) What happens is that, as
+soon as the screensaver installs its colormap, \fBtwm\fP responds to
+the \fBColormapNotify\fP event that is generated by re-instaling the default
+colormap. Apparently, \fBtwm\fP doesn't \fIalways\fP do this; it seems to do
+it regularly if the screensaver is activated from a menu item, but seems to
+not do it if the screensaver comes on of its own volition, or is activated
+from another console. Any thoughts on this problem are welcome...
+.TP 8
+XView Clients
+Apparently there are some problems with XView programs getting confused
+and thinking that the screensaver window is the real root window even when
+the screensaver is not active: ClientMessages intended for the window manager
+are sent to the screensaver window instead. This could be solved by making
+xscreensaver forward all unrecognised ClientMessages to the real root window,
+but there may be other problems as well. If anyone has any insight on the
+cause of this problem, please let me know.
+.TP 8
+MIT Extension and Fading
+When using the \fBMIT-SCREEN-SAVER\fP extension in conjunction with
+the \fBfade\fP option, you may notice an unattractive flicker just before
+the fade begins. This is because the server maps a black window just before
+it tells the \fIxscreensaver\fP process to activate. The \fIxscreensaver\fP
+process immediately unmaps that window, but this results in a flicker. I
+haven't figured a way to get around this; it seems to be a fundamental
+property of the (mis-) design of this server extension.
+.TP 8
+LessTif (Motif Clone)
+Rumor has it that demo mode is buggy if XScreenSaver was compiled with the
+GNU LessTif reimplementation of Motif. Since it works fine with OSF Motif
+on a variety of systems, I assume these problems are due to bugs in LessTif.
+Again, any insight would be appreciated.
+.TP 8
+Red Hot Lava
+There need to be a lot more graphics hacks. In particular, there should be
+a simulation of a Lavalite (tm).
+.SH ENVIRONMENT
+.PP
+.TP 8
+.B DISPLAY
+to get the default host and display number, and to inform the sub-programs
+of the screen on which to draw.
+.TP 8
+.B XENVIRONMENT
+to get the name of a resource file that overrides the global resources
+stored in the RESOURCE_MANAGER property.
+.SH UPGRADES
+The latest version can always be found at
+http://people.netscape.com/jwz/xscreensaver/
+.SH SEE ALSO
+.BR X (1),
+.BR xscreensaver\-command (1),
+.BR xlock (1),
+.BR xnlock (1),
+.BR xautolock (1),
+.BR xdm (1),
+.BR attraction (1),
+.BR greynetic (1),
+.BR helix (1),
+.BR hopalong (1),
+.BR noseguy (1),
+.BR pyro (1),
+.BR xroger (1),
+.BR qix (1),
+.BR rocks (1),
+.BR rorschach (1),
+.BR blitspin (1),
+.BR imsmap (1),
+.BR slidescreen (1),
+.BR decayscreen (1),
+.BR maze (1),
+.BR hypercube (1),
+.BR halo (1),
+.BR flame (1),
+.BR pedal (1),
+.BR lmorph (1),
+.BR deco (1),
+.BR moire (1),
+.BR kaleidescope (1),
+.BR bubbles (1),
+.BR lightning (1),
+.BR strange (1),
+.BR fract (1),
+.BR spiral (1),
+.BR laser (1),
+.BR grav (1),
+.BR drift (1),
+.BR ifs (1),
+.BR julia (1),
+.BR penrose (1),
+.BR sierpinski (1),
+.BR hopalong (1),
+.BR braid (1),
+.BR bouboule (1),
+.BR galaxy (1),
+.BR flag (1),
+.BR forest (1),
+.BR sphere (1),
+.BR lisa (1),
+.BR xdaliclock (1),
+.BR xbouncebits (1),
+.BR ico (1),
+.BR xswarm (1),
+.BR xwave (1),
+.BR xv (1),
+.BR xtacy (1),
+.BR bongo (1),
+.BR xfishtank (1)
+.SH COPYRIGHT
+Copyright \(co 1991, 1992, 1993, 1994, 1995, 1996, 1997 by Jamie Zawinski.
+Permission to use, copy, modify, distribute, and sell this software and its
+documentation for any purpose is hereby granted without fee, provided that
+the above copyright notice appear in all copies and that both that copyright
+notice and this permission notice appear in supporting documentation. No
+representations are made about the suitability of this software for any
+purpose. It is provided "as is" without express or implied warranty.
+.SH AUTHOR
+Jamie Zawinski <jwz@netscape.com>. Written in late 1991; first posted
+to comp.sources.x on 13-Aug-1992.
+
+Please let me know if you find any bugs or make any improvements.
+
+Thanks to David Wojtowicz for implementing \fIlockTimeout\fP.
+
+Thanks to Martin Kraemer for adding support for shadow passwords and
+locking-disabled diagnostics.
+
+Thanks to the many people who have contributed graphics demos to the package.
+
+Thanks to Patrick Moreau for the VMS port.
+
+And huge thanks to Jon A. Christopher for implementing the Athena dialog
+support, so that locking and demo-mode work even if you don't have Motif.
+++ /dev/null
-From mrapple@quack.kfu.com Mon Apr 26 18:31:07 1993
-Newsgroups: alt.hackers
-From: mrapple@quack.kfu.com (Nick Sayer)
-Subject: screenblank and xautolock living in harmony
-Organization: The Duck Pond public unix: +1 408 249 9630, log in as 'guest'.
-Date: 23 Apr 1993 19:26:57 UTC
-
-
-I have a Sun and use xinit to start X. This presented a problem.
-If I use xautolock or xscreensaver to save the screen, then after
-a period of inactivity screenblank would turn the video off despite
-'xset s off'. If I didn't run screenblank, then who would take care of
-the display when X wasn't running?
-
-The hack that saved the day was to include this in .xinitrc:
-
-(
-
-while true ; do
-sleep 360
-touch /dev/console
-done
-
-) &
-killblank=$!
-
-[start up all the clients, etc, etc. Wait for the window manager
-to die, then ]
-
-kill $killblank
-
-The result is that screenblank is kept safely out of the way when X
-is running and left to do its job otherwise.
-
-Yes, I know using XDM would solve this problem.
-
-No, I'm probably not the first to think of this.
-
-You're welcome.
-
---
-Nick Sayer <mrapple@quack.kfu.com> | "Dear Sexy Nickers. I don't half fancy
-N6QQQ @ N0ARY.#NOCAL.CA.USA.NOAM | you. Meet me at the lift at 5:30 and
-+1 408 249 9630, log in as 'guest' | we'll get it together."
-PGP 2.2 public key via finger | -- Mr. Lucas
-
+++ /dev/null
-/*
- * Imakefile file for xscreensaver, Copyright (c) 1993, 1995 Jamie Zawinski.
- *
- * You should not need to edit this file; edit ../config.h instead.
- *
- */
-
-#include "../config.h"
-
-#ifdef NO_SELECT
- DEFINES = R5ISMS -DNO_SELECT
-#else
- DEFINES = R5ISMS
-#endif
- SRCS = fade.c hsv.c resources.c spline.c usleep.c xroger.c \
- grabscreen.c visual.c yarandom.c
- OBJS = fade.o hsv.o resources.o spline.o usleep.o xroger.o \
- grabscreen.o visual.o yarandom.o
- TARFILES = README Imakefile ad2c $(SRCS) spline.h yarandom.h version.h
-
-all:: $(OBJS)
-
-echo_tarfiles:
- @echo $(TARFILES)
+++ /dev/null
-
-This directory contains various utilities that are used both by the
-screensaver driver and by the demo programs; for example, a portable
-implementation of usleep(), and code for manipulating color maps.
-
-If you have compilation problems, check the parameters in ../config.h.
+++ /dev/null
-#!/bin/sh
-#
-# ad2c : Convert app-defaults file to C strings decls.
-#
-# George Ferguson, ferguson@cs.rcohester.edu, 12 Nov 1990.
-# 19 Mar 1991 : gf
-# Made it self-contained.
-# 6 Jan 1992 : mycroft@gnu.ai.mit.edu (Charles Hannum)
-# Removed use of "-n" and ":read" label since Gnu and
-# IBM sed print pattern space on "n" command. Still works
-# with Sun sed, of course.
-# 7 Jan 1992: matthew@sunpix.East.Sun.COM (Matthew Stier)
-# Escape quotes after escaping backslashes.
-#
-
-sed '
-/^!/d
-/^$/d
-s/\\/\\\\/g
-s/\\$//g
-s/"/\\"/g
-s/^/"/
-: test
-/\\$/b slash
-s/$/",/
-p
-d
-: slash
-n
-/^!/d
-/^$/d
-s/"/\\"/g
-s/\\\\/\\/g
-s/\\n/\\\\n/g
-s/\\t/\\\\t/g
-s/\\f/\\\\f/g
-s/\\b/\\\\b/g
-b test' "$@"
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992-1996 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#if __STDC__
-# include <stdlib.h>
-#endif
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xos.h>
-
-#if __STDC__
-# define P(x)x
-#else
-# define P(x)()
-#endif
-
-extern int get_visual_class P((Display *, Visual *));
-extern void screenhack_usleep P((unsigned long));
-#define usleep screenhack_usleep
-
-#define MAX_COLORS 4096
-static XColor orig_colors [MAX_COLORS];
-static XColor current_colors [MAX_COLORS];
-static int ncolors;
-
-Colormap
-copy_colormap (dpy, cmap, into_cmap)
- Display *dpy;
- Colormap cmap, into_cmap;
-{
- int i;
- Screen *screen = DefaultScreenOfDisplay (dpy);
- Visual *visual = DefaultVisualOfScreen (screen);
- Window window = RootWindowOfScreen (screen);
- int vclass = get_visual_class (dpy, visual);
-
- ncolors = CellsOfScreen (screen);
-
- /* If this is a colormap on a mono visual, or one with insanely many
- color cells, bug out. */
- if (ncolors <= 2 || ncolors > MAX_COLORS)
- return 0;
- /* If this is a non-writable visual, bug out. */
- if (vclass == StaticGray || vclass == StaticColor || vclass == TrueColor)
- return 0;
-
- if (! into_cmap)
- into_cmap = XCreateColormap (dpy, window, visual, AllocAll);
- if (! cmap)
- cmap = DefaultColormap (dpy, DefaultScreen (dpy));
- for (i = 0; i < ncolors; i++)
- orig_colors [i].pixel = i;
- XQueryColors (dpy, cmap, orig_colors, ncolors);
- XStoreColors (dpy, into_cmap, orig_colors, ncolors);
- return into_cmap;
-}
-
-void
-blacken_colormap (dpy, cmap)
- Display *dpy;
- Colormap cmap;
-{
- int i;
- for (i = 0; i < ncolors; i++)
- {
- current_colors [i].pixel = i;
- current_colors [i].red = current_colors [i].green =
- current_colors [i].blue = 0;
- }
- XStoreColors (dpy, cmap, current_colors, ncolors);
-}
-
-
-/* The business with `install_p' and `extra_cmaps' is to fake out the SGI
- 8-bit video hardware, which is capable of installing multiple (4) colormaps
- simultaniously. We have to install multiple copies of the same set of
- colors in order to fill up all the available slots in the hardware color
- lookup table.
- */
-
-void
-fade_colormap (dpy, cmap, cmap2, seconds, ticks, out_p, install_p)
- Display *dpy;
- Colormap cmap, cmap2;
- int seconds, ticks;
- Bool out_p;
- Bool install_p;
-{
- int i;
- int steps = seconds * ticks;
- XEvent dummy_event;
-
- Screen *screen = DefaultScreenOfDisplay (dpy);
- Visual *visual = DefaultVisualOfScreen (screen);
- Window window = RootWindowOfScreen (screen);
- static Colormap extra_cmaps[4] = { 0, };
- int n_extra_cmaps = sizeof(extra_cmaps)/sizeof(*extra_cmaps);
-
- if (! cmap2)
- return;
-
- for (i = 0; i < ncolors; i++)
- orig_colors [i].pixel = i;
- XQueryColors (dpy, cmap, orig_colors, ncolors);
- memcpy (current_colors, orig_colors, ncolors * sizeof (XColor));
-
- if (install_p)
- for (i=0; i < n_extra_cmaps; i++)
- if (!extra_cmaps[i])
- extra_cmaps[i] = XCreateColormap (dpy, window, visual, AllocAll);
-
- for (i = (out_p ? steps : 0);
- (out_p ? i > 0 : i < steps);
- (out_p ? i-- : i++))
- {
- int j;
- for (j = 0; j < ncolors; j++)
- {
- current_colors[j].red = orig_colors[j].red * i / steps;
- current_colors[j].green = orig_colors[j].green * i / steps;
- current_colors[j].blue = orig_colors[j].blue * i / steps;
- }
- XStoreColors (dpy, cmap2, current_colors, ncolors);
-
- if (install_p)
- {
- for (j=0; j < n_extra_cmaps; j++)
- if (extra_cmaps[j])
- XStoreColors (dpy, extra_cmaps[j], current_colors, ncolors);
-
- for (j=0; j < n_extra_cmaps; j++)
- if (extra_cmaps[j])
- XInstallColormap (dpy, extra_cmaps[j]);
- XInstallColormap (dpy, cmap2);
- }
-
- XSync (dpy, False);
-
- /* If there is user activity, bug out.
- We put the event back so that the calling code can notice it too.
- It would be better to not remove it at all, but that's harder
- because Xlib has such a non-design for this kind of crap, and
- in this application it doesn't matter if the events end up out
- of order, so in the grand unix tradition we say "fuck it" and
- do something that mostly works for the time being.
- */
- if (XCheckMaskEvent (dpy, (KeyPressMask | KeyReleaseMask |
- ButtonPressMask | ButtonReleaseMask |
- PointerMotionMask),
- &dummy_event))
- {
- XPutBackEvent (dpy, &dummy_event);
- goto DONE;
- }
-
- usleep (1000000 / (ticks * 2)); /* the 2 is a hack... */
- }
-
-DONE:
-
- if (install_p)
- {
- XInstallColormap (dpy, cmap2);
-/* for (i=0; i < n_extra_cmaps; i++)
- if (extra_cmaps[i])
- XFreeColormap (dpy, extra_cmaps[i]);
- */
- }
-}
-
-\f
-#if 0
-#include "../hacks/screenhack.h"
-char *progclass = "foo";
-char *defaults [] = {
- 0
-};
-
-XrmOptionDescRec options [] = {0};
-int options_size = 0;
-
-void
-screenhack (dpy, w)
- Display *dpy;
- Window w;
-{
- Colormap cmap = DefaultColormap (dpy, DefaultScreen (dpy));
- Colormap cmap2 = copy_colormap (dpy, cmap, 0);
-
- int seconds = 1;
- int ticks = 30 * seconds;
- int delay = 1;
-
- XSynchronize (dpy, True);
-
- while (1)
- {
- XSync (dpy, False);
-/* XGrabServer (dpy); */
- fprintf(stderr,"out..."); fflush(stderr);
- XInstallColormap (dpy, cmap2);
- fade_colormap (dpy, cmap, cmap2, seconds, ticks, True, True);
- fprintf(stderr, "done.\n"); fflush(stderr);
- if (delay) sleep (delay);
- fprintf(stderr,"in..."); fflush(stderr);
- fade_colormap (dpy, cmap, cmap2, seconds, ticks, False, True);
- XInstallColormap (dpy, cmap);
- fprintf(stderr, "done.\n"); fflush(stderr);
- XUngrabServer (dpy);
- XSync (dpy, False);
- if (delay) sleep (delay);
- }
-}
-
-#endif
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992, 1993, 1994 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* This file contains code for grabbing an image of the screen to hack its
- bits. This is a little tricky, since doing this involves the need to tell
- the difference between drawing on the actual root window, and on the fake
- root window used by the screensaver, since at this level the illusion
- breaks down...
- */
-
-#if __STDC__
-#include <stdlib.h>
-#include <unistd.h>
-#endif
-
-#include <X11/Xlib.h>
-#include <X11/Xatom.h>
-#include <X11/Xutil.h>
-
-static Bool
-MapNotify_event_p (dpy, event, window)
- Display *dpy;
- XEvent *event;
- XPointer window;
-{
- return (event->xany.type == MapNotify &&
- event->xvisibility.window == (Window) window);
-}
-
-
-#if __STDC__
-static Bool screensaver_window_p (Display *, Window);
-#endif
-
-static Bool
-screensaver_window_p (dpy, window)
- Display *dpy;
- Window window;
-{
- Atom type;
- int format;
- unsigned long nitems, bytesafter;
- char *version;
- if (XGetWindowProperty (dpy, window,
- XInternAtom (dpy, "_SCREENSAVER_VERSION", False),
- 0, 1, False, XA_STRING,
- &type, &format, &nitems, &bytesafter,
- (unsigned char **) &version)
- == Success
- && type != None)
- return True;
- return False;
-}
-
-Pixmap
-grab_screen_image (dpy, window, root_p)
- Display *dpy;
- Window window;
- int root_p;
-{
- Pixmap pixmap = 0;
- XWindowAttributes xgwa;
-
- XGetWindowAttributes (dpy, window, &xgwa);
-
- if (screensaver_window_p (dpy, window))
- {
- /* note: this assumes vroot.h didn't encapsulate the XRootWindowOfScreen
- function, only the RootWindowOfScreen macro... */
- Window real_root = XRootWindowOfScreen (DefaultScreenOfDisplay (dpy));
-
- XSetWindowBackgroundPixmap (dpy, window, None);
-
- /* prevent random viewer of the screen saver (locker) from messing
- with windows. We don't check whether it succeeded, because what
- are our options, really... */
- XGrabPointer (dpy, real_root, True, ButtonPressMask|ButtonReleaseMask,
- GrabModeAsync, GrabModeAsync, None, None, CurrentTime);
- XGrabKeyboard (dpy, real_root, True, GrabModeSync, GrabModeAsync,
- CurrentTime);
-
- XUnmapWindow (dpy, window);
- XSync (dpy, True);
- sleep (5); /* wait for everyone to swap in and handle exposes... */
- XMapRaised (dpy, window);
-
- XUngrabPointer (dpy, CurrentTime);
- XUngrabKeyboard (dpy, CurrentTime);
-
- XSync (dpy, True);
- }
- else if (root_p)
- {
- XGCValues gcv;
- GC gc;
- gcv.function = GXcopy;
- gcv.subwindow_mode = IncludeInferiors;
- gc = XCreateGC (dpy, window, GCFunction | GCSubwindowMode, &gcv);
- pixmap = XCreatePixmap(dpy, window, xgwa.width, xgwa.height, xgwa.depth);
- XCopyArea (dpy, RootWindowOfScreen (xgwa.screen), pixmap, gc,
- xgwa.x, xgwa.y, xgwa.width, xgwa.height, 0, 0);
- XFreeGC (dpy, gc);
- XSetWindowBackgroundPixmap (dpy, window, pixmap);
- }
- else
- {
- XEvent event;
- XSetWindowBackgroundPixmap (dpy, window, None);
- XMapWindow (dpy, window);
- XFlush (dpy);
- XIfEvent (dpy, &event, MapNotify_event_p, (XPointer) window);
- XSync (dpy, True);
- }
- return pixmap;
-}
-
-
-/* When we are grabbing and manipulating a screen image, it's important that
- we use the same colormap it originally had. So, if the screensaver was
- started with -install, we need to copy the contents of the default colormap
- into the screensaver's colormap.
- */
-void
-copy_default_colormap_contents (dpy, to_cmap, to_visual)
- Display *dpy;
- Colormap to_cmap;
- Visual *to_visual;
-{
- Screen *screen = DefaultScreenOfDisplay (dpy);
- Visual *from_visual = DefaultVisualOfScreen (screen);
- Colormap from_cmap = XDefaultColormapOfScreen (screen);
-
- XColor *old_colors, *new_colors;
- unsigned long *pixels;
- XVisualInfo vi_in, *vi_out;
- int out_count;
- int from_cells, to_cells, max_cells;
- int requested;
- int i;
-
- if (from_cmap == to_cmap)
- return;
-
- vi_in.screen = XScreenNumberOfScreen (screen);
- vi_in.visualid = XVisualIDFromVisual (from_visual);
- vi_out = XGetVisualInfo (dpy, VisualScreenMask|VisualIDMask,
- &vi_in, &out_count);
- if (! vi_out) abort ();
- from_cells = vi_out [0].colormap_size;
- XFree ((char *) vi_out);
-
- vi_in.screen = XScreenNumberOfScreen (screen);
- vi_in.visualid = XVisualIDFromVisual (to_visual);
- vi_out = XGetVisualInfo (dpy, VisualScreenMask|VisualIDMask,
- &vi_in, &out_count);
- if (! vi_out) abort ();
- to_cells = vi_out [0].colormap_size;
- XFree ((char *) vi_out);
-
- max_cells = (from_cells > to_cells ? to_cells : from_cells);
-
- old_colors = (XColor *) calloc (sizeof (XColor), max_cells);
- new_colors = (XColor *) calloc (sizeof (XColor), max_cells);
- pixels = (unsigned long *) calloc (sizeof (unsigned long), max_cells);
- for (i = 0; i < max_cells; i++)
- old_colors[i].pixel = i;
- XQueryColors (dpy, from_cmap, old_colors, max_cells);
-
- requested = max_cells;
- while (requested > 0)
- {
- if (XAllocColorCells (dpy, to_cmap, False, 0, 0, pixels, requested))
- {
- /* Got all the pixels we asked for. */
- for (i = 0; i < requested; i++)
- new_colors[i] = old_colors [pixels[i]];
- XStoreColors (dpy, to_cmap, new_colors, requested);
- }
- else
- {
- /* We didn't get all/any of the pixels we asked for. This time, ask
- for half as many. (If we do get all that we ask for, we ask for
- the same number again next time, so we only do O(log(n)) server
- roundtrips.) */
- requested = requested / 2;
- }
- }
-
- free (old_colors);
- free (new_colors);
- free (pixels);
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* This file contains some utility routines for randomly picking the colors
- to hack the screen with.
- */
-
-#include <X11/Xlib.h>
-
-void
-#if __STDC__
-hsv_to_rgb (int h, double s, double v,
- unsigned short *r, unsigned short *g, unsigned short *b)
-#else
-hsv_to_rgb (h,s,v, r,g,b)
- int h; /* 0 - 360 */
- double s, v; /* 0.0 - 1.0 */
- unsigned short *r, *g, *b; /* 0 - 65535 */
-#endif
-{
- double H, S, V, R, G, B;
- double p1, p2, p3;
- double f;
- int i;
- S = s; V = v;
- H = (h % 360) / 60.0;
- i = H;
- f = H - i;
- p1 = V * (1 - S);
- p2 = V * (1 - (S * f));
- p3 = V * (1 - (S * (1 - f)));
- if (i == 0) { R = V; G = p3; B = p1; }
- else if (i == 1) { R = p2; G = V; B = p1; }
- else if (i == 2) { R = p1; G = V; B = p3; }
- else if (i == 3) { R = p1; G = p2; B = V; }
- else if (i == 4) { R = p3; G = p1; B = V; }
- else { R = V; G = p1; B = p2; }
- *r = R * 65535;
- *g = G * 65535;
- *b = B * 65535;
-}
-
-void
-#if __STDC__
-rgb_to_hsv (unsigned short r, unsigned short g, unsigned short b,
- int *h, double *s, double *v)
-#else
-rgb_to_hsv (r,g,b, h,s,v)
- unsigned short r, g, b; /* 0 - 65535 */
- int *h; /* 0 - 360 */
- double *s, *v; /* 0.0 - 1.0 */
-#endif
-{
- double R, G, B, H, S, V;
- double cmax, cmin;
- double cmm;
- int imax;
- R = ((double) r) / 65535.0;
- G = ((double) g) / 65535.0;
- B = ((double) b) / 65535.0;
- cmax = R; cmin = G; imax = 1;
- if ( cmax < G ) { cmax = G; cmin = R; imax = 2; }
- if ( cmax < B ) { cmax = B; imax = 3; }
- if ( cmin > B ) { cmin = B; }
- cmm = cmax - cmin;
- V = cmax;
- if (cmm == 0)
- S = H = 0;
- else
- {
- S = cmm / cmax;
- if (imax == 1) H = (G - B) / cmm;
- else if (imax == 2) H = 2.0 + (B - R) / cmm;
- else if (imax == 3) H = 4.0 + (R - G) / cmm;
- if (H < 0) H += 6.0;
- }
- *h = (H * 60.0);
- *s = S;
- *v = V;
-}
-
-
-void
-make_color_ramp (h1, s1, v1, h2, s2, v2,
- pixels, npixels)
- int h1, h2; /* 0 - 360 */
- double s1, s2, v1, v2; /* 0.0 - 1.0 */
- XColor *pixels;
- int npixels;
-{
- int dh = (h2 - h1) / npixels;
- double ds = (s2 - s1) / npixels;
- double dv = (v2 - v1) / npixels;
- int i;
- for (i = 0; i < npixels; i++)
- hsv_to_rgb ((h1 += dh), (s1 += ds), (v1 += dv),
- &pixels [i].red, &pixels [i].green, &pixels [i].blue);
-}
-
-
-void
-cycle_hue (color, degrees)
- XColor *color;
- int degrees;
-{
- int h;
- double s, v;
- rgb_to_hsv (color->red, color->green, color->blue,
- &h, &s, &v);
- h = (h + degrees) % 360;
- hsv_to_rgb (h, s, v, &color->red, &color->green, &color->blue);
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#if __STDC__
-#include <stdlib.h>
-#include <string.h>
-#endif
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xresource.h>
-
-/* Resource functions. Assumes: */
-
-extern char *progname;
-extern char *progclass;
-extern XrmDatabase db;
-
-#if __STDC__
-char *get_string_resource (char *res_name, char *res_class);
-int parse_time (char *string, Bool seconds_default_p, Bool silent_p);
-static unsigned int get_time_resource (char *res_name, char *res_class,
- Bool sec_p);
-#endif
-
-#ifndef isupper
-# define isupper(c) ((c) >= 'A' && (c) <= 'Z')
-#endif
-#ifndef _tolower
-# define _tolower(c) ((c) - 'A' + 'a')
-#endif
-
-char *
-get_string_resource (res_name, res_class)
- char *res_name, *res_class;
-{
- XrmValue value;
- char *type;
- char full_name [1024], full_class [1024];
- strcpy (full_name, progname);
- strcat (full_name, ".");
- strcat (full_name, res_name);
- strcpy (full_class, progclass);
- strcat (full_class, ".");
- strcat (full_class, res_class);
- if (XrmGetResource (db, full_name, full_class, &type, &value))
- {
- char *str = (char *) malloc (value.size + 1);
- strncpy (str, (char *) value.addr, value.size);
- str [value.size] = 0;
- return str;
- }
- return 0;
-}
-
-Bool
-get_boolean_resource (res_name, res_class)
- char *res_name, *res_class;
-{
- char *tmp, buf [100];
- char *s = get_string_resource (res_name, res_class);
- char *os = s;
- if (! s) return 0;
- for (tmp = buf; *s; s++)
- *tmp++ = isupper (*s) ? _tolower (*s) : *s;
- *tmp = 0;
- free (os);
-
- if (!strcmp (buf, "on") || !strcmp (buf, "true") || !strcmp (buf, "yes"))
- return 1;
- if (!strcmp (buf,"off") || !strcmp (buf, "false") || !strcmp (buf,"no"))
- return 0;
- fprintf (stderr, "%s: %s must be boolean, not %s.\n",
- progname, res_class, buf);
- return 0;
-}
-
-int
-get_integer_resource (res_name, res_class)
- char *res_name, *res_class;
-{
- int val;
- char c, *s = get_string_resource (res_name, res_class);
- if (!s) return 0;
- if (1 == sscanf (s, " %d %c", &val, &c))
- {
- free (s);
- return val;
- }
- fprintf (stderr, "%s: %s must be an integer, not %s.\n",
- progname, res_name, s);
- free (s);
- return 0;
-}
-
-double
-get_float_resource (res_name, res_class)
- char *res_name, *res_class;
-{
- double val;
- char c, *s = get_string_resource (res_name, res_class);
- if (! s) return 0.0;
- if (1 == sscanf (s, " %lf %c", &val, &c))
- {
- free (s);
- return val;
- }
- fprintf (stderr, "%s: %s must be a float, not %s.\n",
- progname, res_name, s);
- free (s);
- return 0.0;
-}
-
-
-unsigned int
-get_pixel_resource (res_name, res_class, dpy, cmap)
- char *res_name, *res_class;
- Display *dpy;
- Colormap cmap;
-{
- XColor color;
- char *s = get_string_resource (res_name, res_class);
- if (!s) goto DEFAULT;
-
- if (! XParseColor (dpy, cmap, s, &color))
- {
- fprintf (stderr, "%s: can't parse color %s\n", progname, s);
- goto DEFAULT;
- }
- if (! XAllocColor (dpy, cmap, &color))
- {
- fprintf (stderr, "%s: couldn't allocate color %s\n", progname, s);
- goto DEFAULT;
- }
- free (s);
- return color.pixel;
- DEFAULT:
- if (s) free (s);
- return (strcmp (res_class, "Background")
- ? WhitePixel (dpy, DefaultScreen (dpy))
- : BlackPixel (dpy, DefaultScreen (dpy)));
-}
-
-
-int
-parse_time (string, seconds_default_p, silent_p)
- char *string;
- Bool seconds_default_p, silent_p;
-{
- unsigned int h, m, s;
- char c;
- if (3 == sscanf (string, " %u : %2u : %2u %c", &h, &m, &s, &c))
- ;
- else if (2 == sscanf (string, " : %2u : %2u %c", &m, &s, &c) ||
- 2 == sscanf (string, " %u : %2u %c", &m, &s, &c))
- h = 0;
- else if (1 == sscanf (string, " : %2u %c", &s, &c))
- h = m = 0;
- else if (1 == sscanf (string, " %u %c",
- (seconds_default_p ? &s : &m), &c))
- {
- h = 0;
- if (seconds_default_p) m = 0;
- else s = 0;
- }
- else
- {
- if (! silent_p)
- fprintf (stderr, "%s: invalid time interval specification \"%s\".\n",
- progname, string);
- return -1;
- }
- if (s >= 60 && (h != 0 || m != 0))
- {
- if (! silent_p)
- fprintf (stderr, "%s: seconds > 59 in \"%s\".\n", progname, string);
- return -1;
- }
- if (m >= 60 && h > 0)
- {
- if (! silent_p)
- fprintf (stderr, "%s: minutes > 59 in \"%s\".\n", progname, string);
- return -1;
- }
- return ((h * 60 * 60) + (m * 60) + s);
-}
-
-static unsigned int
-get_time_resource (res_name, res_class, sec_p)
- char *res_name, *res_class;
- Bool sec_p;
-{
- int val;
- char *s = get_string_resource (res_name, res_class);
- if (!s) return 0;
- val = parse_time (s, sec_p, False);
- free (s);
- return (val < 0 ? 0 : val);
-}
-
-unsigned int
-get_seconds_resource (res_name, res_class)
- char *res_name, *res_class;
-{
- return get_time_resource (res_name, res_class, True);
-}
-
-unsigned int
-get_minutes_resource (res_name, res_class)
- char *res_name, *res_class;
-{
- return get_time_resource (res_name, res_class, False);
-}
+++ /dev/null
-/*
- * Copyright (c) 1987, 1988, 1989 Stanford University
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided
- * that the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation, and that the name of Stanford not be used in advertising or
- * publicity pertaining to distribution of the software without specific,
- * written prior permission. Stanford makes no representations about
- * the suitability of this software for any purpose. It is provided "as is"
- * without express or implied warranty.
- *
- * STANFORD DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE,
- * INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS.
- * IN NO EVENT SHALL STANFORD BE LIABLE FOR ANY SPECIAL, INDIRECT OR
- * CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE,
- * DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR
- * OTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION
- * WITH THE USE OR PERFORMANCE OF THIS SOFTWARE.
- */
-
-/* This code came with the InterViews distribution, and was translated
- from C++ to C by Matthieu Devin <devin@lucid.com> some time in 1992.
- */
-
-#include <stdio.h>
-#include "spline.h"
-#if __STDC__
-#include <stdlib.h>
-#endif
-#include <math.h>
-
-/* Lifted from InterViews */
-#define SMOOTHNESS 1.0
-
-#if __STDC__
-static void no_more_memory (void);
-static void grow_spline_points (spline* s);
-static void mid_point (double x0, double y0, double x1, double y1,
- double *mx, double *my);
-static int can_approx_with_line (double x0, double y0, double x2,
- double y2, double x3, double y3);
-static void add_line (spline* s, double x0, double y0, double x1, double y1);
-static void add_bezier_arc (spline* s,
- double x0, double y0, double x1, double y1,
- double x2, double y2, double x3, double y3);
-static void third_point (double x0, double y0, double x1, double y1,
- double *tx, double *ty);
-static void calc_section (spline* s, double cminus1x, double cminus1y,
- double cx, double cy, double cplus1x, double cplus1y,
- double cplus2x, double cplus2y);
-
-#endif
-
-static void
-no_more_memory ()
-{
- fprintf (stderr, "No more memory\n");
- exit (1);
-}
-
-spline*
-make_spline (size)
- u_int size;
-{
- spline* s = (spline*)calloc (1, sizeof (spline));
- if (!s)
- no_more_memory ();
- s->n_controls = size;
- s->control_x = (double*)calloc (s->n_controls, sizeof (double));
- s->control_y = (double*)calloc (s->n_controls, sizeof (double));
-
- s->n_points = 0;
- s->allocated_points = s->n_controls;
- s->points = (XPoint*)calloc (s->allocated_points, sizeof (XPoint));
-
- if (!s->control_x || !s->control_y || !s->points)
- no_more_memory ();
-
- return s;
-}
-
-static void
-grow_spline_points (s)
- spline* s;
-{
- s->allocated_points *= 2;
- s->points =
- (XPoint*)realloc (s->points, s->allocated_points * sizeof (XPoint));
-
- if (!s->points)
- no_more_memory ();
-}
-
-static void
-mid_point (x0, y0, x1, y1, mx, my)
- double x0, y0, x1, y1, *mx, *my;
-{
- *mx = (x0 + x1) / 2.0;
- *my = (y0 + y1) / 2.0;
-}
-
-static void
-third_point (x0, y0, x1, y1, tx, ty)
- double x0, y0, x1, y1, *tx, *ty;
-{
- *tx = (2 * x0 + x1) / 3.0;
- *ty = (2 * y0 + y1) / 3.0;
-}
-
-static int
-can_approx_with_line (x0, y0, x2, y2, x3, y3)
- double x0, y0, x2, y2, x3, y3;
-{
- double triangle_area, side_squared, dx, dy;
-
- triangle_area = x0 * y2 - x2 * y0 + x2 * y3 - x3 * y2 + x3 * y0 - x0 * y3;
- /* actually 4 times the area. */
- triangle_area *= triangle_area;
- dx = x3 - x0;
- dy = y3 - y0;
- side_squared = dx * dx + dy * dy;
- return triangle_area <= SMOOTHNESS * side_squared;
-}
-
-static void
-add_line (s, x0, y0, x1, y1)
- spline* s;
- double x0, y0, x1, y1;
-{
- if (s->n_points >= s->allocated_points)
- grow_spline_points (s);
-
- if (s->n_points == 0)
- {
- s->points [s->n_points].x = x0;
- s->points [s->n_points].y = y0;
- s->n_points += 1;
- }
- s->points [s->n_points].x = x1;
- s->points [s->n_points].y = y1;
- s->n_points += 1;
-}
-
-static void
-add_bezier_arc (s, x0, y0, x1, y1, x2, y2, x3, y3)
- spline* s;
- double x0, y0, x1, y1, x2, y2, x3, y3;
-{
- double midx01, midx12, midx23, midlsegx, midrsegx, cx,
- midy01, midy12, midy23, midlsegy, midrsegy, cy;
-
- mid_point (x0, y0, x1, y1, &midx01, &midy01);
- mid_point (x1, y1, x2, y2, &midx12, &midy12);
- mid_point (x2, y2, x3, y3, &midx23, &midy23);
- mid_point (midx01, midy01, midx12, midy12, &midlsegx, &midlsegy);
- mid_point (midx12, midy12, midx23, midy23, &midrsegx, &midrsegy);
- mid_point (midlsegx, midlsegy, midrsegx, midrsegy, &cx, &cy);
-
- if (can_approx_with_line (x0, y0, midlsegx, midlsegy, cx, cy))
- add_line (s, x0, y0, cx, cy);
- else if ((midx01 != x1) || (midy01 != y1) || (midlsegx != x2)
- || (midlsegy != y2) || (cx != x3) || (cy != y3))
- add_bezier_arc (s, x0, y0, midx01, midy01, midlsegx, midlsegy, cx, cy);
-
- if (can_approx_with_line (cx, cy, midx23, midy23, x3, y3))
- add_line (s, cx, cy, x3, y3);
- else if ((cx != x0) || (cy != y0) || (midrsegx != x1) || (midrsegy != y1)
- || (midx23 != x2) || (midy23 != y2))
- add_bezier_arc (s, cx, cy, midrsegx, midrsegy, midx23, midy23, x3, y3);
-}
-
-static void
-calc_section (s, cminus1x, cminus1y, cx, cy, cplus1x, cplus1y,
- cplus2x, cplus2y)
- spline* s;
- double cminus1x, cminus1y, cx, cy, cplus1x, cplus1y, cplus2x, cplus2y;
-{
- double p0x, p1x, p2x, p3x, tempx,
- p0y, p1y, p2y, p3y, tempy;
-
- third_point (cx, cy, cplus1x, cplus1y, &p1x, &p1y);
- third_point (cplus1x, cplus1y, cx, cy, &p2x, &p2y);
- third_point (cx, cy, cminus1x, cminus1y, &tempx, &tempy);
- mid_point (tempx, tempy, p1x, p1y, &p0x, &p0y);
- third_point (cplus1x, cplus1y, cplus2x, cplus2y, &tempx, &tempy);
- mid_point (tempx, tempy, p2x, p2y, &p3x, &p3y);
- add_bezier_arc (s, p0x, p0y, p1x, p1y, p2x, p2y, p3x, p3y);
-}
-
-void
-compute_spline (s)
- spline* s;
-{
- int i;
- s->n_points = 0;
-
- if (s->n_controls < 3)
- return;
-
- calc_section (s, s->control_x [0], s->control_y [0], s->control_x [0],
- s->control_y [0], s->control_x [0], s->control_y [0],
- s->control_x [1], s->control_y [1]);
- calc_section (s, s->control_x [0], s->control_y [0], s->control_x [0],
- s->control_y [0], s->control_x [1], s->control_y [1],
- s->control_x [2], s->control_y [2]);
-
- for (i = 1; i < s->n_controls - 2; i++)
- calc_section (s, s->control_x [i - 1], s->control_y [i - 1],
- s->control_x [i], s->control_y [i],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [i + 2], s->control_y [i + 2]);
-
- calc_section (s, s->control_x [i - 1], s->control_y [i - 1],
- s->control_x [i], s->control_y [i],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [i + 1], s->control_y [i + 1]);
- calc_section (s, s->control_x [i], s->control_y [i],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [i + 1], s->control_y [i + 1]);
-}
-
-void
-compute_closed_spline (s)
- spline *s;
-{
- int i;
- s->n_points = 0;
-
- if (s->n_controls < 3)
- return;
-
- calc_section (s,
- s->control_x [s->n_controls - 1],
- s->control_y [s->n_controls - 1],
- s->control_x [0], s->control_y [0],
- s->control_x [1], s->control_y [1],
- s->control_x [2], s->control_y [2]);
-
- for (i = 1; i < s->n_controls - 2; i++)
- calc_section (s, s->control_x [i - 1], s->control_y [i - 1],
- s->control_x [i], s->control_y [i],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [i + 2], s->control_y [i + 2]);
-
- calc_section (s, s->control_x [i - 1], s->control_y [i - 1],
- s->control_x [i], s->control_y [i],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [0], s->control_y [0]);
- calc_section (s, s->control_x [i], s->control_y [i],
- s->control_x [i + 1], s->control_y [i + 1],
- s->control_x [0], s->control_y [0],
- s->control_x [1], s->control_y [1]);
-}
-
-void
-just_fill_spline (s)
- spline *s;
-{
- int i;
-
- while (s->allocated_points < s->n_controls + 1)
- grow_spline_points (s);
-
- for (i = 0; i < s->n_controls; i++)
- {
- s->points [i].x = s->control_x [i];
- s->points [i].y = s->control_y [i];
- }
- s->points [s->n_controls].x = s->control_x [0];
- s->points [s->n_controls].y = s->control_y [0];
- s->n_points = s->n_controls + 1;
-}
-
-void
-append_spline_points (s1, s2)
- spline *s1, *s2;
-{
- int i;
- while (s1->allocated_points < s1->n_points + s2->n_points)
- grow_spline_points (s1);
- for (i = s1->n_points; i < s1->n_points + s2->n_points; i++)
- {
- s1->points [i].x = s2->points [i - s1->n_points].x;
- s1->points [i].y = s2->points [i - s1->n_points].y;
- }
- s1->n_points = s1->n_points + s2->n_points;
-}
-
-void
-spline_bounding_box (s, rectangle_out)
- spline* s;
- XRectangle* rectangle_out;
-{
- int min_x;
- int max_x;
- int min_y;
- int max_y;
- int i;
-
- if (s->n_points == 0)
- {
- rectangle_out->x = 0;
- rectangle_out->y = 0;
- rectangle_out->width = 0;
- rectangle_out->height = 0;
- }
-
- min_x = s->points [0].x;
- max_x = min_x;
- min_y = s->points [0].y;
- max_y = min_y;
-
- for (i = 1; i < s->n_points; i++)
- {
- if (s->points [i].x < min_x)
- min_x = s->points [i].x;
- if (s->points [i].x > max_x)
- max_x = s->points [i].x;
- if (s->points [i].y < min_y)
- min_y = s->points [i].y;
- if (s->points [i].y > max_y)
- max_y = s->points [i].y;
- }
- rectangle_out->x = min_x;
- rectangle_out->y = min_y;
- rectangle_out->width = max_x - min_x;
- rectangle_out->height = max_y - min_y;
-}
+++ /dev/null
-/*
- * Copyright (c) 1987, 1988, 1989 Stanford University
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided
- * that the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation, and that the name of Stanford not be used in advertising or
- * publicity pertaining to distribution of the software without specific,
- * written prior permission. Stanford makes no representations about
- * the suitability of this software for any purpose. It is provided "as is"
- * without express or implied warranty.
- *
- * STANFORD DISCLAIMS ALL WARRANTIES WITH REGARD TO THIS SOFTWARE,
- * INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS.
- * IN NO EVENT SHALL STANFORD BE LIABLE FOR ANY SPECIAL, INDIRECT OR
- * CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE,
- * DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR
- * OTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION
- * WITH THE USE OR PERFORMANCE OF THIS SOFTWARE.
- */
-
-/* This code came with the InterViews distribution, and was translated
- from C++ to C by Matthieu Devin <devin@lucid.com> some time in 1992.
- */
-
-#ifndef _SPLINE_H_
-#define _SPLINE_H_
-
-#include <X11/Xlib.h>
-
-#if __STDC__
-# define P(x)x
-#else
-# define P(x)()
-#endif
-
-typedef struct _spline
-{
- /* input */
- u_int n_controls;
- double* control_x;
- double* control_y;
-
- /* output */
- u_int n_points;
- XPoint* points;
- u_int allocated_points;
-} spline;
-
-spline* make_spline P((u_int size));
-void compute_spline P((spline* s));
-void compute_closed_spline P((spline* s));
-void just_fill_spline P((spline* s));
-void append_spline_points P((spline* s1, spline* s2));
-void spline_bounding_box P((spline* s, XRectangle* rectangle_out));
-
-#undef P
-#endif /* _SPLINE_H_ */
+++ /dev/null
-/* xscreensaver, Copyright (c) 1992 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#if __STDC__
-#include <stdlib.h>
-#endif
-
-#include <X11/Xlib.h>
-#include <X11/Xos.h> /* lazy way out */
-
-/* usleep() doesn't exist everywhere, and select() is faster anyway.
- */
-
-#ifndef VMS
-
-#ifdef NO_SELECT
- /* If you don't have select() or usleep(), I guess you lose...
- Maybe you have napms() instead? Let me know.
- */
-void
-screenhack_usleep (usecs)
- unsigned long usecs;
-{
- usleep (usecs);
-}
-
-#else /* ! NO_SELECT */
-
-void
-screenhack_usleep (usecs)
- unsigned long usecs;
-{
- struct timeval tv;
- tv.tv_sec = usecs / 1000000L;
- tv.tv_usec = usecs % 1000000L;
- (void) select (0, 0, 0, 0, &tv);
-}
-
-#endif /* ! NO_SELECT */
-
-#else /* VMS */
-
-#define SEC_DELTA "0000 00:00:01.00"
-#define TICK_DELTA "0000 00:00:00.08"
-static int bin_sec_delta[2], bin_tick_delta[2], deltas_set = 0;
-
-static void
-set_deltas ()
-{
- int status;
- extern int SYS$BINTIM ();
- $DESCRIPTOR (str_sec_delta, SEC_DELTA);
- $DESCRIPTOR (str_tick_delta, TICK_DELTA);
- if (!deltas_set)
- {
- status = SYS$BINTIM (&str_sec_delta, &bin_sec_delta);
- if (!(status & 1))
- {
- fprintf (stderr, "%s: cannot convert delta time ", progname);
- fprintf (stderr, SEC_DELTA);
- fprintf (stderr, "; status code = %d\n", status);
- exit (status);
- }
- status = SYS$BINTIM (&str_tick_delta, &bin_tick_delta);
- if (!(status & 1))
- {
- fprintf (stderr, "%s: cannot convert delta time ", progname);
- fprintf (stderr, TICK_DELTA);
- fprintf (stderr, "; status code = %d\n", status);
- exit (status);
- }
- deltas_set = 1;
- }
-}
-
-void
-screenhack_usleep (usecs)
- unsigned long usecs;
-{
- int status, *bin_delta;
- extern int SYS$SCHWDK (), SYS$HIBER ();
-
- if (!deltas_set) set_deltas ();
- bin_delta = (usecs == TICK_INTERVAL) ? &bin_tick_delta : &bin_sec_delta;
- status = SYS$SCHDWK (0, 0, bin_delta, 0);
- if ((status & 1)) (void) SYS$HIBER ();
-}
-
-#endif /*VMS */
+++ /dev/null
-static char *screensaver_id =
- "@(#)xscreensaver 1.27, by Jamie Zawinski (jwz@netscape.com)";
+++ /dev/null
-/* xscreensaver, Copyright (c) 1993, 1994, 1995
- * Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-/* This file contains some code for intelligently picking the best visual
- (where "best" is biased in the direction of high color counts...)
- */
-
-#if __STDC__
-#include <stdlib.h>
-#include <unistd.h>
-#include <string.h>
-#endif
-
-#include <stdio.h>
-#include <X11/Xlib.h>
-#include <X11/Xutil.h>
-
-#if __STDC__
-# define P(x)x
-#else
-#define P(x)()
-#endif
-
-#ifndef isupper
-# define isupper(c) ((c) >= 'A' && (c) <= 'Z')
-#endif
-#ifndef _tolower
-# define _tolower(c) ((c) - 'A' + 'a')
-#endif
-
-extern char *progname;
-extern char *get_string_resource P((char *, char *));
-
-static Visual *pick_best_visual P ((Screen *));
-static Visual *pick_best_visual_of_class P((Screen *, int));
-static Visual *id_to_visual P((Screen *, int));
-static int screen_number P((Screen *));
-static Visual *id_to_visual P((Screen *screen, int id));
-int get_visual_depth P((Display *dpy, Visual *visual));
-
-
-#define DEFAULT_VISUAL -1
-#define BEST_VISUAL -2
-#define SPECIFIC_VISUAL -3
-
-Visual *
-get_visual_resource (dpy, name, class)
- Display *dpy;
- char *name, *class;
-{
- Screen *screen = DefaultScreenOfDisplay (dpy);
- char c, *v = get_string_resource (name, class);
- char *tmp;
- int vclass;
- unsigned long id;
-
- if (v)
- for (tmp = v; *tmp; tmp++)
- if (isupper (*tmp)) *tmp = _tolower (*tmp);
-
- if (!v) vclass = BEST_VISUAL;
- else if (!strcmp (v, "default")) vclass = DEFAULT_VISUAL;
- else if (!strcmp (v, "best")) vclass = BEST_VISUAL;
- else if (!strcmp (v, "staticgray")) vclass = StaticGray;
- else if (!strcmp (v, "staticcolor")) vclass = StaticColor;
- else if (!strcmp (v, "truecolor")) vclass = TrueColor;
- else if (!strcmp (v, "grayscale")) vclass = GrayScale;
- else if (!strcmp (v, "pseudocolor")) vclass = PseudoColor;
- else if (!strcmp (v, "directcolor")) vclass = DirectColor;
- else if (1 == sscanf (v, " %ld %c", &id, &c)) vclass = SPECIFIC_VISUAL;
- else if (1 == sscanf (v, " 0x%lx %c", &id, &c)) vclass = SPECIFIC_VISUAL;
- else
- {
- fprintf (stderr, "%s: unrecognized visual \"%s\".\n", progname, v);
- vclass = DEFAULT_VISUAL;
- }
- if (v) free (v);
-
- if (vclass == DEFAULT_VISUAL)
- return DefaultVisualOfScreen (screen);
- else if (vclass == BEST_VISUAL)
- return pick_best_visual (screen);
- else if (vclass == SPECIFIC_VISUAL)
- {
- Visual *visual = id_to_visual (screen, id);
- if (visual) return visual;
- fprintf (stderr, "%s: no visual with id 0x%x.\n", progname,
- (unsigned int) id);
- return DefaultVisualOfScreen (screen);
- }
- else
- {
- Visual *visual = pick_best_visual_of_class (screen, vclass);
- if (visual) return visual;
- fprintf (stderr, "%s: no visual of class %s.\n", progname, v);
- return DefaultVisualOfScreen (screen);
- }
-}
-
-static Visual *
-pick_best_visual (screen)
- Screen *screen;
-{
- /* The "best" visual is the one on which we can allocate the largest
- range and number of colors.
-
- Therefore, a TrueColor visual which is at least 16 bits deep is best.
- (The assumption here being that a TrueColor of less than 16 bits is
- really just a PseudoColor visual with a pre-allocated color cube.)
-
- The next best thing is a PseudoColor visual of any type. After that
- come the non-colormappable visuals, and non-color visuals.
- */
- Display *dpy = DisplayOfScreen (screen);
- Visual *visual;
- if ((visual = pick_best_visual_of_class (screen, TrueColor)) &&
- get_visual_depth (dpy, visual) >= 16)
- return visual;
- if ((visual = pick_best_visual_of_class (screen, PseudoColor)))
- return visual;
- if ((visual = pick_best_visual_of_class (screen, TrueColor)))
- return visual;
- if ((visual = pick_best_visual_of_class (screen, DirectColor)))
- return visual;
- if ((visual = pick_best_visual_of_class (screen, GrayScale)))
- return visual;
- if ((visual = pick_best_visual_of_class (screen, StaticGray)))
- return visual;
- return DefaultVisualOfScreen (screen);
-}
-
-static Visual *
-pick_best_visual_of_class (screen, visual_class)
- Screen *screen;
- int visual_class;
-{
- /* The best visual of a class is the one which on which we can allocate
- the largest range and number of colors, which means the one with the
- greatest depth and number of cells.
- */
- Display *dpy = DisplayOfScreen (screen);
- XVisualInfo vi_in, *vi_out;
- int out_count;
-
- vi_in.class = visual_class;
- vi_in.screen = screen_number (screen);
- vi_out = XGetVisualInfo (dpy, (VisualClassMask | VisualScreenMask),
- &vi_in, &out_count);
- if (vi_out)
- {
- /* choose the 'best' one, if multiple */
- int i, best;
- Visual *visual;
- for (i = 0, best = 0; i < out_count; i++)
- /* It's better if it's deeper, or if it's the same depth with
- more cells (does that ever happen? Well, it could...) */
- if ((vi_out [i].depth > vi_out [best].depth) ||
- ((vi_out [i].depth == vi_out [best].depth) &&
- (vi_out [i].colormap_size > vi_out [best].colormap_size)))
- best = i;
- visual = vi_out [best].visual;
- XFree ((char *) vi_out);
- return visual;
- }
- else
- return 0;
-}
-
-static Visual *
-id_to_visual (screen, id)
- Screen *screen;
- int id;
-{
- Display *dpy = DisplayOfScreen (screen);
- XVisualInfo vi_in, *vi_out;
- int out_count;
- vi_in.screen = screen_number (screen);
- vi_in.visualid = id;
- vi_out = XGetVisualInfo (dpy, (VisualScreenMask | VisualIDMask),
- &vi_in, &out_count);
- if (vi_out)
- {
- Visual *v = vi_out[0].visual;
- XFree ((char *) vi_out);
- return v;
- }
- return 0;
-}
-
-int
-get_visual_depth (dpy, visual)
- Display *dpy;
- Visual *visual;
-{
- XVisualInfo vi_in, *vi_out;
- int out_count, d;
- vi_in.screen = DefaultScreen (dpy);
- vi_in.visualid = XVisualIDFromVisual (visual);
- vi_out = XGetVisualInfo (dpy, VisualScreenMask|VisualIDMask,
- &vi_in, &out_count);
- if (! vi_out) abort ();
- d = vi_out [0].depth;
- XFree ((char *) vi_out);
- return d;
-}
-
-
-int
-get_visual_class (dpy, visual)
- Display *dpy;
- Visual *visual;
-{
- XVisualInfo vi_in, *vi_out;
- int out_count, c;
- vi_in.screen = DefaultScreen (dpy);
- vi_in.visualid = XVisualIDFromVisual (visual);
- vi_out = XGetVisualInfo (dpy, VisualScreenMask|VisualIDMask,
- &vi_in, &out_count);
- if (! vi_out) abort ();
- c = vi_out [0].class;
- XFree ((char *) vi_out);
- return c;
-}
-
-void
-describe_visual (f, dpy, visual)
- FILE *f;
- Display *dpy;
- Visual *visual;
-{
- Screen *screen = DefaultScreenOfDisplay (dpy);
- XVisualInfo vi_in, *vi_out;
- int out_count;
- vi_in.screen = screen_number (screen);
- vi_in.visualid = XVisualIDFromVisual (visual);
- vi_out = XGetVisualInfo (dpy, (VisualScreenMask | VisualIDMask),
- &vi_in, &out_count);
- if (! vi_out) abort ();
- fprintf (f, "0x%02x (%s depth: %2d, cmap: %3d)\n",
- (unsigned int) vi_out->visualid,
- (vi_out->class == StaticGray ? "StaticGray, " :
- vi_out->class == StaticColor ? "StaticColor," :
- vi_out->class == TrueColor ? "TrueColor, " :
- vi_out->class == GrayScale ? "GrayScale, " :
- vi_out->class == PseudoColor ? "PseudoColor," :
- vi_out->class == DirectColor ? "DirectColor," :
- "UNKNOWN: "),
- vi_out->depth, vi_out->colormap_size /*, vi_out->bits_per_rgb*/);
- XFree ((char *) vi_out);
-}
-
-static int
-screen_number (screen)
- Screen *screen;
-{
- Display *dpy = DisplayOfScreen (screen);
- int i;
- for (i = 0; i < ScreenCount (dpy); i++)
- if (ScreenOfDisplay (dpy, i) == screen)
- return i;
- abort ();
-}
-
-int
-visual_cells (dpy, visual)
- Display *dpy;
- Visual *visual;
-{
- XVisualInfo vi_in, *vi_out;
- int out_count, c;
- vi_in.screen = DefaultScreen (dpy);
- vi_in.visualid = XVisualIDFromVisual (visual);
- vi_out = XGetVisualInfo (dpy, VisualScreenMask|VisualIDMask,
- &vi_in, &out_count);
- if (! vi_out) abort ();
- c = vi_out [0].colormap_size;
- XFree ((char *) vi_out);
- return c;
-}
+++ /dev/null
-/* xscreensaver, Copyright (c) 1991-1993 Jamie Zawinski <jwz@netscape.com>
- *
- * Permission to use, copy, modify, distribute, and sell this software and its
- * documentation for any purpose is hereby granted without fee, provided that
- * the above copyright notice appear in all copies and that both that
- * copyright notice and this permission notice appear in supporting
- * documentation. No representations are made about the suitability of this
- * software for any purpose. It is provided "as is" without express or
- * implied warranty.
- */
-
-#include <X11/Xlib.h>
-
-#if __STDC__
-static void crossbones (Display *, Window, GC, int x, int y, int w, int h);
-#endif
-
-static void
-crossbones (dpy, window, draw_gc, x, y, w, h)
- Display *dpy;
- Window window;
- GC draw_gc;
- int x, y, w, h;
-{
- double xscale = w / 440.0;
- double yscale = h / 216.0;
- XPoint points [6];
- points [0].x = x + xscale * 20;
- points [0].y = y + yscale * 10;
- points [1].x = x + xscale * 120;
- points [1].y = y + yscale * 10;
- points [2].x = x + xscale * 243;
- points [2].y = y + yscale * 93;
- points [3].x = x + xscale * 57;
- points [3].y = y + yscale * 210;
- points [4].x = x + xscale * 20;
- points [4].y = y + yscale * 210;
- points [5].x = x + xscale * 175;
- points [5].y = y + yscale * 113;
- XFillPolygon (dpy, window, draw_gc, points, 6, Complex, CoordModeOrigin);
- points [0].x = x + xscale * 197;
- points [0].y = y + yscale * 127;
- points [1].x = x + xscale * 384;
- points [1].y = y + yscale * 10;
- points [2].x = x + xscale * 420;
- points [2].y = y + yscale * 10;
- points [3].x = x + xscale * 265;
- points [3].y = y + yscale * 108;
- points [4].x = x + xscale * 420;
- points [4].y = y + yscale * 210;
- points [5].x = x + xscale * 320;
- points [5].y = y + yscale * 210;
- XFillPolygon (dpy, window, draw_gc, points, 6, Complex, CoordModeOrigin);
-}
-
-
-void
-skull (dpy, window, draw_gc, erase_gc, x, y, w, h)
- Display *dpy;
- Window window;
- GC draw_gc, erase_gc;
- int x, y, w, h;
-{
- XPoint points [3];
- crossbones (dpy, window, draw_gc, x, y+h/2, w, h/2);
- x += w/100;
- y += h/15;
- XFillArc (dpy, window, draw_gc, (int) (x + (w * 0.3)), y, w/2, h/2,
- -40*64, 260*64);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.35)), y + h/5,
- (int) (w * 0.4), h/5);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.375)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.495)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.555)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- XFillRectangle (dpy, window, draw_gc, (int) (x + (w * 0.675)),
- (int) (y + (h * 0.425)), w / 20, h / 20);
- points [0].x = x + (w * 0.435);
- points [0].y = y + (h * 0.425);
- points [1].x = x + (w * 0.485);
- points [1].y = points [0].y;
- points [2].x = (points [0].x + points [1].x) / 2;
- points [2].y = points [0].y + h/10;
- XFillPolygon (dpy, window, draw_gc, points, 3, Complex, CoordModeOrigin);
- points [0].x = x + (w * 0.615);
- points [1].x = x + (w * 0.665);
- points [2].x = (points [0].x + points [1].x) / 2;
- XFillPolygon (dpy, window, draw_gc, points, 3, Complex, CoordModeOrigin);
- points [0].x = x + (w * 0.52);
- points [0].y = y + (h * 0.35);
- points [1].x = points [0].x - (w * 0.05);
- points [1].y = points [0].y;
- points [2].x = points [0].x;
- points [2].y = points [0].y - (w * 0.10);
- XFillPolygon (dpy, window, erase_gc, points, 3, Complex, CoordModeOrigin);
- points [0].x = x + (w * 0.57);
- points [1].x = x + (w * 0.62);
- points [2].x = points [0].x;
- XFillPolygon (dpy, window, erase_gc, points, 3, Complex, CoordModeOrigin);
- XFillArc (dpy, window, erase_gc, x + ((int) (w * 0.375)), y + h/7,
- w/10, h/10, 0, 360*64);
- XFillArc (dpy, window, erase_gc, x + ((int) (w * 0.615)), y + h/7,
- w/10, h/10, 0, 360*64);
-}
+++ /dev/null
-/* ya_random -- Yet Another Random Number Generator.
-
- The unportable mess that is rand(), random(), drand48() and friends led me
- to ask Phil Karlton <karlton@netscape.com> what the Right Thing to Do was.
- He responded with this. It is non-cryptographically secure, reasonably
- random (more so than anything that is in any C library), and very fast.
-
- I don't understand how it works at all, but he says "look at Knuth,
- Vol. 2 (original edition), page 26, Algorithm A. In this case n=55,
- k=20 and m=2^32."
-
- So there you have it.
- */
-
-#include <unistd.h> /* for getpid() */
-#include <sys/time.h> /* for gettimeofday() */
-
-
-/* The following 'random' numbers are taken from CRC, 18th Edition, page 622.
- Each array element was taken from the corresponding line in the table,
- except that a[0] was from line 100. 8s and 9s in the table were simply
- skipped. The high order digit was taken mod 4.
- */
-#define VectorSize 55
-static unsigned int a[VectorSize] = {
- 035340171546, 010401501101, 022364657325, 024130436022, 002167303062, /* 5 */
- 037570375137, 037210607110, 016272055420, 023011770546, 017143426366, /* 10 */
- 014753657433, 021657231332, 023553406142, 004236526362, 010365611275, /* 14 */
- 007117336710, 011051276551, 002362132524, 001011540233, 012162531646, /* 20 */
- 007056762337, 006631245521, 014164542224, 032633236305, 023342700176, /* 25 */
- 002433062234, 015257225043, 026762051606, 000742573230, 005366042132, /* 30 */
- 012126416411, 000520471171, 000725646277, 020116577576, 025765742604, /* 35 */
- 007633473735, 015674255275, 017555634041, 006503154145, 021576344247, /* 40 */
- 014577627653, 002707523333, 034146376720, 030060227734, 013765414060, /* 45 */
- 036072251540, 007255221037, 024364674123, 006200353166, 010126373326, /* 50 */
- 015664104320, 016401041535, 016215305520, 033115351014, 017411670323 /* 55 */
-};
-
-static int i1, i2;
-
-unsigned int ya_random()
-{
- register int ret = a[i1] + a[i2];
- a[i1] = ret;
- i1 = i1 >= VectorSize ? 0 : i1 + 1;
- i2 = i2 >= VectorSize ? 0 : i2 + 1;
- return ret;
-}
-
-void ya_rand_init(seed)
- register unsigned int seed;
-{
- int i;
- if (seed == 0)
- {
- struct timeval tp;
- struct timezone tzp;
- gettimeofday(&tp, &tzp);
- /* ignore overflow */
- seed = (999*tp.tv_sec) + (1001*tp.tv_usec) + (1003 * getpid());
- }
-
- a[0] += seed;
- for (i = 1; i < VectorSize; i++)
- {
- seed = a[i-1]*1001 + seed*999;
- a[i] += seed;
- }
-
- i1 = a[0] % VectorSize;
- i2 = (i1 + 024) % VectorSize;
-}
+++ /dev/null
-#undef random
-#undef rand
-#undef drand48
-#undef srandom
-#undef srand
-#undef srand48
-
-#define random() ya_random()
-#define srandom(i) ya_rand_init(0)
-
-#undef P
-#if __STDC__
-# define P(x)x
-#else
-# define P(x)()
-#endif
-
-extern unsigned int ya_random P((void));
-extern void ya_rand_init P((unsigned int));